F442113

General Info

Members Datasets Scaffolds Average Seq Length
430 209 860 156

Family's Representative Sequence

Representative Sequence 3300006852|Ga0075433_10068179|Ga0075433_100681792
Length 175
Sequence MTNNQRPTTNDHENVVMHMDDTAVRAQLRAMLDWREAHAGFDAAVKGLPPRLRGVVPQGLVHSAWQLVEHMRMAQADILEFCVEPKYKHKKWPEDYWPAGAEPRDSAAWEASITAFRSDRRALQDLTTDRTIDLLAKIPWGTGQTYLREILLVADHNAHHVGQLILVRRALGAWP

Samples

Sample ID Description Type Environment
1 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
69 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
70 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
71 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
72 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
73 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
74 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
75 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
76 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
79 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
80 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
87 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
99 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
100 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
106 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
107 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
108 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
158 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
159 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
162 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
163 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
164 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
165 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
166 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
167 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
168 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
169 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
170 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
171 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
172 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
173 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
174 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
175 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
176 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
177 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
178 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
179 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
180 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
181 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
182 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
183 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
184 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
185 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
186 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
187 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
188 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
189 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
191 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
192 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
193 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
194 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
195 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
196 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
197 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
198 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
199 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
200 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
201 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
202 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
203 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
204 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
205 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
206 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
207 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
208 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
209 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.91
Nodule 0
Rhizoplane 1.86
Rhizosphere 90
Stem 0
Stem Tuber 0
Unclassified 17.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075433_10068179 3300006852 Bacteria 3123
2 Ga0065704_10113736 3300005289 Unclassified 1897
3 Ga0065712_10180776 3300005290 Unclassified 1193
4 Ga0065715_10189515 3300005293 Bacteria 1424
5 Ga0065715_10322856 3300005293 Bacteria 998
6 Ga0065707_10330419 3300005295 Bacteria 950
7 Ga0065707_10430483 3300005295 Bacteria 821
8 Ga0065707_10578332 3300005295 Bacteria 703
9 Ga0070658_10075826 3300005327 Unclassified 2759
10 Ga0070658_10595163 3300005327 Unclassified 958
11 Ga0070676_10004330 3300005328 Bacteria 7459
12 Ga0070683_100183951 3300005329 Bacteria 1984
13 Ga0070683_100398097 3300005329 Bacteria 1313
14 Ga0070690_100178920 3300005330 Bacteria 1464
15 Ga0070690_100727805 3300005330 Bacteria 764
