F442145

General Info

Members Datasets Scaffolds Average Seq Length
430 254 399 187

Family's Representative Sequence

Representative Sequence 3300017792|Ga0163161_10026693|Ga0163161_100266932
Length 207
Sequence MRFEIRNAFFYAPKKPTHFISCAMEEINPWQTLESELKYDNNWISVTEHQVINPSGGNGIYGEVHFKNIAIGILPLDENYNTWLVGQYRYPLKAYSWEIPEGGGPLDKEPLDGAKRELLEETGMSAKYWKEIQRMHLSNSVSNELSIIYVATELIQGIAMPEETEQLVVKKLPFEEAYQMVLTGKITDSMSVAAILKAKLMILNGEL

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
4 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
5 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
6 2738541283 Pedobacter sp. OK701 Isolate Unclassified
7 2738541284 Pedobacter sp. YR016 Isolate Unclassified
8 2738541302 Pedobacter sp. CF074 Isolate Unclassified
9 2738543023 Pedobacter sp. OK628 Isolate Unclassified
10 2739367651 Pedobacter sp. OK291 Isolate Unclassified
11 2739367656 Pedobacter sp. CF523 Isolate Unclassified
12 2739367663 Pedobacter sp. YR510 Isolate Unclassified
13 2739367866 Hymenobacter sp. YR204 Isolate Unclassified
14 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
15 2818991437 Pedobacter terrae 518 Isolate Unclassified
16 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
17 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
18 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
19 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
20 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
21 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
22 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
23 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
24 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
25 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
26 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
27 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
28 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
29 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
30 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
31 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
32 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
33 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
34 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
35 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
36 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
37 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
38 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
39 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
40 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
41 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
42 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
43 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
44 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
45 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
46 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
47 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
48 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
49 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
50 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
51 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
52 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
53 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
54 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
55 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
56 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
57 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
58 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
59 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
60 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
61 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
62 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
63 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
64 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
65 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
66 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
67 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
68 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
69 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
70 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
71 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
72 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
73 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
74 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
75 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
76 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
77 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
78 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
79 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
80 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
84 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
97 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
98 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
108 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
112 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
113 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
114 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
115 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
116 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
117 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
118 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
119 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
120 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
121 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
122 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
123 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
161 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
165 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
166 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
167 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
168 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
169 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
170 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
171 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
172 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
173 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
174 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
175 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
176 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
177 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
178 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
179 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
180 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
181 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
182 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
183 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
184 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
185 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
186 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
187 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
188 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
189 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
190 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
191 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
192 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
193 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
194 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
195 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
196 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
197 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
198 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
199 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
200 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
201 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
202 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
203 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
204 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
205 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
206 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
207 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
208 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
209 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
210 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
211 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
212 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
213 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
214 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
215 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
216 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
217 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
218 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
219 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
220 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
221 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
222 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
223 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
224 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
225 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
226 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
227 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
228 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
229 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
230 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
231 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
232 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
233 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
234 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
235 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
236 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
237 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
238 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
239 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
240 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
241 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
242 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
243 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
244 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
245 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
246 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
247 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
248 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
249 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
250 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
251 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
252 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
253 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
254 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.79
Metatranscriptomes 0
Isolates 7.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.58
Nodule 0
Rhizoplane 0.93
Rhizosphere 85.58
Stem 0
Stem Tuber 0
Unclassified 7.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2665874 2162886007 Bacteria 8637
2 MBSR1b_contig_13861294 2162886012 Bacteria 1827
3 MBSR1b_contig_8776295 2162886012 Bacteria 1833
4 JGI25152J39213_1000054 3300002773 Bacteria 76796
5 JGI25150J39212_1000003 3300002774 Bacteria 508651
6 JGI25150J39212_1000004 3300002774 Bacteria 417320
7 JGI25151J46595_10000002 3300003187 Bacteria 731381
8 JGI25153J46596_10000015 3300003215 Bacteria 289820
9 rootH2_10008117 3300003320 Bacteria 30213
10 rootH2_10019662 3300003320 Bacteria 2163
11 rootL2_10200586 3300003322 Bacteria 3762
12 rootH1_10014534 3300003323 Bacteria 1408
13 JGI25160J50197_1016553 3300003354 Unclassified 2373
14 Ga0065714_10002307 3300005288 Bacteria 26043
15 Ga0065714_10002609 3300005288 Bacteria 23390
16 Ga0065714_10003190 3300005288 Bacteria 8794
17 Ga0065714_10065739 3300005288 Bacteria 8667
18 Ga0065714_10074750 3300005288 Bacteria 2994
19 Ga0065704_10001668 3300005289 Bacteria 7109
20 Ga0065704_10070323 3300005289 Bacteria 32863
21 Ga0065704_10389989 3300005289 Bacteria 751
22 Ga0065715_10138389 3300005293 Bacteria 1827
23 Ga0070690_100011440 3300005330 Bacteria 5190
24 Ga0070670_100001046 3300005331 Bacteria 21950
25 Ga0070670_100063147 3300005331 Bacteria 3178
26 Ga0070670_100621487 3300005331 Unclassified 968
27 Ga0068869_100025933 3300005334 Unclassified 4075
28 Ga0070666_10002509 3300005335 Bacteria 11106
29 Ga0070666_10016002 3300005335 Bacteria 4792
30 Ga0070666_10072525 3300005335 Bacteria 2344
31 Ga0068868_100000943 3300005338 Bacteria 19752
32 Ga0068868_100029488 3300005338 Bacteria 4201
33 Ga0070689_100120243 3300005340 Bacteria 2097
34 Ga0070689_100232029 3300005340 Bacteria 1517
35 Ga0070661_100035248 3300005344 Unclassified 3633
36 Ga0070668_100027385 3300005347 Bacteria 4328
37 Ga0070669_100019971 3300005353 Bacteria 4785
38 Ga0070671_100018604 3300005355 Bacteria 5645
39 Ga0070673_100023790 3300005364 Unclassified 4481
40 Ga0070673_100229031 3300005364 Bacteria 1611
41 Ga0070688_100033874 3300005365 Bacteria 3090
42 Ga0070667_100000753 3300005367 Bacteria 30884
43 Ga0070667_100133943 3300005367 Bacteria 2165
44 Ga0070662_100019567 3300005457 Bacteria 4597
45 Ga0070681_10033002 3300005458 Bacteria 5197
46 Ga0068867_100036065 3300005459 Bacteria 3588
47 Ga0070685_10049630 3300005466 Bacteria 2421
48 Ga0070684_100148964 3300005535 Unclassified 2119
49 Ga0068853_100082850 3300005539 Bacteria 2810
50 Ga0070672_100034631 3300005543 Unclassified 3834
51 Ga0070672_100073170 3300005543 Bacteria 2731
52 Ga0070686_100007139 3300005544 Bacteria 6227
53 Ga0070686_100558807 3300005544 Bacteria 896
54 Ga0068855_100005566 3300005563 Bacteria 15373
55 Ga0068855_100275464 3300005563 Bacteria 1870
56 Ga0070664_100000535 3300005564 Bacteria 28978
57 Ga0068857_100057396 3300005577 Bacteria 3455
58 Ga0068857_100059035 3300005577 Bacteria 3407
59 Ga0068854_100074314 3300005578 Bacteria 2493
60 Ga0068854_100678713 3300005578 Bacteria 887
61 Ga0068856_100112525 3300005614 Bacteria 2720
62 Ga0068856_100314247 3300005614 Bacteria 1584
63 Ga0068852_100066622 3300005616 Unclassified 3145
64 Ga0068852_100145797 3300005616 Unclassified 2196
65 Ga0068852_100522296 3300005616 Bacteria 1185