16 Ga0068869_100129844 3300005334 Bacteria 1936
17 Ga0068869_100694697 3300005334 Bacteria 867
18 Ga0070680_100004319 3300005336 Bacteria 10685
19 Ga0070680_100321059 3300005336 Unclassified 1314
20 Ga0070682_100663880 3300005337 Unclassified 831
21 Ga0068868_100074942 3300005338 Bacteria 2704
22 Ga0068868_100791698 3300005338 Bacteria 855
23 Ga0068868_100989448 3300005338 Unclassified 769
24 Ga0070689_100679199 3300005340 Unclassified 898
25 Ga0070691_10003000 3300005341 Bacteria 7560
26 Ga0070687_100017042 3300005343 Bacteria 3332
27 Ga0070687_100151675 3300005343 Unclassified 1361
28 Ga0070661_100036385 3300005344 Bacteria 3578
29 Ga0070692_10720592 3300005345 Bacteria 673
30 Ga0070668_100022459 3300005347 Bacteria 4770
31 Ga0070668_100088329 3300005347 Bacteria 2440
32 Ga0070669_100022053 3300005353 Bacteria 4556
33 Ga0070669_100071297 3300005353 Bacteria 2570
34 Ga0070675_100084467 3300005354 Bacteria 2652
35 Ga0070675_100525755 3300005354 Bacteria 1068
36 Ga0070675_100802965 3300005354 Bacteria 860
37 Ga0070675_100940213 3300005354 Bacteria 793
38 Ga0070675_101767191 3300005354 Bacteria 570
39 Ga0070671_100616684 3300005355 Bacteria 938
40 Ga0070674_100525847 3300005356 Bacteria 989
41 Ga0070674_100633018 3300005356 Bacteria 907
42 Ga0070674_100994280 3300005356 Bacteria 736
43 Ga0070674_101593141 3300005356 Unclassified 589
44 Ga0070688_100019000 3300005365 Bacteria 3977
45 Ga0070659_100231196 3300005366 Unclassified 1528
46 Ga0070659_101175371 3300005366 Bacteria 678
47 Ga0070659_101580285 3300005366 Unclassified 585
48 Ga0070709_10003199 3300005434 Bacteria 8792
49 Ga0070709_10135210 3300005434 Bacteria 1688
50 Ga0070709_10171519 3300005434 Bacteria 1516
51 Ga0070709_10175522 3300005434 Bacteria 1501
52 Ga0070709_10314915 3300005434 Bacteria 1147
53 Ga0070714_100012684 3300005435 Bacteria 6731
54 Ga0070714_100149372 3300005435 Bacteria 2104
55 Ga0070714_100158683 3300005435 Bacteria 2044
56 Ga0070713_100002222 3300005436 Bacteria 12582
57 Ga0070713_100022450 3300005436 Bacteria 4878
58 Ga0070713_100196316 3300005436 Bacteria 1821
59 Ga0070710_10008917 3300005437 Bacteria 4896
60 Ga0070701_10004798 3300005438 Bacteria 5526
61 Ga0070711_100027984 3300005439 Bacteria 3705
62 Ga0070705_100711648 3300005440 Bacteria 790
63 Ga0070705_101115073 3300005440 Bacteria 646
64 Ga0070700_100267981 3300005441 Bacteria 1233
65 Ga0070700_100344176 3300005441 Bacteria 1103
66 Ga0070700_101161728 3300005441 Bacteria 643
67 Ga0070694_100285826 3300005444 Bacteria 1259
68 Ga0070694_100356660 3300005444 Bacteria 1134
69 Ga0070694_101171876 3300005444 Bacteria 643
70 Ga0070708_100013785 3300005445 Bacteria 6634
71 Ga0070708_100812448 3300005445 Bacteria 879
72 Ga0070663_100186463 3300005455 Bacteria 1612
73 Ga0070663_100544915 3300005455 Bacteria 969
74 Ga0070662_100300192 3300005457 Bacteria 1305
75 Ga0070681_10018125 3300005458 Bacteria 7039
76 Ga0070681_10025232 3300005458 Bacteria 5979
77 Ga0070681_10335675 3300005458 Bacteria 1421
78 Ga0070681_10380137 3300005458 Unclassified 1323
79 Ga0070681_10564208 3300005458 Bacteria 1052
80 Ga0070681_10824699 3300005458 Unclassified 845
81 Ga0068867_100827637 3300005459 Bacteria 828
82 Ga0070685_10042552 3300005466 Bacteria 2592
83 Ga0070706_100004546 3300005467 Bacteria 13344
84 Ga0070706_100261127 3300005467 Bacteria 1617
85 Ga0070706_100571090 3300005467 Bacteria 1052
86 Ga0070706_101760214 3300005467 Bacteria 564
87 Ga0070707_100069750 3300005468 Bacteria 3385
88 Ga0070707_100157008 3300005468 Bacteria 2216
89 Ga0070707_100169329 3300005468 Bacteria 2129
90 Ga0070698_100096197 3300005471 Bacteria 2938
91 Ga0070698_100456164 3300005471 Bacteria 1214
92 Ga0070698_100562862 3300005471 Bacteria 1079
93 Ga0070699_100001334 3300005518 Bacteria 22713
94 Ga0070699_100005331 3300005518 Bacteria 11275
95 Ga0070699_100075091 3300005518 Bacteria 2942
96 Ga0070679_100009324 3300005530 Bacteria 9279
97 Ga0070679_100503170 3300005530 Unclassified 1155
98 Ga0070679_101022364 3300005530 Bacteria 771
99 Ga0070684_100066267 3300005535 Bacteria 3170
100 Ga0070684_100151406 3300005535 Bacteria 2102
101 Ga0070697_100022716 3300005536 Bacteria 4983
102 Ga0070697_100056052 3300005536 Bacteria 3205
103 Ga0070697_100168265 3300005536 Bacteria 1854
104 Ga0070697_100462470 3300005536 Bacteria 1106
105 Ga0070697_100518985 3300005536 Unclassified 1043
106 Ga0068853_100005190 3300005539 Bacteria 10190
107 Ga0070672_100134128 3300005543 Bacteria 2038
108 Ga0070672_100638599 3300005543 Bacteria 929
109 Ga0070686_100193501 3300005544 Bacteria 1453
110 Ga0070686_100593631 3300005544 Bacteria 872
111 Ga0070695_100006552 3300005545 Bacteria 6880
112 Ga0070695_100065561 3300005545 Bacteria 2365
113 Ga0070695_100466270 3300005545 Bacteria 971
114 Ga0070696_100008448 3300005546 Bacteria 6892
115 Ga0070696_100031357 3300005546 Bacteria 3642
116 Ga0070696_100273171 3300005546 Bacteria 1286
117 Ga0070693_100011287 3300005547 Bacteria 4497
118 Ga0070693_100232330 3300005547 Unclassified 1214
119 Ga0070704_100017410 3300005549 Bacteria 4570
120 Ga0070704_100408253 3300005549 Bacteria 1160
121 Ga0070704_101988846 3300005549 Unclassified 539
122 Ga0068855_100021982 3300005563 Bacteria 7648
123 Ga0068855_101884119 3300005563 Bacteria 606
124 Ga0068857_101577032 3300005577 Bacteria 641
125 Ga0068854_100005606 3300005578 Bacteria 7934
126 Ga0068854_100024976 3300005578 Bacteria 4099
127 Ga0068854_100381307 3300005578 Bacteria 1162
128 Ga0068854_100909594 3300005578 Bacteria 774
129 Ga0068856_100013248 3300005614 Bacteria 7985
130 Ga0068856_100554684 3300005614 Bacteria 1170
131 Ga0070702_100011460 3300005615 Bacteria 4412
132 Ga0068859_101036173 3300005617 Bacteria 902
133 Ga0068864_100400732 3300005618 Unclassified 1304
134 Ga0068861_100030484 3300005719 Bacteria 3953
135 Ga0068861_100035403 3300005719 Bacteria 3698
136 Ga0068861_100122200 3300005719 Bacteria 2102
137 Ga0068861_100251899 3300005719 Bacteria 1507
138 Ga0068870_10210540 3300005840 Bacteria 1184
139 Ga0068870_10218235 3300005840 Bacteria 1166
140 Ga0068870_10303940 3300005840 Bacteria 1008
141 Ga0068863_100128058 3300005841 Bacteria 2423
142 Ga0068863_100287808 3300005841 Bacteria 1593
143 Ga0068858_100022496 3300005842 Bacteria 5882
144 Ga0068860_101281509 3300005843 Bacteria 753
145 Ga0068862_100086906 3300005844 Bacteria 2719
146 Ga0068862_100245166 3300005844 Unclassified 1631
147 Ga0068862_100819023 3300005844 Bacteria 910
148 Ga0068862_101035611 3300005844 Bacteria 813
149 Ga0081455_10528813 3300005937 Unclassified 785
150 Ga0070717_10001114 3300006028 Bacteria 18140
151 Ga0070717_10271919 3300006028 Bacteria 1501
152 Ga0075365_10005005 3300006038 Bacteria 7098
153 Ga0075365_10152526 3300006038 Bacteria 1608
154 Ga0075368_10013759 3300006042 Bacteria 2976
155 Ga0075368_10087152 3300006042 Bacteria 1275
156 Ga0075364_10041315 3300006051 Bacteria 2994
157 Ga0075364_10041428 3300006051 Bacteria 2990
158 Ga0075364_10215459 3300006051 Bacteria 1302
159 Ga0075364_10340043 3300006051 Bacteria 1023
160 Ga0075432_10011564 3300006058 Bacteria 3000
161 Ga0075367_10004925 3300006178 Bacteria 6580
162 Ga0075367_10007622 3300006178 Bacteria 5557
163 Ga0075367_10008864 3300006178 Bacteria 5233
164 Ga0075367_10308463 3300006178 Bacteria 997
165 Ga0075367_10514453 3300006178 Unclassified 760
166 Ga0075369_10099970 3300006186 Bacteria 1301
167 Ga0075366_10001859 3300006195 Bacteria 10643
168 Ga0075366_10006026 3300006195 Bacteria 6605
169 Ga0075366_10009811 3300006195 Bacteria 5354
170 Ga0097621_101204464 3300006237 Unclassified 713
171 Ga0075370_10052165 3300006353 Bacteria 2319
172 Ga0075428_100016691 3300006844 Bacteria 8107
173 Ga0075428_100060554 3300006844 Bacteria 4145
174 Ga0075428_100461030 3300006844 Bacteria 1361
175 Ga0075431_100709912 3300006847 Bacteria 983
176 Ga0075433_10000013 3300006852 Bacteria 68708
177 Ga0075433_10184816 3300006852 Bacteria 1854
178 Ga0075433_10228410 3300006852 Bacteria 1653
179 Ga0075433_10251153 3300006852 Bacteria 1569
180 Ga0075434_100000360 3300006871 Bacteria 33046
181 Ga0075434_100000707 3300006871 Bacteria 26071
182 Ga0075434_100022952 3300006871 Bacteria 6073
183 Ga0075434_100715335 3300006871 Bacteria 1019
184 Ga0075434_101163736 3300006871 Bacteria 784
185 Ga0075429_100049500 3300006880 Bacteria 3654
186 Ga0075429_100245892 3300006880 Bacteria 1566
187 Ga0068865_100101856 3300006881 Bacteria 2103
188 Ga0068865_100923394 3300006881 Unclassified 760
189 Ga0075436_100005424 3300006914 Bacteria 8774
190 Ga0075436_100014988 3300006914 Bacteria 5314
191 Ga0075436_100043405 3300006914 Bacteria 3100
192 Ga0075436_100280235 3300006914 Bacteria 1192
193 Ga0097620_101036167 3300006931 Bacteria 902
194 Ga0075435_100000257 3300007076 Bacteria 33044
195 Ga0075435_100000262 3300007076 Bacteria 32699
196 Ga0075435_100010324 3300007076 Bacteria 6825
197 Ga0075435_100030675 3300007076 Bacteria 4229
198 Ga0075435_100178658 3300007076 Bacteria 1793
199 Ga0075435_100808804 3300007076 Unclassified 816
200 Ga0075435_101465635 3300007076 Unclassified 598
201 Ga0099794_10135332 3300007265 Bacteria 1246
202 Ga0099794_10304152 3300007265 Bacteria 826
203 Ga0099794_10661483 3300007265 Unclassified 555
204 Ga0105240_10213986 3300009093 Unclassified 2250
205 Ga0105240_10266378 3300009093 Bacteria 1975
206 Ga0105240_11472124 3300009093 Unclassified 714
207 Ga0111539_10001277 3300009094 Bacteria 33614
208 Ga0111539_10076068 3300009094 Bacteria 3953
209 Ga0111539_10098379 3300009094 Unclassified 3436
210 Ga0111539_10113943 3300009094 Bacteria 3171
211 Ga0111539_11108164 3300009094 Bacteria 920
212 Ga0105245_10224833 3300009098 Bacteria 1813
213 Ga0105245_10238287 3300009098 Unclassified 1762
214 Ga0114129_10029208 3300009147 Bacteria 7809
215 Ga0114129_10069990 3300009147 Bacteria 4892
216 Ga0114129_10162796 3300009147 Bacteria 3046
217 Ga0114129_10936763 3300009147 Bacteria 1095
218 Ga0105243_10012897 3300009148 Bacteria 6315
219 Ga0105243_12795607 3300009148 Unclassified 528
220 Ga0105241_10169059 3300009174 Unclassified 1804
221 Ga0105242_10233990 3300009176 Unclassified 1648
222 Ga0105248_10094742 3300009177 Bacteria 3361
223 Ga0105248_10157578 3300009177 Bacteria 2562
224 Ga0105238_10025215 3300009551 Bacteria 6060