66 Ga0068852_100593497 3300005616 Bacteria 1111
67 Ga0068859_100055704 3300005617 Unclassified 3978
68 Ga0068859_100161135 3300005617 Bacteria 2322
69 Ga0068859_101213011 3300005617 Unclassified 831
70 Ga0068864_100000280 3300005618 Bacteria 45611
71 Ga0068864_100041723 3300005618 Unclassified 3924
72 Ga0068864_100287242 3300005618 Unclassified 1537
73 Ga0068861_100101233 3300005719 Bacteria 2292
74 Ga0068870_10380593 3300005840 Bacteria 913
75 Ga0068863_100007784 3300005841 Bacteria 10477
76 Ga0068863_100022043 3300005841 Bacteria 6082
77 Ga0068863_100106342 3300005841 Bacteria 2670
78 Ga0068858_100010366 3300005842 Bacteria 8828
79 Ga0068858_100237076 3300005842 Bacteria 1730
80 Ga0068860_100000110 3300005843 Bacteria 131175
81 Ga0068860_100169547 3300005843 Bacteria 2108
82 Ga0068860_100307533 3300005843 Bacteria 1554
83 Ga0068862_100038894 3300005844 Bacteria 4038
84 Ga0068862_100453175 3300005844 Bacteria 1210
85 Ga0081540_1003257 3300005983 Bacteria 12898
86 Ga0097621_100013112 3300006237 Bacteria 6164
87 Ga0097621_100090600 3300006237 Bacteria 2559
88 Ga0097621_100203487 3300006237 Unclassified 1720
89 Ga0068871_100007633 3300006358 Bacteria 7736
90 Ga0068871_100061389 3300006358 Bacteria 3070
91 Ga0068871_100348580 3300006358 Bacteria 1309
92 Ga0068871_100458446 3300006358 Unclassified 1144
93 Ga0075428_100770615 3300006844 Bacteria 1023
94 Ga0075430_100810725 3300006846 Unclassified 771
95 Ga0097620_100055703 3300006931 Unclassified 3978
96 Ga0097620_100161134 3300006931 Bacteria 2322
97 Ga0097620_101212771 3300006931 Unclassified 831
98 Ga0105244_10033756 3300009036 Bacteria 2696
99 Ga0105240_10000253 3300009093 Bacteria 106101
100 Ga0105240_10001160 3300009093 Bacteria 46165
101 Ga0105240_10019282 3300009093 Bacteria 9117
102 Ga0105240_10054150 3300009093 Bacteria 5029
103 Ga0105240_10278819 3300009093 Bacteria 1921
104 Ga0105240_10396443 3300009093 Bacteria 1556
105 Ga0105240_10434414 3300009093 Bacteria 1472
106 Ga0105240_10476876 3300009093 Bacteria 1391
107 Ga0111539_10008819 3300009094 Bacteria 12781
108 Ga0105241_10000921 3300009174 Bacteria 22269
109 Ga0105241_10085379 3300009174 Bacteria 2480
110 Ga0105248_10001049 3300009177 Bacteria 30595
111 Ga0105237_10002011 3300009545 Bacteria 25894
112 Ga0105237_10004225 3300009545 Bacteria 16725
113 Ga0105237_10010869 3300009545 Bacteria 9658
114 Ga0105237_10019647 3300009545 Bacteria 6976
115 Ga0105237_10040889 3300009545 Bacteria 4676
116 Ga0105237_10439804 3300009545 Bacteria 1310
117 Ga0105238_10000806 3300009551 Bacteria 32512
118 Ga0105238_10036705 3300009551 Bacteria 4982
119 Ga0105238_10391060 3300009551 Bacteria 1383
120 Ga0105238_10599404 3300009551 Bacteria 1109
121 Ga0105238_10699937 3300009551 Bacteria 1025
122 Ga0105249_10220290 3300009553 Bacteria 1867
123 Ga0105239_10000754 3300010375 Bacteria 45868
124 Ga0105239_10002487 3300010375 Bacteria 23470
125 Ga0105239_10004525 3300010375 Bacteria 16578
126 Ga0105239_10005010 3300010375 Bacteria 15637
127 Ga0105246_10766611 3300011119 Bacteria 852
128 Ga0157373_10000262 3300013100 Bacteria 42799
129 Ga0157373_10019166 3300013100 Bacteria 4981
130 Ga0157373_10019649 3300013100 Bacteria 4914
131 Ga0157373_10205808 3300013100 Bacteria 1388
132 Ga0157371_10000117 3300013102 Bacteria 121069
133 Ga0157371_10001520 3300013102 Bacteria 23949
134 Ga0157371_10003549 3300013102 Bacteria 14071
135 Ga0157371_10009852 3300013102 Bacteria 7487
136 Ga0157370_10003772 3300013104 Bacteria 17695
137 Ga0157370_10010246 3300013104 Bacteria 9898
138 Ga0157370_10021228 3300013104 Bacteria 6473
139 Ga0157370_10031313 3300013104 Bacteria 5205
140 Ga0157370_10091862 3300013104 Bacteria 2849
141 Ga0157370_10117441 3300013104 Bacteria 2485
142 Ga0157370_10138605 3300013104 Bacteria 2267
143 Ga0157370_10178700 3300013104 Bacteria 1972
144 Ga0157370_10237416 3300013104 Bacteria 1687
145 Ga0157370_10353258 3300013104 Bacteria 1355
146 Ga0157369_10000047 3300013105 Bacteria 172682
147 Ga0157369_10038399 3300013105 Bacteria 5236
148 Ga0157374_10055245 3300013296 Unclassified 3705
149 Ga0157378_10115640 3300013297 Bacteria 2465
150 Ga0163162_10000895 3300013306 Bacteria 27750
151 Ga0163162_10001109 3300013306 Bacteria 24984
152 Ga0163162_10007084 3300013306 Bacteria 10882
153 Ga0163162_10024283 3300013306 Bacteria 5983
154 Ga0163162_10199033 3300013306 Bacteria 2132
155 Ga0163162_10204162 3300013306 Bacteria 2105
156 Ga0157372_10002664 3300013307 Bacteria 19339
157 Ga0157372_10003000 3300013307 Bacteria 18202
158 Ga0157372_10114170 3300013307 Bacteria 3096
159 Ga0157375_10003115 3300013308 Bacteria 14397
160 Ga0157375_10229172 3300013308 Bacteria 2017
161 Ga0157375_10290508 3300013308 Unclassified 1798
162 Ga0157375_10704732 3300013308 Bacteria 1163
163 Ga0163163_10023928 3300014325 Bacteria 5807
164 Ga0163163_10033136 3300014325 Bacteria 4996
165 Ga0163163_10069771 3300014325 Bacteria 3499
166 Ga0163163_10166646 3300014325 Bacteria 2249
167 Ga0163163_11463291 3300014325 Bacteria 745
168 Ga0157380_10002429 3300014326 Bacteria 12558
169 Ga0157380_10029131 3300014326 Bacteria 4218
170 Ga0182008_10000002 3300014497 Bacteria 480216
171 Ga0182008_10000132 3300014497 Bacteria 56231
172 Ga0182008_10000294 3300014497 Bacteria 39204
173 Ga0182008_10021243 3300014497 Unclassified 3335
174 Ga0182008_10029039 3300014497 Bacteria 2795
175 Ga0157377_10009180 3300014745 Bacteria 4842
176 Ga0157377_10068619 3300014745 Bacteria 2043
177 Ga0157379_10100751 3300014968 Bacteria 2593
178 Ga0157376_10338413 3300014969 Bacteria 1436
179 Ga0157376_10358738 3300014969 Unclassified 1397
180 Ga0157376_10835751 3300014969 Bacteria 935
181 Ga0182006_1000179 3300015261 Bacteria 66779
182 Ga0182006_1000182 3300015261 Bacteria 65171
183 Ga0182006_1000349 3300015261 Bacteria 38806
184 Ga0182006_1003895 3300015261 Bacteria 7480
185 Ga0182006_1012363 3300015261 Bacteria 3731
186 Ga0182007_10000005 3300015262 Bacteria 442702
187 Ga0182007_10011302 3300015262 Bacteria 3478
188 Ga0182007_10011780 3300015262 Unclassified 3389
189 Ga0182005_1000224 3300015265 Bacteria 37425
190 Ga0183373_1002 3300015682 Bacteria 990153
191 Ga0163161_10000800 3300017792 Bacteria 24627
192 Ga0163161_10000830 3300017792 Bacteria 24159
193 Ga0163161_10000838 3300017792 Bacteria 23986
194 Ga0163161_10001299 3300017792 Bacteria 18626
195 Ga0163161_10026693 3300017792 Bacteria 4091
196 Ga0163161_10049327 3300017792 Bacteria 3042
197 Ga0163161_10122115 3300017792 Bacteria 1958
198 Ga0163161_10265853 3300017792 Unclassified 1341
199 Ga0209436_103227 3300025208 Bacteria 4428
200 Ga0207425_1000003 3300025245 Bacteria 1145342
201 Ga0209129_1000014 3300025258 Bacteria 509018
202 Ga0209130_1004441 3300025284 Bacteria 5317
203 Ga0209025_1000007 3300025294 Bacteria 1145109
204 Ga0209758_1000012 3300025297 Bacteria 949866
205 Ga0207426_1000216 3300025302 Bacteria 136337
206 Ga0207680_10013256 3300025903 Bacteria 4229
207 Ga0207680_10016532 3300025903 Unclassified 3876
208 Ga0207647_10150659 3300025904 Bacteria 1360
209 Ga0207654_10005523 3300025911 Bacteria 6397
210 Ga0207654_10049820 3300025911 Bacteria 2404
211 Ga0207707_10033252 3300025912 Bacteria 4514
212 Ga0207695_10000021 3300025913 Bacteria 679399
213 Ga0207695_10001248 3300025913 Bacteria 43473
214 Ga0207695_10117833 3300025913 Bacteria 2627
215 Ga0207695_10217251 3300025913 Bacteria 1820
216 Ga0207695_10351728 3300025913 Bacteria 1360
217 Ga0207695_10417528 3300025913 Bacteria 1226
218 Ga0207671_10001328 3300025914 Bacteria 28918
219 Ga0207671_10002003 3300025914 Bacteria 22450
220 Ga0207671_10004879 3300025914 Bacteria 12608
221 Ga0207671_10012112 3300025914 Bacteria 6964
222 Ga0207671_10017094 3300025914 Bacteria 5607
223 Ga0207671_10028520 3300025914 Bacteria 4170
224 Ga0207671_10038512 3300025914 Bacteria 3543
225 Ga0207671_10300776 3300025914 Bacteria 1267
226 Ga0207671_10628697 3300025914 Bacteria 855
227 Ga0207662_10228817 3300025918 Bacteria 1213
228 Ga0207649_10013647 3300025920 Unclassified 4540
229 Ga0207681_10008265 3300025923 Bacteria 6363
230 Ga0207694_10004674 3300025924 Bacteria 10660
231 Ga0207694_10155241 3300025924 Bacteria 1846
232 Ga0207694_10364654 3300025924 Bacteria 1197
233 Ga0207650_10005416 3300025925 Bacteria 8711
234 Ga0207659_10047547 3300025926 Bacteria 3035
235 Ga0207706_10028697 3300025933 Bacteria 4967
236 Ga0207670_10136494 3300025936 Bacteria 1804
237 Ga0207670_10221829 3300025936 Bacteria 1448
238 Ga0207669_10059412 3300025937 Bacteria 2338
239 Ga0207669_10334351 3300025937 Bacteria 1164
240 Ga0207691_10008214 3300025940 Bacteria 10028
241 Ga0207691_10593578 3300025940 Bacteria 938
242 Ga0207711_10051972 3300025941 Unclassified 3510
243 Ga0207689_10051812 3300025942 Bacteria 3383
244 Ga0207679_10022146 3300025945 Unclassified 4322
245 Ga0207667_10001687 3300025949 Bacteria 27830
246 Ga0207667_10153037 3300025949 Bacteria 2374
247 Ga0207651_10043095 3300025960 Bacteria 3009
248 Ga0207651_10047364 3300025960 Bacteria 2898
249 Ga0207712_10350947 3300025961 Bacteria 1226
250 Ga0207668_10038904 3300025972 Bacteria 3196
251 Ga0207640_10639763 3300025981 Bacteria 905
252 Ga0207658_10021067 3300025986 Bacteria 4520
253 Ga0207658_11238836 3300025986 Bacteria 682
254 Ga0207677_10007254 3300026023 Bacteria 6113
255 Ga0207703_10129742 3300026035 Unclassified 2175
256 Ga0207639_10033891 3300026041 Bacteria 3770
257 Ga0207639_10102644 3300026041 Bacteria 2315
258 Ga0207639_10255586 3300026041 Bacteria 1530
259 Ga0207702_10047244 3300026078 Unclassified 3627
260 Ga0207702_10426971 3300026078 Bacteria 1282
261 Ga0207702_11257484 3300026078 Bacteria 734
262 Ga0207641_10057678 3300026088 Bacteria 3303
263 Ga0207641_10063978 3300026088 Bacteria 3143
264 Ga0207641_10074571 3300026088 Unclassified 2927
265 Ga0207648_10146977 3300026089 Bacteria 2079
266 Ga0207648_10398373 3300026089 Bacteria 1247
267 Ga0207676_10000681 3300026095 Bacteria 27020
268 Ga0207676_10268474 3300026095 Bacteria 1544
269 Ga0207674_10005266 3300026116 Bacteria 15396
270 Ga0207674_10008311 3300026116 Bacteria 12012
271 Ga0207674_10056420 3300026116 Bacteria 3989
272 Ga0207675_100024802 3300026118 Bacteria 5579
273 Ga0207675_100127064 3300026118 Bacteria 2416
274 Ga0207683_10195548 3300026121 Bacteria 1837
275 Ga0207698_10002119 3300026142 Bacteria 11707
276 Ga0209999_1027476 3300027543 Bacteria 1053
277 Ga0207428_10038829 3300027907 Bacteria 3868
278 Ga0268266_10000010 3300028379 Bacteria 1030233
279 Ga0268265_10172841 3300028380 Bacteria 1848
280 Ga0268265_10239226 3300028380 Bacteria 1601
281 Ga0268264_10000052 3300028381 Bacteria 321218
282 Ga0268264_10144206 3300028381 Bacteria 2127
283 Ga0268264_10252154 3300028381 Bacteria 1640
284 Ga0307517_10042902 3300028786 Bacteria 4835
285 Ga0307517_10192610 3300028786 Bacteria 1291
286 Ga0307517_10276061 3300028786 Unclassified 962
287 Ga0307511_10000362 3300030521 Bacteria 48275
288 Ga0265328_10136927 3300031239 Unclassified 918
289 Ga0265325_10081751 3300031241 Bacteria 1605
290 Ga0265331_10035939 3300031250 Bacteria 2435
291 Ga0265331_10064999 3300031250 Bacteria 1716
292 Ga0265316_10098874 3300031344 Bacteria 2220
293 Ga0307509_10059632 3300031507 Bacteria 4038
294 Ga0307509_10252917 3300031507 Bacteria 1544
295 Ga0265313_10013704 3300031595 Bacteria 4841
296 Ga0265314_10016016 3300031711 Bacteria 5936
297 Ga0307516_10001001 3300031730 Bacteria 39099
298 Ga0307405_10000009 3300031731 Bacteria 259388
299 Ga0307407_10000001 3300031903 Bacteria 570048
300 Ga0307412_10000050 3300031911 Bacteria 151527
301 Ga0307409_100000833 3300031995 Bacteria 14214
302 Ga0307416_100000008 3300032002 Bacteria 401343
303 Ga0307414_10000344 3300032004 Bacteria 26282
304 Ga0307414_10008697 3300032004 Bacteria 5782
305 Ga0307414_10054450 3300032004 Bacteria 2796
306 Ga0307414_10075067 3300032004 Bacteria 2452
307 Ga0307414_10208467 3300032004 Bacteria 1595
308 Ga0307414_10243063 3300032004 Unclassified 1491
309 Ga0307414_10979769 3300032004 Unclassified 778
310 Ga0307510_10400876 3300033180 Unclassified 815
311 Ga0373934_0114167 3300035086 Bacteria 1097
312 Ga0373953_0336146 3300035117 Unclassified 661
313 Ga0373954_0109135 3300035118 Bacteria 1338
314 Ga0373957_0323520 3300035120 Unclassified 656
315 Ga0373924_0163806 3300035410 Bacteria 976
316 Ga0373937_0005809 3300036401 Bacteria 10609
317 Ga0436365_1622828 3300039437 Bacteria 27494
318 Ga0466965_0007953 3300044683 Bacteria 4889
319 Ga0466961_0142202 3300044693 Bacteria 1501
320 Ga0453684_0033562 3300044712 Bacteria 7151
321 Ga0466968_0006457 3300044735 Bacteria 4421
322 Ga0466970_0034012 3300044765 Bacteria 2697
323 Ga0466970_0101840 3300044765 Bacteria 1564
324 Ga0466957_0356196 3300044842 Bacteria 994
325 Ga0466959_0000420 3300045049 Bacteria 24757
326 Ga0466958_0387707 3300045836 Bacteria 901
327 Ga0495592_0075682 3300046454 Bacteria 2444
328 Ga0495638_0067980 3300046460 Bacteria 2186
329 Ga0495638_0274153 3300046460 Bacteria 919
330 Ga0495651_0008762 3300046462 Bacteria 7760
331 Ga0495651_0490465 3300046462 Bacteria 788
332 Ga0495653_0003503 3300046463 Bacteria 12630
333 Ga0495662_0079139 3300046476 Unclassified 1598
334 Ga0495664_0132474 3300046477 Bacteria 1510
335 Ga0495583_0057985 3300046506 Bacteria 1740
336 Ga0495606_0002264 3300046507 Bacteria 22818
337 Ga0495606_0024744 3300046507 Bacteria 4318
338 Ga0495606_0035081 3300046507 Bacteria 3434
339 Ga0495608_0077785 3300046511 Bacteria 2159
340 Ga0495610_0000076 3300046512 Bacteria 118246
341 Ga0495610_0000696 3300046512 Bacteria 32341
342 Ga0495618_0021308 3300046514 Bacteria 3995
343 Ga0495628_0000344 3300046516 Bacteria 42305
344 Ga0495628_0477685 3300046516 Unclassified 902
345 Ga0495637_0005787 3300046520 Bacteria 6262
346 Ga0495648_0004081 3300046524 Bacteria 12598
347 Ga0495652_0002409 3300046529 Bacteria 19315
348 Ga0495586_0052749 3300046535 Bacteria 2202
349 Ga0495587_0000696 3300046536 Bacteria 22548
350 Ga0495609_0007600 3300046538 Bacteria 5388
351 Ga0495645_0012762 3300046543 Bacteria 5928
352 Ga0495633_0037364 3300046558 Bacteria 2323
353 Ga0495667_0000554 3300046559 Bacteria 23934
354 Ga0495667_0034126 3300046559 Bacteria 3402
355 Ga0495634_0472706 3300046642 Unclassified 737
356 Ga0495611_0000176 3300046648 Bacteria 46302
357 Ga0495625_0054549 3300046660 Bacteria 2854
358 Ga0495625_0106325 3300046660 Bacteria 1922
359 Ga0495625_0219369 3300046660 Bacteria 1247
360 Ga0495635_0397558 3300046663 Unclassified 916
361 Ga0495657_0000347 3300046675 Bacteria 42821
362 Ga0495657_0004862 3300046675 Bacteria 10698