225 Ga0105238_10500097 3300009551 Unclassified 1216
226 Ga0105238_10875569 3300009551 Unclassified 916
227 Ga0105249_10000341 3300009553 Bacteria 47106
228 Ga0105249_10097401 3300009553 Unclassified 2761
229 Ga0105249_10102954 3300009553 Bacteria 2688
230 Ga0105249_10283021 3300009553 Bacteria 1657
231 Ga0105249_11689015 3300009553 Unclassified 706
232 Ga0105246_10347406 3300011119 Unclassified 1214
233 Ga0157373_10266108 3300013100 Bacteria 1213
234 Ga0157370_10015563 3300013104 Bacteria 7732
235 Ga0157369_10032840 3300013105 Bacteria 5703
236 Ga0157369_10248406 3300013105 Bacteria 1857
237 Ga0157372_10006761 3300013307 Bacteria 12191
238 Ga0157372_10245781 3300013307 Bacteria 2076
239 Ga0157372_11149498 3300013307 Bacteria 898
240 Ga0157375_11121122 3300013308 Bacteria 921
241 Ga0163163_10028840 3300014325 Bacteria 5334
242 Ga0163163_10271288 3300014325 Bacteria 1748
243 Ga0157380_10135741 3300014326 Bacteria 2105
244 Ga0182008_10024095 3300014497 Bacteria 3101
245 Ga0157377_10031773 3300014745 Bacteria 2871
246 Ga0207642_10029357 3300025899 Bacteria 2276
247 Ga0207642_10643575 3300025899 Bacteria 664
248 Ga0207699_10037321 3300025906 Bacteria 2777
249 Ga0207699_10125161 3300025906 Bacteria 1668
250 Ga0207699_10132510 3300025906 Bacteria 1628
251 Ga0207699_10268359 3300025906 Unclassified 1182
252 Ga0207699_10356539 3300025906 Bacteria 1033
253 Ga0207645_10014625 3300025907 Bacteria 5244
254 Ga0207645_10172194 3300025907 Unclassified 1419
255 Ga0207643_10009635 3300025908 Bacteria 5187
256 Ga0207643_10636150 3300025908 Unclassified 688
257 Ga0207684_10225476 3300025910 Bacteria 1617
258 Ga0207684_11220653 3300025910 Bacteria 622
259 Ga0207707_10039664 3300025912 Bacteria 4116
260 Ga0207707_10095285 3300025912 Unclassified 2601
261 Ga0207707_10134797 3300025912 Bacteria 2159
262 Ga0207707_10760707 3300025912 Bacteria 809
263 Ga0207695_10128215 3300025913 Bacteria 2497
264 Ga0207695_11122653 3300025913 Bacteria 666
265 Ga0207671_10351217 3300025914 Bacteria 1169
266 Ga0207693_10359203 3300025915 Unclassified 1140
267 Ga0207693_10488152 3300025915 Bacteria 962
268 Ga0207663_10019542 3300025916 Bacteria 3820
269 Ga0207660_10210251 3300025917 Bacteria 1523
270 Ga0207662_10000477 3300025918 Bacteria 17926
271 Ga0207662_10170169 3300025918 Bacteria 1396
272 Ga0207662_10387374 3300025918 Bacteria 945
273 Ga0207652_10059760 3300025921 Bacteria 3286
274 Ga0207652_10069937 3300025921 Bacteria 3048
275 Ga0207652_11068926 3300025921 Bacteria 707
276 Ga0207646_10110269 3300025922 Bacteria 2469
277 Ga0207646_10269014 3300025922 Unclassified 1540
278 Ga0207681_10006282 3300025923 Bacteria 7295
279 Ga0207694_10014200 3300025924 Bacteria 6006
280 Ga0207650_10455421 3300025925 Bacteria 1065
281 Ga0207659_10223829 3300025926 Bacteria 1514
282 Ga0207659_10242278 3300025926 Bacteria 1459
283 Ga0207659_10363267 3300025926 Bacteria 1204
284 Ga0207659_10595756 3300025926 Bacteria 942
285 Ga0207700_10002834 3300025928 Bacteria 9973
286 Ga0207700_10028538 3300025928 Bacteria 3925
287 Ga0207700_10629187 3300025928 Unclassified 956
288 Ga0207664_10019646 3300025929 Bacteria 4997
289 Ga0207664_10420014 3300025929 Unclassified 1191
290 Ga0207644_10803466 3300025931 Bacteria 787
291 Ga0207690_10393137 3300025932 Unclassified 1104
292 Ga0207690_10517254 3300025932 Bacteria 967
293 Ga0207690_10921078 3300025932 Unclassified 725
294 Ga0207706_10686770 3300025933 Bacteria 875
295 Ga0207686_10241526 3300025934 Bacteria 1315
296 Ga0207709_10008442 3300025935 Bacteria 5697
297 Ga0207670_10129937 3300025936 Bacteria 1844
298 Ga0207669_10064123 3300025937 Bacteria 2272
299 Ga0207669_10548338 3300025937 Bacteria 933
300 Ga0207669_10638736 3300025937 Bacteria 869
301 Ga0207704_10057349 3300025938 Bacteria 2392
302 Ga0207691_10057120 3300025940 Bacteria 3553
303 Ga0207711_10086577 3300025941 Bacteria 2747
304 Ga0207711_11876303 3300025941 Unclassified 542
305 Ga0207689_10071797 3300025942 Bacteria 2843
306 Ga0207689_10107259 3300025942 Bacteria 2295
307 Ga0207661_10006415 3300025944 Bacteria 8321
308 Ga0207667_10974913 3300025949 Unclassified 836
309 Ga0207651_10001274 3300025960 Bacteria 11351
310 Ga0207651_10349463 3300025960 Bacteria 1245
311 Ga0207712_10000847 3300025961 Bacteria 22346
312 Ga0207712_10182547 3300025961 Bacteria 1649
313 Ga0207712_10192797 3300025961 Bacteria 1610
314 Ga0207668_10015157 3300025972 Bacteria 4785
315 Ga0207668_10096081 3300025972 Bacteria 2189
316 Ga0207668_10104436 3300025972 Bacteria 2112
317 Ga0207640_10022312 3300025981 Bacteria 3786
318 Ga0207658_11366736 3300025986 Unclassified 648
319 Ga0207677_10214271 3300026023 Bacteria 1540
320 Ga0207677_10748475 3300026023 Bacteria 871
321 Ga0207703_10020150 3300026035 Bacteria 5213
322 Ga0207703_10050017 3300026035 Unclassified 3381
323 Ga0207703_10603260 3300026035 Bacteria 1038
324 Ga0207678_10194516 3300026067 Unclassified 1734
325 Ga0207678_10523936 3300026067 Bacteria 1035
326 Ga0207708_10061980 3300026075 Bacteria 2856
327 Ga0207708_10081609 3300026075 Bacteria 2485
328 Ga0207708_10224171 3300026075 Bacteria 1507
329 Ga0207702_10095546 3300026078 Unclassified 2612