363 Ga0495599_0015570 3300046678 Bacteria 4720
364 Ga0495647_0024062 3300046681 Unclassified 2215
365 Ga0495613_0079274 3300046689 Bacteria 2388
366 Ga0495670_0014786 3300046691 Bacteria 3842
367 Ga0495649_0287128 3300046694 Bacteria 840
368 Ga0495600_0007416 3300046809 Bacteria 6710
369 Ga0495660_0015470 3300046810 Bacteria 4406
370 Ga0495604_0012010 3300047317 Bacteria 6884
371 Ga0495674_0004796 3300047319 Bacteria 13012
372 Ga0495674_0033844 3300047319 Unclassified 4625
373 Ga0495674_0504958 3300047319 Unclassified 967
374 Ga0495680_0042900 3300047322 Bacteria 3585
375 Ga0495687_000039 3300047443 Bacteria 245077
376 Ga0495675_0000073 3300047444 Bacteria 69936
377 Ga0495684_0006940 3300047471 Bacteria 8793
378 Ga0495684_0076355 3300047471 Unclassified 2545
379 Ga0495686_0000046 3300047472 Bacteria 281963
380 Ga0495602_0079804 3300048088 Bacteria 2759
381 Ga0496112_0190012 3300048915 Bacteria 2016
382 Ga0496114_0312094 3300048917 Bacteria 1389
383 Ga0496115_0040339 3300048918 Bacteria 3711
384 Ga0496122_0004298 3300048925 Bacteria 17852
385 Ga0496123_0005429 3300048926 Bacteria 12835
386 Ga0501241_003024 3300049758 Bacteria 3216
387 nmdc:mga08y16_35642_c1 3300050511 Bacteria 5225
388 Ga0495619_0026067 3300053085 Unclassified 3759
389 Ga0500644_0014571 3300053088 Bacteria 2223
390 Ga0500644_0142055 3300053088 Bacteria 955
391 Ga0500646_0009260 3300053090 Bacteria 2521
392 Ga0500651_0000350 3300053093 Bacteria 25883
393 Ga0500650_0134752 3300053098 Bacteria 1147
394 Ga0500618_004885 3300053125 Bacteria 4174
395 Ga0500642_0054416 3300053130 Bacteria 1777
396 Ga0500588_0125061 3300053146 Unclassified 911
397 Ga0500633_0245316 3300053160 Bacteria 666
398 Ga0500637_0225448 3300053178 Bacteria 1058
399 Ga0500645_054990 3300053730 Unclassified 1157

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300033180 Ga0307510_10400876 Ga0307510_104008762 165
2 3300009093 Ga0105240_10434414 Ga0105240_104344143 169
3 3300009093 Ga0105240_10001160 Ga0105240_100011603 170
4 3300005564 Ga0070664_100000535 Ga0070664_10000053513 172
5 3300025945 Ga0207679_10022146 Ga0207679_100221465 172
6 3300026095 Ga0207676_10268474 Ga0207676_102684742 173
7 3300028786 Ga0307517_10276061 Ga0307517_102760612 174
8 3300013100 Ga0157373_10019166 Ga0157373_1001916610 175
9 3300025924 Ga0207694_10364654 Ga0207694_103646542 175
10 3300044735 Ga0466968_0006457 Ga0466968_0006457_2269_2829 175
11 3300046507 Ga0495606_0024744 Ga0495606_0024744_1904_2464 175
12 3300046810 Ga0495660_0015470 Ga0495660_0015470_434_994 175
13 3300009545 Ga0105237_10439804 Ga0105237_104398042 176
14 3300025914 Ga0207671_10300776 Ga0207671_103007762 176
15 3300031239 Ga0265328_10136927 Ga0265328_101369271 176
16 3300046506 Ga0495583_0057985 Ga0495583_0057985_99_659 179
17 3300053125 Ga0500618_004885 Ga0500618_004885_2667_3248 179
18 iso_pu_bacteria 2585427687 2586208799 180
19 iso_pu_bacteria 2738541283 2738759093 180
20 iso_pu_bacteria 2738541284 2738761797 180
21 iso_pu_bacteria 2738543023 2739302295 180
22 iso_pu_bacteria 2739367651 2739587032 180
23 iso_pu_bacteria 2739367656 2739618222 180
24 iso_pu_bacteria 2739367663 2739646329 180
25 iso_pu_bacteria 2775506987 2776615557 180
26 iso_pu_bacteria 2842722452 2842726509 180
27 iso_pu_bacteria 2842909656 2842911273 180
28 iso_pu_bacteria 2849281842 2849286479 180
29 iso_pu_bacteria 2857627736 2857631488 180
30 iso_pu_bacteria 2902048731 2902051303 180
31 iso_pu_bacteria 2904445276 2904448915 180
32 iso_pu_bacteria 2919186247 2919190747 180
33 iso_pu_bacteria 2939664404 2939669043 180
34 iso_pu_bacteria 2945997725 2946003190 180
35 iso_pu_bacteria 2954016120 2954020047 180
36 3300003320 rootH2_10008117 rootH2_1000811722 181
37 3300005330 Ga0070690_100011440 Ga0070690_1000114404 181
38 3300005331 Ga0070670_100001046 Ga0070670_1000010468 181
39 3300005331 Ga0070670_100621487 Ga0070670_1006214872 181
40 3300005335 Ga0070666_10002509 Ga0070666_100025094 181
41 3300005335 Ga0070666_10072525 Ga0070666_100725252 181
42 3300005338 Ga0068868_100000943 Ga0068868_1000009432 181
43 3300005338 Ga0068868_100029488 Ga0068868_1000294885 181
44 3300005340 Ga0070689_100120243 Ga0070689_1001202432 181
45 3300005344 Ga0070661_100035248 Ga0070661_1000352484 181
46 3300005355 Ga0070671_100018604 Ga0070671_1000186046 181
47 3300005364 Ga0070673_100023790 Ga0070673_1000237903 181
48 3300005367 Ga0070667_100000753 Ga0070667_10000075312 181
49 3300005367 Ga0070667_100133943 Ga0070667_1001339433 181
50 3300005458 Ga0070681_10033002 Ga0070681_100330026 181
51 3300005466 Ga0070685_10049630 Ga0070685_100496302 181
52 3300005535 Ga0070684_100148964 Ga0070684_1001489642 181
53 3300005543 Ga0070672_100034631 Ga0070672_1000346314 181
54 3300005544 Ga0070686_100007139 Ga0070686_1000071396 181
55 3300005614 Ga0068856_100112525 Ga0068856_1001125253 181
56 3300005617 Ga0068859_100055704 Ga0068859_1000557044 181
57 3300005617 Ga0068859_101213011 Ga0068859_1012130111 181
58 3300005618 Ga0068864_100000280 Ga0068864_1000002806 181
59 3300005618 Ga0068864_100287242 Ga0068864_1002872421 181
60 3300005841 Ga0068863_100007784 Ga0068863_10000778410 181
61 3300005841 Ga0068863_100106342 Ga0068863_1001063423 181
62 3300005842 Ga0068858_100010366 Ga0068858_10001036610 181
63 3300005843 Ga0068860_100169547 Ga0068860_1001695473 181
64 3300005843 Ga0068860_100307533 Ga0068860_1003075332 181
65 3300006237 Ga0097621_100090600 Ga0097621_1000906003 181
66 3300006237 Ga0097621_100203487 Ga0097621_1002034873 181
67 3300006358 Ga0068871_100348580 Ga0068871_1003485801 181
68 3300006358 Ga0068871_100458446 Ga0068871_1004584461 181
69 3300006931 Ga0097620_100055703 Ga0097620_1000557034 181
70 3300006931 Ga0097620_101212771 Ga0097620_1012127711 181
71 3300009093 Ga0105240_10019282 Ga0105240_100192823 181
72 3300009093 Ga0105240_10054150 Ga0105240_100541505 181
73 3300009177 Ga0105248_10001049 Ga0105248_100010494 181
74 3300009545 Ga0105237_10019647 Ga0105237_100196476 181
75 3300009551 Ga0105238_10391060 Ga0105238_103910602 181
76 3300010375 Ga0105239_10004525 Ga0105239_1000452513 181
77 3300013296 Ga0157374_10055245 Ga0157374_100552453 181
78 3300013306 Ga0163162_10024283 Ga0163162_100242836 181
79 3300013306 Ga0163162_10199033 Ga0163162_101990332 181
80 3300013308 Ga0157375_10003115 Ga0157375_100031153 181
81 3300013308 Ga0157375_10290508 Ga0157375_102905083 181
82 3300014325 Ga0163163_10023928 Ga0163163_100239285 181
83 3300014325 Ga0163163_10166646 Ga0163163_101666463 181
84 3300014745 Ga0157377_10068619 Ga0157377_100686193 181
85 3300014968 Ga0157379_10100751 Ga0157379_101007513 181
86 3300014969 Ga0157376_10338413 Ga0157376_103384132 181
87 3300017792 Ga0163161_10265853 Ga0163161_102658533 181
88 3300025903 Ga0207680_10016532 Ga0207680_100165324 181
89 3300025912 Ga0207707_10033252 Ga0207707_100332525 181
90 3300025913 Ga0207695_10117833 Ga0207695_101178332 181
91 3300025913 Ga0207695_10417528 Ga0207695_104175282 181
92 3300025914 Ga0207671_10012112 Ga0207671_100121126 181
93 3300025920 Ga0207649_10013647 Ga0207649_100136473 181
94 3300025925 Ga0207650_10005416 Ga0207650_100054166 181
95 3300025936 Ga0207670_10136494 Ga0207670_101364942 181
96 3300025940 Ga0207691_10008214 Ga0207691_100082148 181
97 3300025941 Ga0207711_10051972 Ga0207711_100519722 181