330 Ga0207641_10411613 3300026088 Bacteria 1300
331 Ga0207648_10001203 3300026089 Bacteria 28985
332 Ga0207648_10107698 3300026089 Bacteria 2446
333 Ga0207676_10119814 3300026095 Unclassified 2217
334 Ga0207676_10302948 3300026095 Bacteria 1460
335 Ga0207676_11534433 3300026095 Archaea 663
336 Ga0207674_11515985 3300026116 Bacteria 639
337 Ga0207675_100004655 3300026118 Bacteria 13215
338 Ga0207675_100037801 3300026118 Bacteria 4503
339 Ga0207675_100043237 3300026118 Bacteria 4207
340 Ga0207698_10110309 3300026142 Bacteria 2304
341 Ga0209813_10004812 3300027866 Bacteria 3243
342 Ga0209813_10388257 3300027866 Unclassified 560
343 Ga0207428_10000443 3300027907 Bacteria 50772
344 Ga0207428_10111470 3300027907 Unclassified 2105
345 Ga0268265_10030916 3300028380 Bacteria 3862
346 Ga0268265_10089512 3300028380 Bacteria 2455
347 Ga0268265_11825964 3300028380 Unclassified 614
348 Ga0268264_10265888 3300028381 Bacteria 1600
349 Ga0268264_11259008 3300028381 Bacteria 750
350 Ga0307413_10213743 3300031824 Unclassified 1403
351 Ga0307412_11100062 3300031911 Unclassified 707
352 Ga0307409_100905047 3300031995 Unclassified 896
353 Ga0307416_100829782 3300032002 Bacteria 1022
354 Ga0373957_0104760 3300035120 Unclassified 1135
355 Ga0373955_0124062 3300035172 Unclassified 1503
356 Ga0373937_0037112 3300036401 Bacteria 4441
357 Ga0373937_2112617 3300036401 Unclassified 509
358 Ga0395900_1533168 3300037418 Bacteria 578
359 Ga0436365_1709429 3300039437 Bacteria 889
360 Ga0439460_0003716 3300042461 Bacteria 3698
361 Ga0439460_0010933 3300042461 Bacteria 2333
362 Ga0466970_0244291 3300044765 Unclassified 1005
363 Ga0466960_0619908 3300044901 Unclassified 643
364 Ga0495582_0407054 3300046473 Unclassified 785
365 Ga0495664_0052647 3300046477 Bacteria 2420
366 Ga0495584_0498207 3300046491 Bacteria 620
367 Ga0495610_0069309 3300046512 Bacteria 1651
368 Ga0495628_0055191 3300046516 Bacteria 3130
369 Ga0495645_0002380 3300046543 Bacteria 12760
370 Ga0495658_0048644 3300046683 Unclassified 2392
371 Ga0495669_0016650 3300046684 Bacteria 3150
372 Ga0495613_0402390 3300046689 Bacteria 934
373 Ga0495672_0235413 3300047320 Bacteria 897
374 Ga0495684_0099564 3300047471 Bacteria 2198
375 Ga0496104_0577475 3300048907 Unclassified 1035
376 Ga0496109_0698602 3300048912 Bacteria 952
377 Ga0496109_1003313 3300048912 Bacteria 772
378 Ga0496110_0047867 3300048913 Bacteria 3746
379 Ga0496110_1017108 3300048913 Unclassified 736
380 Ga0496111_0055143 3300048914 Bacteria 2874
381 Ga0496112_0065874 3300048915 Bacteria 3575
382 Ga0496112_0359103 3300048915 Bacteria 1399
383 Ga0501036_0826026 3300049572 Bacteria 762
384 Ga0501067_0033279 3300049583 Bacteria 2860
385 Ga0501068_0805976 3300049584 Bacteria 616
386 nmdc:mga03683_6844_c1 3300050489 Bacteria 3925
387 nmdc:mga03683_75833_c1 3300050489 Bacteria 1445
388 nmdc:mga00v17_130672_c1 3300050491 Bacteria 1605
389 nmdc:mga00v17_134156_c1 3300050491 Bacteria 1584
390 nmdc:mga00v17_363890_c1 3300050491 Bacteria 940
391 nmdc:mga00v17_54479_c1 3300050491 Bacteria 2440
392 nmdc:mga0yw44_98412_c1 3300050492 Bacteria 1860
393 nmdc:mga0k408_3545_c1 3300050493 Bacteria 8246
394 nmdc:mga0k408_766_c1 3300050493 Bacteria 17656
395 nmdc:mga06z11_13578_c1 3300050494 Bacteria 3582
396 nmdc:mga06z11_821937_c1 3300050494 Bacteria 566
397 nmdc:mga06z11_88019_c1 3300050494 Bacteria 1681
398 nmdc:mga04h51_4893_c1 3300050495 Bacteria 3372
399 nmdc:mga07m45_65796_c1 3300050496 Bacteria 2059
400 nmdc:mga05p37_757575_c1 3300050507 Bacteria 1069
401 nmdc:mga09592_150784_c1 3300050508 Bacteria 2006
402 nmdc:mga06r32_242549_c1 3300050510 Bacteria 1789
403 nmdc:mga06r32_708029_c1 3300050510 Unclassified 972
404 nmdc:mga08y16_159834_c1 3300050511 Bacteria 2341
405 nmdc:mga08y16_1788509_c1 3300050511 Bacteria 568
406 nmdc:mga08y16_274_c1 3300050511 Bacteria 47070
407 nmdc:mga08y16_67050_c1 3300050511 Bacteria 3745
408 nmdc:mga0n895_156625_c1 3300050512 Bacteria 2309
409 nmdc:mga0n895_15_c1 3300050512 Bacteria 102361
410 nmdc:mga0n895_283997_c1 3300050512 Unclassified 1678
411 nmdc:mga0n895_707_c1 3300050512 Bacteria 23458
412 nmdc:mga0n895_850126_c1 3300050512 Unclassified 900
413 nmdc:mga0rr50_11533_c1 3300050513 Bacteria 5664
414 nmdc:mga0rr50_15_c1 3300050513 Bacteria 189079
415 nmdc:mga0rr50_277662_c1 3300050513 Bacteria 1397
416 nmdc:mga0rr50_289_c1 3300050513 Bacteria 27265
417 nmdc:mga0rr50_31028_c1 3300050513 Bacteria 3790
418 nmdc:mga0rr50_57543_c1 3300050513 Bacteria 2909
419 nmdc:mga0rr50_671350_c1 3300050513 Unclassified 884
420 nmdc:mga08x19_10134_c1 3300050514 Bacteria 5654
421 nmdc:mga08x19_2516_c1 3300050514 Bacteria 11135
422 nmdc:mga08x19_8355_c1 3300050514 Bacteria 6164
423 nmdc:mga0a205_161638_c1 3300050515 Bacteria 2136
424 nmdc:mga0a205_273182_c1 3300050515 Bacteria 1567
425 nmdc:mga0a205_28_c1 3300050515 Bacteria 82237
426 nmdc:mga0a205_409044_c1 3300050515 Bacteria 1220
427 nmdc:mga0a205_510409_c1 3300050515 Unclassified 1059
428 Ga0495601_0556206 3300053077 Bacteria 738
429 Ga0495595_0134039 3300053084 Unclassified 1212
430 Ga0495619_0017807 3300053085 Bacteria 4502
431 Ga0075433_10068179
432 Ga0065704_10113736
433 Ga0065712_10180776
434 Ga0065715_10189515
435 Ga0065715_10322856
436 Ga0065707_10330419
437 Ga0065707_10430483
438 Ga0065707_10578332
439 Ga0070658_10075826
440 Ga0070658_10595163
441 Ga0070676_10004330
442 Ga0070683_100183951
443 Ga0070683_100398097
444 Ga0070690_100178920
445 Ga0070690_100727805
446 Ga0068869_100129844
447 Ga0068869_100694697
448 Ga0070680_100004319
449 Ga0070680_100321059
450 Ga0070682_100663880
451 Ga0068868_100074942
452 Ga0068868_100791698
453 Ga0068868_100989448
454 Ga0070689_100679199
455 Ga0070691_10003000
456 Ga0070687_100017042
457 Ga0070687_100151675
458 Ga0070661_100036385
459 Ga0070692_10720592
460 Ga0070668_100022459
461 Ga0070668_100088329
462 Ga0070669_100022053
463 Ga0070669_100071297
464 Ga0070675_100084467
465 Ga0070675_100525755
466 Ga0070675_100802965
467 Ga0070675_100940213
468 Ga0070675_101767191
469 Ga0070671_100616684
470 Ga0070674_100525847
471 Ga0070674_100633018
472 Ga0070674_100994280
473 Ga0070674_101593141
474 Ga0070688_100019000
475 Ga0070659_100231196
476 Ga0070659_101175371
477 Ga0070659_101580285
478 Ga0070709_10003199
479 Ga0070709_10135210
480 Ga0070709_10171519
481 Ga0070709_10175522
482 Ga0070709_10314915
483 Ga0070714_100012684
484 Ga0070714_100149372
485 Ga0070714_100158683
486 Ga0070713_100002222
487 Ga0070713_100022450
488 Ga0070713_100196316
489 Ga0070710_10008917
490 Ga0070701_10004798
491 Ga0070711_100027984
492 Ga0070705_100711648
493 Ga0070705_101115073
494 Ga0070700_100267981
495 Ga0070700_100344176
496 Ga0070700_101161728
497 Ga0070694_100285826
498 Ga0070694_100356660
499 Ga0070694_101171876
500 Ga0070708_100013785
501 Ga0070708_100812448
502 Ga0070663_100186463
503 Ga0070663_100544915
504 Ga0070662_100300192
505 Ga0070681_10018125
506 Ga0070681_10025232
507 Ga0070681_10335675
508 Ga0070681_10380137
509 Ga0070681_10564208
510 Ga0070681_10824699
511 Ga0068867_100827637
512 Ga0070685_10042552
513 Ga0070706_100004546
514 Ga0070706_100261127
515 Ga0070706_100571090
516 Ga0070706_101760214
517 Ga0070707_100069750
518 Ga0070707_100157008
519 Ga0070707_100169329
520 Ga0070698_100096197
521 Ga0070698_100456164
522 Ga0070698_100562862
523 Ga0070699_100001334
524 Ga0070699_100005331
525 Ga0070699_100075091
526 Ga0070679_100009324
527 Ga0070679_100503170
528 Ga0070679_101022364
529 Ga0070684_100066267
530 Ga0070684_100151406
531 Ga0070697_100022716
532 Ga0070697_100056052
533 Ga0070697_100168265
534 Ga0070697_100462470
535 Ga0070697_100518985
536 Ga0068853_100005190
537 Ga0070672_100134128
538 Ga0070672_100638599
539 Ga0070686_100193501
540 Ga0070686_100593631
541 Ga0070695_100006552
542 Ga0070695_100065561
543 Ga0070695_100466270
544 Ga0070696_100008448
545 Ga0070696_100031357
546 Ga0070696_100273171
547 Ga0070693_100011287
548 Ga0070693_100232330
549 Ga0070704_100017410
550 Ga0070704_100408253
551 Ga0070704_101988846
552 Ga0068855_100021982
553 Ga0068855_101884119
554 Ga0068857_101577032
555 Ga0068854_100005606
556 Ga0068854_100024976
557 Ga0068854_100381307
558 Ga0068854_100909594
559 Ga0068856_100013248
560 Ga0068856_100554684
561 Ga0070702_100011460
562 Ga0068859_101036173
563 Ga0068864_100400732
564 Ga0068861_100030484
565 Ga0068861_100035403
566 Ga0068861_100122200
567 Ga0068861_100251899
568 Ga0068870_10210540
569 Ga0068870_10218235
570 Ga0068870_10303940
571 Ga0068863_100128058
572 Ga0068863_100287808
573 Ga0068858_100022496
574 Ga0068860_101281509
575 Ga0068862_100086906
576 Ga0068862_100245166
577 Ga0068862_100819023
578 Ga0068862_101035611
579 Ga0081455_10528813
580 Ga0070717_10001114
581 Ga0070717_10271919
582 Ga0075365_10005005
583 Ga0075365_10152526
584 Ga0075368_10013759
585 Ga0075368_10087152
586 Ga0075364_10041315
587 Ga0075364_10041428
588 Ga0075364_10215459
589 Ga0075364_10340043
590 Ga0075432_10011564
591 Ga0075367_10004925
592 Ga0075367_10007622
593 Ga0075367_10008864
594 Ga0075367_10308463
595 Ga0075367_10514453
596 Ga0075369_10099970
597 Ga0075366_10001859
598 Ga0075366_10006026
599 Ga0075366_10009811
600 Ga0097621_101204464
601 Ga0075370_10052165
602 Ga0075428_100016691
603 Ga0075428_100060554
604 Ga0075428_100461030
605 Ga0075431_100709912
606 Ga0075433_10000013
607 Ga0075433_10184816
608 Ga0075433_10228410
609 Ga0075433_10251153
610 Ga0075434_100000360
611 Ga0075434_100000707
612 Ga0075434_100022952
613 Ga0075434_100715335
614 Ga0075434_101163736
615 Ga0075429_100049500
616 Ga0075429_100245892
617 Ga0068865_100101856
618 Ga0068865_100923394
619 Ga0075436_100005424
620 Ga0075436_100014988
621 Ga0075436_100043405
622 Ga0075436_100280235
623 Ga0097620_101036167
624 Ga0075435_100000257
625 Ga0075435_100000262
626 Ga0075435_100010324
627 Ga0075435_100030675
628 Ga0075435_100178658
629 Ga0075435_100808804
630 Ga0075435_101465635
631 Ga0099794_10135332
632 Ga0099794_10304152
633 Ga0099794_10661483
634 Ga0105240_10213986
635 Ga0105240_10266378
636 Ga0105240_11472124
637 Ga0111539_10001277
638 Ga0111539_10076068
639 Ga0111539_10098379
640 Ga0111539_10113943
641 Ga0111539_11108164
642 Ga0105245_10224833
643 Ga0105245_10238287
644 Ga0114129_10029208
645 Ga0114129_10069990