98 3300025960 Ga0207651_10043095 Ga0207651_100430954 181
99 3300025986 Ga0207658_10021067 Ga0207658_100210671 181
100 3300025986 Ga0207658_11238836 Ga0207658_112388361 181
101 3300026023 Ga0207677_10007254 Ga0207677_100072543 181
102 3300026035 Ga0207703_10129742 Ga0207703_101297423 181
103 3300026078 Ga0207702_11257484 Ga0207702_112574841 181
104 3300026088 Ga0207641_10057678 Ga0207641_100576782 181
105 3300026088 Ga0207641_10063978 Ga0207641_100639784 181
106 3300026089 Ga0207648_10398373 Ga0207648_103983731 181
107 3300026095 Ga0207676_10000681 Ga0207676_1000068115 181
108 3300028381 Ga0268264_10144206 Ga0268264_101442063 181
109 3300028381 Ga0268264_10252154 Ga0268264_102521542 181
110 3300035118 Ga0373954_0109135 Ga0373954_0109135_545_1111 181
111 3300035120 Ga0373957_0323520 Ga0373957_0323520_49_615 181
112 3300035410 Ga0373924_0163806 Ga0373924_0163806_323_886 181
113 3300036401 Ga0373937_0005809 Ga0373937_0005809_5417_5983 181
114 3300046462 Ga0495651_0490465 Ga0495651_0490465_67_630 181
115 3300046477 Ga0495664_0132474 Ga0495664_0132474_67_630 181
116 3300046511 Ga0495608_0077785 Ga0495608_0077785_174_740 181
117 3300046559 Ga0495667_0000554 Ga0495667_0000554_15718_16284 181
118 3300046642 Ga0495634_0472706 Ga0495634_0472706_140_706 181
119 3300046663 Ga0495635_0397558 Ga0495635_0397558_277_840 181
120 3300046675 Ga0495657_0000347 Ga0495657_0000347_33511_34077 181
121 3300046681 Ga0495647_0024062 Ga0495647_0024062_1402_1965 181
122 3300047471 Ga0495684_0076355 Ga0495684_0076355_276_842 181
123 3300053085 Ga0495619_0026067 Ga0495619_0026067_857_1423 181
124 iso_pu_bacteria 2522572158 2523105414 181
125 iso_pu_bacteria 2599185184 2599481457 181
126 iso_pu_bacteria 2818991442 2819573081 181
127 iso_pu_bacteria 2928078545 2928083238 181
128 iso_pu_bacteria 2928147474 2928152703 181
129 iso_pu_bacteria 2929177148 2929179653 181
130 iso_pu_bacteria 2945977869 2945982081 181
131 iso_pu_bacteria 2946013367 2946018531 181
132 iso_pu_bacteria 2977232053 2977234034 181
133 3300005563 Ga0068855_100275464 Ga0068855_1002754642 182
134 3300005983 Ga0081540_1003257 Ga0081540_10032578 182
135 3300006358 Ga0068871_100061389 Ga0068871_1000613892 182
136 3300009093 Ga0105240_10396443 Ga0105240_103964432 182
137 3300009545 Ga0105237_10010869 Ga0105237_1001086910 182
138 3300009551 Ga0105238_10599404 Ga0105238_105994042 182
139 3300009551 Ga0105238_10699937 Ga0105238_106999371 182
140 3300010375 Ga0105239_10000754 Ga0105239_1000075415 182
141 3300013104 Ga0157370_10178700 Ga0157370_101787003 182
142 3300013307 Ga0157372_10003000 Ga0157372_1000300014 182
143 3300014325 Ga0163163_11463291 Ga0163163_114632911 182
144 3300025913 Ga0207695_10000021 Ga0207695_10000021479 182
145 3300025913 Ga0207695_10351728 Ga0207695_103517282 182
146 3300025914 Ga0207671_10001328 Ga0207671_1000132821 182
147 3300025914 Ga0207671_10028520 Ga0207671_100285204 182
148 3300025949 Ga0207667_10153037 Ga0207667_101530372 182
149 3300044693 Ga0466961_0142202 Ga0466961_0142202_553_1107 182
150 3300044765 Ga0466970_0101840 Ga0466970_0101840_611_1165 182
151 3300045049 Ga0466959_0000420 Ga0466959_0000420_16492_17046 182
152 3300045836 Ga0466958_0387707 Ga0466958_0387707_105_659 182
153 3300046507 Ga0495606_0002264 Ga0495606_0002264_15645_16199 182
154 3300046648 Ga0495611_0000176 Ga0495611_0000176_7449_8006 182
155 3300005335 Ga0070666_10016002 Ga0070666_100160022 183
156 3300005544 Ga0070686_100558807 Ga0070686_1005588071 183
157 3300005616 Ga0068852_100145797 Ga0068852_1001457972 183
158 3300005618 Ga0068864_100041723 Ga0068864_1000417234 183
159 3300005840 Ga0068870_10380593 Ga0068870_103805931 183
160 3300005841 Ga0068863_100022043 Ga0068863_1000220432 183
161 3300005842 Ga0068858_100237076 Ga0068858_1002370762 183
162 3300006237 Ga0097621_100013112 Ga0097621_1000131123 183
163 3300006358 Ga0068871_100007633 Ga0068871_1000076335 183
164 3300009093 Ga0105240_10476876 Ga0105240_104768762 183
165 3300009545 Ga0105237_10040889 Ga0105237_100408892 183
166 3300010375 Ga0105239_10002487 Ga0105239_100024876 183
167 3300013308 Ga0157375_10704732 Ga0157375_107047322 183
168 3300014325 Ga0163163_10033136 Ga0163163_100331364 183
169 3300014325 Ga0163163_10069771 Ga0163163_100697714 183
170 3300014969 Ga0157376_10835751 Ga0157376_108357511 183
171 3300025903 Ga0207680_10013256 Ga0207680_100132564 183
172 3300025914 Ga0207671_10017094 Ga0207671_100170943 183
173 3300026041 Ga0207639_10033891 Ga0207639_100338915 183
174 3300026088 Ga0207641_10074571 Ga0207641_100745714 183
175 3300031250 Ga0265331_10035939 Ga0265331_100359393 183
176 3300031344 Ga0265316_10098874 Ga0265316_100988742 183
177 3300031711 Ga0265314_10016016 Ga0265314_100160162 183
178 3300032004 Ga0307414_10054450 Ga0307414_100544502 183
179 3300032004 Ga0307414_10208467 Ga0307414_102084673 183
180 3300035086 Ga0373934_0114167 Ga0373934_0114167_436_1008 183
181 3300035117 Ga0373953_0336146 Ga0373953_0336146_21_593 183
182 3300044683 Ga0466965_0007953 Ga0466965_0007953_2870_3430 183
183 3300044712 Ga0453684_0033562 Ga0453684_0033562_1867_2421 183
184 3300044765 Ga0466970_0034012 Ga0466970_0034012_171_731 183
185 3300044842 Ga0466957_0356196 Ga0466957_0356196_236_799 183
186 3300046476 Ga0495662_0079139 Ga0495662_0079139_758_1330 183
187 3300046514 Ga0495618_0021308 Ga0495618_0021308_241_813 183
188 3300046516 Ga0495628_0477685 Ga0495628_0477685_143_715 183
189 3300046535 Ga0495586_0052749 Ga0495586_0052749_802_1374 183
190 3300046689 Ga0495613_0079274 Ga0495613_0079274_1754_2326 183
191 3300046691 Ga0495670_0014786 Ga0495670_0014786_2933_3490 183
192 3300047319 Ga0495674_0033844 Ga0495674_0033844_3024_3596 183
193 3300047319 Ga0495674_0504958 Ga0495674_0504958_155_727 183
194 3300048917 Ga0496114_0312094 Ga0496114_0312094_552_1103 183
195 iso_pu_bacteria 2739367866 2740031196 183
196 2162886007 SwRhRL2b_contig_2665874 SwRhRL2b_0027.00000320 184
197 2162886012 MBSR1b_contig_13861294 MBSR1b_0918.00007300 184
198 2162886012 MBSR1b_contig_8776295 MBSR1b_0795.00004660 184
199 3300002773 JGI25152J39213_1000054 JGI25152J39213_100005442 184
200 3300002774 JGI25150J39212_1000003 JGI25150J39212_1000003254 184
201 3300002774 JGI25150J39212_1000004 JGI25150J39212_1000004370 184
202 3300003187 JGI25151J46595_10000002 JGI25151J46595_10000002254 184
203 3300003215 JGI25153J46596_10000015 JGI25153J46596_1000001565 184
204 3300003320 rootH2_10019662 rootH2_100196623 184
205 3300003322 rootL2_10200586 rootL2_102005866 184
206 3300003323 rootH1_10014534 rootH1_100145342 184
207 3300003354 JGI25160J50197_1016553 JGI25160J50197_10165533 184
208 3300005288 Ga0065714_10002307 Ga0065714_1000230722 184
209 3300005288 Ga0065714_10002609 Ga0065714_1000260921 184
210 3300005288 Ga0065714_10003190 Ga0065714_100031908 184
211 3300005288 Ga0065714_10065739 Ga0065714_100657397 184
212 3300005288 Ga0065714_10074750 Ga0065714_100747503 184
213 3300005289 Ga0065704_10001668 Ga0065704_100016685 184
214 3300005289 Ga0065704_10070323 Ga0065704_100703239 184
215 3300005289 Ga0065704_10389989 Ga0065704_103899891 184
216 3300005293 Ga0065715_10138389 Ga0065715_101383892 184
217 3300005331 Ga0070670_100063147 Ga0070670_1000631472 184
218 3300005334 Ga0068869_100025933 Ga0068869_1000259332 184