646 Ga0114129_10162796
647 Ga0114129_10936763
648 Ga0105243_10012897
649 Ga0105243_12795607
650 Ga0105241_10169059
651 Ga0105242_10233990
652 Ga0105248_10094742
653 Ga0105248_10157578
654 Ga0105238_10025215
655 Ga0105238_10500097
656 Ga0105238_10875569
657 Ga0105249_10000341
658 Ga0105249_10097401
659 Ga0105249_10102954
660 Ga0105249_10283021
661 Ga0105249_11689015
662 Ga0105246_10347406
663 Ga0157373_10266108
664 Ga0157370_10015563
665 Ga0157369_10032840
666 Ga0157369_10248406
667 Ga0157372_10006761
668 Ga0157372_10245781
669 Ga0157372_11149498
670 Ga0157375_11121122
671 Ga0163163_10028840
672 Ga0163163_10271288
673 Ga0157380_10135741
674 Ga0182008_10024095
675 Ga0157377_10031773
676 Ga0207642_10029357
677 Ga0207642_10643575
678 Ga0207699_10037321
679 Ga0207699_10125161
680 Ga0207699_10132510
681 Ga0207699_10268359
682 Ga0207699_10356539
683 Ga0207645_10014625
684 Ga0207645_10172194
685 Ga0207643_10009635
686 Ga0207643_10636150
687 Ga0207684_10225476
688 Ga0207684_11220653
689 Ga0207707_10039664
690 Ga0207707_10095285
691 Ga0207707_10134797
692 Ga0207707_10760707
693 Ga0207695_10128215
694 Ga0207695_11122653
695 Ga0207671_10351217
696 Ga0207693_10359203
697 Ga0207693_10488152
698 Ga0207663_10019542
699 Ga0207660_10210251
700 Ga0207662_10000477
701 Ga0207662_10170169
702 Ga0207662_10387374
703 Ga0207652_10059760
704 Ga0207652_10069937
705 Ga0207652_11068926
706 Ga0207646_10110269
707 Ga0207646_10269014
708 Ga0207681_10006282
709 Ga0207694_10014200
710 Ga0207650_10455421
711 Ga0207659_10223829
712 Ga0207659_10242278
713 Ga0207659_10363267
714 Ga0207659_10595756
715 Ga0207700_10002834
716 Ga0207700_10028538
717 Ga0207700_10629187
718 Ga0207664_10019646
719 Ga0207664_10420014
720 Ga0207644_10803466
721 Ga0207690_10393137
722 Ga0207690_10517254
723 Ga0207690_10921078
724 Ga0207706_10686770
725 Ga0207686_10241526
726 Ga0207709_10008442
727 Ga0207670_10129937
728 Ga0207669_10064123
729 Ga0207669_10548338
730 Ga0207669_10638736
731 Ga0207704_10057349
732 Ga0207691_10057120
733 Ga0207711_10086577
734 Ga0207711_11876303
735 Ga0207689_10071797
736 Ga0207689_10107259
737 Ga0207661_10006415
738 Ga0207667_10974913
739 Ga0207651_10001274
740 Ga0207651_10349463
741 Ga0207712_10000847
742 Ga0207712_10182547
743 Ga0207712_10192797
744 Ga0207668_10015157
745 Ga0207668_10096081
746 Ga0207668_10104436
747 Ga0207640_10022312
748 Ga0207658_11366736
749 Ga0207677_10214271
750 Ga0207677_10748475
751 Ga0207703_10020150
752 Ga0207703_10050017
753 Ga0207703_10603260
754 Ga0207678_10194516
755 Ga0207678_10523936
756 Ga0207708_10061980
757 Ga0207708_10081609
758 Ga0207708_10224171
759 Ga0207702_10095546
760 Ga0207641_10411613
761 Ga0207648_10001203
762 Ga0207648_10107698
763 Ga0207676_10119814
764 Ga0207676_10302948
765 Ga0207676_11534433
766 Ga0207674_11515985
767 Ga0207675_100004655
768 Ga0207675_100037801
769 Ga0207675_100043237
770 Ga0207698_10110309
771 Ga0209813_10004812
772 Ga0209813_10388257
773 Ga0207428_10000443
774 Ga0207428_10111470
775 Ga0268265_10030916
776 Ga0268265_10089512
777 Ga0268265_11825964
778 Ga0268264_10265888
779 Ga0268264_11259008
780 Ga0307413_10213743
781 Ga0307412_11100062
782 Ga0307409_100905047
783 Ga0307416_100829782
784 Ga0373957_0104760
785 Ga0373955_0124062
786 Ga0373937_0037112
787 Ga0373937_2112617
788 Ga0395900_1533168
789 Ga0436365_1709429
790 Ga0439460_0003716
791 Ga0439460_0010933
792 Ga0466970_0244291
793 Ga0466960_0619908
794 Ga0495582_0407054
795 Ga0495664_0052647
796 Ga0495584_0498207
797 Ga0495610_0069309
798 Ga0495628_0055191
799 Ga0495645_0002380
800 Ga0495658_0048644
801 Ga0495669_0016650
802 Ga0495613_0402390
803 Ga0495672_0235413
804 Ga0495684_0099564
805 Ga0496104_0577475
806 Ga0496109_0698602
807 Ga0496109_1003313
808 Ga0496110_0047867
809 Ga0496110_1017108
810 Ga0496111_0055143
811 Ga0496112_0065874
812 Ga0496112_0359103
813 Ga0501036_0826026
814 Ga0501067_0033279
815 Ga0501068_0805976
816 nmdc:mga03683_6844_c1
817 nmdc:mga03683_75833_c1
818 nmdc:mga00v17_130672_c1
819 nmdc:mga00v17_134156_c1
820 nmdc:mga00v17_363890_c1
821 nmdc:mga00v17_54479_c1
822 nmdc:mga0yw44_98412_c1
823 nmdc:mga0k408_3545_c1
824 nmdc:mga0k408_766_c1
825 nmdc:mga06z11_13578_c1
826 nmdc:mga06z11_821937_c1
827 nmdc:mga06z11_88019_c1
828 nmdc:mga04h51_4893_c1
829 nmdc:mga07m45_65796_c1
830 nmdc:mga05p37_757575_c1
831 nmdc:mga09592_150784_c1
832 nmdc:mga06r32_242549_c1
833 nmdc:mga06r32_708029_c1
834 nmdc:mga08y16_159834_c1
835 nmdc:mga08y16_1788509_c1
836 nmdc:mga08y16_274_c1
837 nmdc:mga08y16_67050_c1
838 nmdc:mga0n895_156625_c1
839 nmdc:mga0n895_15_c1
840 nmdc:mga0n895_283997_c1
841 nmdc:mga0n895_707_c1
842 nmdc:mga0n895_850126_c1
843 nmdc:mga0rr50_11533_c1
844 nmdc:mga0rr50_15_c1
845 nmdc:mga0rr50_277662_c1
846 nmdc:mga0rr50_289_c1
847 nmdc:mga0rr50_31028_c1
848 nmdc:mga0rr50_57543_c1
849 nmdc:mga0rr50_671350_c1
850 nmdc:mga08x19_10134_c1
851 nmdc:mga08x19_2516_c1
852 nmdc:mga08x19_8355_c1
853 nmdc:mga0a205_161638_c1
854 nmdc:mga0a205_273182_c1
855 nmdc:mga0a205_28_c1
856 nmdc:mga0a205_409044_c1
857 nmdc:mga0a205_510409_c1
858 Ga0495601_0556206
859 Ga0495595_0134039
860 Ga0495619_0017807