219 3300005340 Ga0070689_100232029 Ga0070689_1002320292 184
220 3300005347 Ga0070668_100027385 Ga0070668_1000273852 184
221 3300005353 Ga0070669_100019971 Ga0070669_1000199716 184
222 3300005364 Ga0070673_100229031 Ga0070673_1002290312 184
223 3300005365 Ga0070688_100033874 Ga0070688_1000338742 184
224 3300005457 Ga0070662_100019567 Ga0070662_1000195673 184
225 3300005459 Ga0068867_100036065 Ga0068867_1000360652 184
226 3300005539 Ga0068853_100082850 Ga0068853_1000828502 184
227 3300005543 Ga0070672_100073170 Ga0070672_1000731703 184
228 3300005563 Ga0068855_100005566 Ga0068855_10000556614 184
229 3300005577 Ga0068857_100057396 Ga0068857_1000573963 184
230 3300005577 Ga0068857_100059035 Ga0068857_1000590353 184
231 3300005578 Ga0068854_100074314 Ga0068854_1000743143 184
232 3300005578 Ga0068854_100678713 Ga0068854_1006787132 184
233 3300005614 Ga0068856_100314247 Ga0068856_1003142472 184
234 3300005616 Ga0068852_100066622 Ga0068852_1000666222 184
235 3300005616 Ga0068852_100522296 Ga0068852_1005222962 184
236 3300005616 Ga0068852_100593497 Ga0068852_1005934972 184
237 3300005617 Ga0068859_100161135 Ga0068859_1001611352 184
238 3300005719 Ga0068861_100101233 Ga0068861_1001012331 184
239 3300005843 Ga0068860_100000110 Ga0068860_10000011062 184
240 3300005844 Ga0068862_100038894 Ga0068862_1000388941 184
241 3300005844 Ga0068862_100453175 Ga0068862_1004531752 184
242 3300006844 Ga0075428_100770615 Ga0075428_1007706152 184
243 3300006846 Ga0075430_100810725 Ga0075430_1008107251 184
244 3300006931 Ga0097620_100161134 Ga0097620_1001611342 184
245 3300009036 Ga0105244_10033756 Ga0105244_100337562 184
246 3300009093 Ga0105240_10000253 Ga0105240_1000025369 184
247 3300009093 Ga0105240_10278819 Ga0105240_102788192 184
248 3300009094 Ga0111539_10008819 Ga0111539_1000881913 184
249 3300009174 Ga0105241_10000921 Ga0105241_100009218 184
250 3300009174 Ga0105241_10085379 Ga0105241_100853792 184
251 3300009545 Ga0105237_10002011 Ga0105237_1000201115 184
252 3300009545 Ga0105237_10004225 Ga0105237_100042254 184
253 3300009551 Ga0105238_10000806 Ga0105238_1000080615 184
254 3300009551 Ga0105238_10036705 Ga0105238_100367055 184
255 3300009553 Ga0105249_10220290 Ga0105249_102202902 184
256 3300010375 Ga0105239_10005010 Ga0105239_100050109 184
257 3300011119 Ga0105246_10766611 Ga0105246_107666112 184
258 3300013100 Ga0157373_10000262 Ga0157373_1000026218 184
259 3300013100 Ga0157373_10019649 Ga0157373_100196494 184
260 3300013100 Ga0157373_10205808 Ga0157373_102058081 184
261 3300013102 Ga0157371_10000117 Ga0157371_1000011752 184
262 3300013102 Ga0157371_10001520 Ga0157371_1000152014 184
263 3300013102 Ga0157371_10003549 Ga0157371_100035496 184
264 3300013102 Ga0157371_10009852 Ga0157371_100098528 184
265 3300013104 Ga0157370_10003772 Ga0157370_1000377212 184
266 3300013104 Ga0157370_10010246 Ga0157370_1001024611 184
267 3300013104 Ga0157370_10021228 Ga0157370_100212285 184
268 3300013104 Ga0157370_10031313 Ga0157370_100313132 184
269 3300013104 Ga0157370_10091862 Ga0157370_100918622 184
270 3300013104 Ga0157370_10117441 Ga0157370_101174412 184
271 3300013104 Ga0157370_10138605 Ga0157370_101386051 184
272 3300013104 Ga0157370_10237416 Ga0157370_102374162 184
273 3300013104 Ga0157370_10353258 Ga0157370_103532581 184
274 3300013105 Ga0157369_10000047 Ga0157369_1000004795 184
275 3300013105 Ga0157369_10038399 Ga0157369_100383996 184
276 3300013297 Ga0157378_10115640 Ga0157378_101156402 184
277 3300013306 Ga0163162_10000895 Ga0163162_1000089525 184
278 3300013306 Ga0163162_10001109 Ga0163162_1000110923 184
279 3300013306 Ga0163162_10007084 Ga0163162_100070844 184
280 3300013306 Ga0163162_10204162 Ga0163162_102041622 184
281 3300013307 Ga0157372_10002664 Ga0157372_1000266413 184
282 3300013307 Ga0157372_10114170 Ga0157372_101141702 184
283 3300013308 Ga0157375_10229172 Ga0157375_102291723 184
284 3300014326 Ga0157380_10002429 Ga0157380_100024297 184
285 3300014326 Ga0157380_10029131 Ga0157380_100291314 184
286 3300014497 Ga0182008_10000002 Ga0182008_10000002115 184
287 3300014497 Ga0182008_10000132 Ga0182008_100001323 184
288 3300014497 Ga0182008_10000294 Ga0182008_1000029427 184
289 3300014497 Ga0182008_10021243 Ga0182008_100212433 184
290 3300014497 Ga0182008_10029039 Ga0182008_100290392 184
291 3300014745 Ga0157377_10009180 Ga0157377_100091802 184
292 3300014969 Ga0157376_10358738 Ga0157376_103587382 184
293 3300015261 Ga0182006_1000179 Ga0182006_10001795 184
294 3300015261 Ga0182006_1000182 Ga0182006_10001825 184
295 3300015261 Ga0182006_1000349 Ga0182006_100034926 184
296 3300015261 Ga0182006_1003895 Ga0182006_10038952 184
297 3300015261 Ga0182006_1012363 Ga0182006_10123634 184
298 3300015262 Ga0182007_10000005 Ga0182007_10000005180 184
299 3300015262 Ga0182007_10011302 Ga0182007_100113024 184
300 3300015262 Ga0182007_10011780 Ga0182007_100117803 184
301 3300015265 Ga0182005_1000224 Ga0182005_100022447 184
302 3300015682 Ga0183373_1002 Ga0183373_1002768 184
303 3300017792 Ga0163161_10000800 Ga0163161_100008008 184
304 3300017792 Ga0163161_10000830 Ga0163161_100008305 184
305 3300017792 Ga0163161_10000838 Ga0163161_1000083816 184
306 3300017792 Ga0163161_10001299 Ga0163161_100012999 184
307 3300017792 Ga0163161_10026693 Ga0163161_100266932 184
308 3300017792 Ga0163161_10049327 Ga0163161_100493273 184
309 3300017792 Ga0163161_10122115 Ga0163161_101221152 184
310 3300025208 Ga0209436_103227 Ga0209436_1032274 184
311 3300025245 Ga0207425_1000003 Ga0207425_1000003588 184
312 3300025258 Ga0209129_1000014 Ga0209129_1000014245 184
313 3300025284 Ga0209130_1004441 Ga0209130_10044413 184
314 3300025294 Ga0209025_1000007 Ga0209025_1000007587 184
315 3300025297 Ga0209758_1000012 Ga0209758_1000012588 184
316 3300025302 Ga0207426_1000216 Ga0207426_10002164 184
317 3300025904 Ga0207647_10150659 Ga0207647_101506591 184
318 3300025911 Ga0207654_10005523 Ga0207654_100055237 184
319 3300025911 Ga0207654_10049820 Ga0207654_100498202 184
320 3300025913 Ga0207695_10001248 Ga0207695_1000124811 184
321 3300025913 Ga0207695_10217251 Ga0207695_102172512 184
322 3300025914 Ga0207671_10002003 Ga0207671_1000200314 184
323 3300025914 Ga0207671_10004879 Ga0207671_100048792 184
324 3300025914 Ga0207671_10038512 Ga0207671_100385121 184
325 3300025914 Ga0207671_10628697 Ga0207671_106286971 184
326 3300025918 Ga0207662_10228817 Ga0207662_102288172 184
327 3300025923 Ga0207681_10008265 Ga0207681_100082658 184
328 3300025924 Ga0207694_10004674 Ga0207694_100046748 184
329 3300025924 Ga0207694_10155241 Ga0207694_101552412 184
330 3300025926 Ga0207659_10047547 Ga0207659_100475472 184
331 3300025933 Ga0207706_10028697 Ga0207706_100286973 184
332 3300025936 Ga0207670_10221829 Ga0207670_102218292 184
333 3300025937 Ga0207669_10059412 Ga0207669_100594121 184
334 3300025937 Ga0207669_10334351 Ga0207669_103343512 184
335 3300025940 Ga0207691_10593578 Ga0207691_105935782 184
336 3300025942 Ga0207689_10051812 Ga0207689_100518122 184
337 3300025949 Ga0207667_10001687 Ga0207667_1000168718 184
338 3300025960 Ga0207651_10047364 Ga0207651_100473644 184
339 3300025961 Ga0207712_10350947 Ga0207712_103509472 184
340 3300025972 Ga0207668_10038904 Ga0207668_100389044 184
341 3300025981 Ga0207640_10639763 Ga0207640_106397632 184
342 3300026041 Ga0207639_10102644 Ga0207639_101026443 184