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05163

DinB

DinB family

19

175

0.83

PF12867

DinB_2

DinB superfamily

33

164

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dka-assembly1.cif.gz_B crystal structure of a dinb-like protein (yjoa, bsu12410) from bacillus subtilis at 2.30 a resolution 0.7162 9 157
2qnl-assembly1.cif.gz_A-2 crystal structure of a putative dna damage-inducible protein (chu_0679) from cytophaga hutchinsonii atcc 33406 at 1.50 a resolution 0.6994 3 150
3dka-assembly1.cif.gz_A crystal structure of a dinb-like protein (yjoa, bsu12410) from bacillus subtilis at 2.30 a resolution 0.6972 9 152
2hkv-assembly1.cif.gz_A-2 crystal structure of a putative member of the dinb family (exig_1237) from exiguobacterium sibiricum 255-15 at 1.70 a resolution 0.684 1 154
2ou6-assembly1.cif.gz_A-2 crystal structure of a putative metalloenzyme of the duf664 family (dr_1065) from deinococcus radiodurans at 1.80 a resolution 0.6829 7 153
ID Description Score Start End Superfamily
2ou6A00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.6988 24 153 1.20.120.450
2f22B00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.6867 7 154 1.20.120.450
2hkvA01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.6758 1 154 1.20.120.450
2hkvA01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.6631 1 154 1.20.120.450
af_P71985_5_134_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.6621 7 149 1.20.120.450
ID Description Score Start End GO Terms
AF-A0A842P163-F1-model_v4 DinB family protein 0.9893 21 157
AF-A0A497P1K9-F1-model_v4 DinB-like domain-containing protein 0.9865 4 157
AF-A0A842P163-F1-model_v4 DinB family protein 0.9821 21 157
AF-A0A1F5DF68-F1-model_v4 DinB-like domain-containing protein 0.9816 7 157
AF-A0A2H6EI55-F1-model_v4 DinB superfamily protein 0.981 4 156

Map