343 3300026041 Ga0207639_10255586 Ga0207639_102555862 184
344 3300026078 Ga0207702_10047244 Ga0207702_100472443 184
345 3300026078 Ga0207702_10426971 Ga0207702_104269712 184
346 3300026089 Ga0207648_10146977 Ga0207648_101469772 184
347 3300026116 Ga0207674_10005266 Ga0207674_100052663 184
348 3300026116 Ga0207674_10008311 Ga0207674_1000831112 184
349 3300026116 Ga0207674_10056420 Ga0207674_100564203 184
350 3300026118 Ga0207675_100024802 Ga0207675_1000248023 184
351 3300026118 Ga0207675_100127064 Ga0207675_1001270641 184
352 3300026121 Ga0207683_10195548 Ga0207683_101955482 184
353 3300026142 Ga0207698_10002119 Ga0207698_100021192 184
354 3300027543 Ga0209999_1027476 Ga0209999_10274761 184
355 3300027907 Ga0207428_10038829 Ga0207428_100388292 184
356 3300028379 Ga0268266_10000010 Ga0268266_10000010723 184
357 3300028380 Ga0268265_10172841 Ga0268265_101728413 184
358 3300028380 Ga0268265_10239226 Ga0268265_102392262 184
359 3300028381 Ga0268264_10000052 Ga0268264_1000005264 184
360 3300028786 Ga0307517_10042902 Ga0307517_100429023 184
361 3300028786 Ga0307517_10192610 Ga0307517_101926101 184
362 3300030521 Ga0307511_10000362 Ga0307511_1000036220 184
363 3300031241 Ga0265325_10081751 Ga0265325_100817512 184
364 3300031250 Ga0265331_10064999 Ga0265331_100649991 184
365 3300031507 Ga0307509_10059632 Ga0307509_100596322 184
366 3300031507 Ga0307509_10252917 Ga0307509_102529172 184
367 3300031595 Ga0265313_10013704 Ga0265313_100137044 184
368 3300031730 Ga0307516_10001001 Ga0307516_1000100118 184
369 3300031731 Ga0307405_10000009 Ga0307405_1000000992 184
370 3300031903 Ga0307407_10000001 Ga0307407_10000001270 184
371 3300031911 Ga0307412_10000050 Ga0307412_1000005062 184
372 3300031995 Ga0307409_100000833 Ga0307409_1000008332 184
373 3300032002 Ga0307416_100000008 Ga0307416_100000008119 184
374 3300032004 Ga0307414_10000344 Ga0307414_100003447 184
375 3300032004 Ga0307414_10008697 Ga0307414_100086972 184
376 3300032004 Ga0307414_10075067 Ga0307414_100750671 184
377 3300032004 Ga0307414_10243063 Ga0307414_102430632 184
378 3300032004 Ga0307414_10979769 Ga0307414_109797691 184
379 3300039437 Ga0436365_1622828 Ga0436365_1622828_14871_15428 184
380 3300046454 Ga0495592_0075682 Ga0495592_0075682_1716_2315 184
381 3300046460 Ga0495638_0067980 Ga0495638_0067980_112_696 184
382 3300046460 Ga0495638_0274153 Ga0495638_0274153_61_639 184
383 3300046462 Ga0495651_0008762 Ga0495651_0008762_5797_6396 184
384 3300046463 Ga0495653_0003503 Ga0495653_0003503_7704_8303 184
385 3300046507 Ga0495606_0035081 Ga0495606_0035081_2450_3004 184
386 3300046512 Ga0495610_0000076 Ga0495610_0000076_43799_44353 184
387 3300046512 Ga0495610_0000696 Ga0495610_0000696_24500_25054 184
388 3300046516 Ga0495628_0000344 Ga0495628_0000344_37386_37985 184
389 3300046520 Ga0495637_0005787 Ga0495637_0005787_3119_3673 184
390 3300046524 Ga0495648_0004081 Ga0495648_0004081_8414_8998 184
391 3300046529 Ga0495652_0002409 Ga0495652_0002409_8841_9440 184
392 3300046536 Ga0495587_0000696 Ga0495587_0000696_6043_6603 184
393 3300046538 Ga0495609_0007600 Ga0495609_0007600_1220_1774 184
394 3300046543 Ga0495645_0012762 Ga0495645_0012762_2524_3123 184
395 3300046558 Ga0495633_0037364 Ga0495633_0037364_441_995 184
396 3300046559 Ga0495667_0034126 Ga0495667_0034126_105_704 184
397 3300046660 Ga0495625_0054549 Ga0495625_0054549_800_1384 184
398 3300046660 Ga0495625_0106325 Ga0495625_0106325_1215_1835 184
399 3300046660 Ga0495625_0219369 Ga0495625_0219369_321_881 184
400 3300046675 Ga0495657_0004862 Ga0495657_0004862_7338_7937 184
401 3300046678 Ga0495599_0015570 Ga0495599_0015570_2425_3024 184
402 3300046694 Ga0495649_0287128 Ga0495649_0287128_73_657 184
403 3300046809 Ga0495600_0007416 Ga0495600_0007416_2002_2601 184
404 3300047317 Ga0495604_0012010 Ga0495604_0012010_3576_4175 184
405 3300047319 Ga0495674_0004796 Ga0495674_0004796_4674_5273 184
406 3300047322 Ga0495680_0042900 Ga0495680_0042900_2279_2878 184
407 3300047443 Ga0495687_000039 Ga0495687_000039_80987_81571 184
408 3300047444 Ga0495675_0000073 Ga0495675_0000073_33774_34373 184
409 3300047471 Ga0495684_0006940 Ga0495684_0006940_2906_3505 184
410 3300047472 Ga0495686_0000046 Ga0495686_0000046_272862_273428 184
411 3300048088 Ga0495602_0079804 Ga0495602_0079804_1006_1605 184
412 3300048915 Ga0496112_0190012 Ga0496112_0190012_1016_1615 184
413 3300048918 Ga0496115_0040339 Ga0496115_0040339_3116_3670 184
414 3300048925 Ga0496122_0004298 Ga0496122_0004298_5981_6544 184
415 3300048926 Ga0496123_0005429 Ga0496123_0005429_4247_4810 184
416 3300049758 Ga0501241_003024 Ga0501241_003024_61_615 184
417 3300050511 nmdc:mga08y16_35642_c1 nmdc:mga08y16_35642_c1_1362_1922 184
418 3300053088 Ga0500644_0014571 Ga0500644_0014571_1557_2141 184
419 3300053088 Ga0500644_0142055 Ga0500644_0142055_382_942 184
420 3300053090 Ga0500646_0009260 Ga0500646_0009260_1705_2289 184
421 3300053093 Ga0500651_0000350 Ga0500651_0000350_15269_15823 184
422 3300053098 Ga0500650_0134752 Ga0500650_0134752_362_922 184
423 3300053130 Ga0500642_0054416 Ga0500642_0054416_811_1395 184
424 3300053146 Ga0500588_0125061 Ga0500588_0125061_167_727 184
425 3300053160 Ga0500633_0245316 Ga0500633_0245316_41_601 184
426 3300053178 Ga0500637_0225448 Ga0500637_0225448_154_717 184
427 3300053730 Ga0500645_054990 Ga0500645_054990_156_713 184
428 iso_pu_bacteria 2738541302 2738854850 184
429 iso_pu_bacteria 2818991437 2819547485 184
430 iso_pu_bacteria 2852627209 2852631046 184

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00293

NUDIX

NUDIX domain

66

190

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
5c7q-assembly1.cif.gz_B crystal structure of the bdellovibrio bacteriovorus nucleoside diphosphate sugar hydrolase 0.9321 7 183
5c8l-assembly1.cif.gz_B crystal structure of the bdellovibrio bacteriovorus nucleoside diphosphate sugar hydrolase 0.9284 7 184
1mk1-assembly1.cif.gz_A structure of the mt-adprase in complex with adpr, a nudix enzyme 0.9217 8 184
1mqw-assembly1.cif.gz_A-2 structure of the mt-adprase in complex with three mn2+ ions and ampcpr, a nudix enzyme 0.9132 7 184
5i8u-assembly4.cif.gz_E crystal structure of the rv1700 (mt adprase) e142q mutant 0.9099 8 184
ID Description Score Start End Superfamily
5c8lB00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9284 7 184 3.90.79.10
af_Q2FY72_1_175_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9237 7 179 3.90.79.10
5c8lB00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9088 7 184 3.90.79.10
2yvmA00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9001 4 184 3.90.79.10
af_Q2FY72_1_175_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8938 7 179 3.90.79.10
ID Description Score Start End GO Terms
AF-A0A519TYR5-F1-model_v4 deleted 0.9923 2 184
AF-A0A6A2FK87-F1-model_v4 NUDIX hydrolase 0.9882 1 184 GO:0005829
GO:0006753
GO:0016787
GO:0019693
AF-A0A7C1ZXS5-F1-model_v4 GDP-mannose pyrophosphatase (GDP-mannose hydrolase) (GDPMK) 0.9866 6 180 GO:0005829
GO:0006753
GO:0016787
GO:0019693
AF-A0A4Q3C8D5-F1-model_v4 NUDIX hydrolase 0.9864 1 140 GO:0016787
AF-A0A7W0MI53-F1-model_v4 NUDIX hydrolase 0.9859 15 178 GO:0005829
GO:0006753
GO:0016787
GO:0019693

Feature Viewer

pLDDT pTM Quality
94.77 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map