F441922

General Info

Members Datasets Scaffolds Average Seq Length
429 230 858 132

Family's Representative Sequence

Representative Sequence 3300024225|Ga0224572_1010127|Ga0224572_10101273
Length 147
Sequence LRGIIPERDGERVREGNDRDMAAEIGISRIGQIAINAHDVDRAAAFYQDALGLKLLFKAGPGLAFFDCGGVRLMLTLPEKPEFDHPSSVLYFAVPDIQAAHARMKEKGVQFEDEPHLIAKMPDHDLWMTFFRDSEGNLLGLMCEVKR

Samples

Sample ID Description Type Environment
1 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
65 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
66 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
143 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
144 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
148 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
149 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
150 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
151 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
152 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
153 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
154 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
155 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
156 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
157 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
158 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
159 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
160 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
161 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
162 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
163 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
164 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
165 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
166 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
167 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
168 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
169 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
170 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
171 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
172 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
173 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
174 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
175 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
176 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
177 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
178 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
179 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
180 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
181 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
182 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
183 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
184 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
185 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
186 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
187 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
188 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
189 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
190 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
191 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
192 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
193 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
194 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
195 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
196 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
197 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
198 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
199 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
200 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
201 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
202 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
203 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
204 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
205 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
206 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
207 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
208 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
209 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
210 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
211 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
212 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
213 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
214 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
215 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
216 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
217 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
218 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
219 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
220 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
221 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
222 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
223 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
224 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
225 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
226 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
227 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
228 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
229 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
230 2919425241 Bacillus sp. 3255 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.83
Metatranscriptomes 0.47
Isolates 0.7

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.59
Rhizosphere 93.94
Stem 0
Stem Tuber 0
Unclassified 16.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0224572_1010127 3300024225 Bacteria 1769
2 Ga0065712_10317388 3300005290 Unclassified 834
3 Ga0065715_10254355 3300005293 Bacteria 1157
4 Ga0065707_10100169 3300005295 Bacteria 2950
5 Ga0065707_10409652 3300005295 Bacteria 843
6 Ga0070658_10029306 3300005327 Bacteria 4422
7 Ga0070658_10627103 3300005327 Bacteria 932
8 Ga0070676_10039313 3300005328 Bacteria 2735
9 Ga0070683_100914651 3300005329 Bacteria 842
10 Ga0070690_101430851 3300005330 Bacteria 557
11 Ga0070670_100624994 3300005331 Unclassified 965
12 Ga0070670_100881689 3300005331 Bacteria 811
13 Ga0070677_10393126 3300005333 Unclassified 729
14 Ga0068869_100328645 3300005334 Unclassified 1242
15 Ga0070666_10205815 3300005335 Bacteria 1385
16 Ga0070682_100288862 3300005337 Bacteria 1198
17 Ga0068868_100191553 3300005338 Bacteria 1701
18 Ga0068868_100426873 3300005338 Bacteria 1149
19 Ga0068868_101530730 3300005338 Unclassified 625
20 Ga0070660_100522938 3300005339 Bacteria 988
21 Ga0070689_100616865 3300005340 Bacteria 941
22 Ga0070687_100082312 3300005343 Bacteria 1760
23 Ga0070687_100453269 3300005343 Unclassified 854
24 Ga0070687_101004620 3300005343 Unclassified 605
25 Ga0070661_100364618 3300005344 Bacteria 1136
26 Ga0070661_100878653 3300005344 Unclassified 739
27 Ga0070692_10396327 3300005345 Unclassified 870
28 Ga0070692_11035229 3300005345 Bacteria 576
29 Ga0070668_100107206 3300005347 Unclassified 2221
30 Ga0070668_101118018 3300005347 Bacteria 712
31 Ga0070669_100065793 3300005353 Bacteria 2671
32 Ga0070675_100160221 3300005354 Bacteria 1934
33 Ga0070675_100423205 3300005354 Unclassified 1191
34 Ga0070675_101832612 3300005354 Unclassified 560
35 Ga0070674_100003987 3300005356 Bacteria 8366
36 Ga0070673_100826187 3300005364 Unclassified 857
37 Ga0070673_101447519 3300005364 Unclassified 647
38 Ga0070673_102269263 3300005364 Bacteria 516
39 Ga0070688_100162146 3300005365 Bacteria 1537
40 Ga0070688_100239847 3300005365 Bacteria 1286
41 Ga0070659_100872642 3300005366 Bacteria 785
42 Ga0070709_10002008 3300005434 Bacteria 11069
43 Ga0070714_100001532 3300005435 Bacteria 16858
44 Ga0070713_100000060 3300005436 Bacteria 69784
45 Ga0070713_100364847 3300005436 Bacteria 1343
46 Ga0070710_10070130 3300005437 Unclassified 2018
47 Ga0070711_100000525 3300005439 Bacteria 19885
48 Ga0070711_100483707 3300005439 Bacteria 1018
49 Ga0070705_100080241 3300005440 Bacteria 2001
50 Ga0070705_100272030 3300005440 Bacteria 1200
51 Ga0070700_100919240 3300005441 Bacteria 714
52 Ga0070694_100036501 3300005444 Bacteria 3256
53 Ga0070694_100419605 3300005444 Bacteria 1051
54 Ga0070708_100629628 3300005445 Bacteria 1011
55 Ga0070708_100634287 3300005445 Bacteria 1007
56 Ga0070708_100892379 3300005445 Bacteria 835
57 Ga0070678_100161851 3300005456 Bacteria 1814
58 Ga0070678_100639467 3300005456 Bacteria 953
59 Ga0070662_100074761 3300005457 Bacteria 2508
60 Ga0068867_100170292 3300005459 Bacteria 1724
61 Ga0068867_100251335 3300005459 Bacteria 1438
62 Ga0068867_100275800 3300005459 Bacteria 1377
63 Ga0068867_100657733 3300005459 Bacteria 920
64 Ga0068867_102263074 3300005459 Bacteria 516
65 Ga0070706_100027884 3300005467 Bacteria 5194
66 Ga0070706_100216737 3300005467 Bacteria 1787
67 Ga0070706_100286970 3300005467 Bacteria 1536
68 Ga0070706_101213253 3300005467 Unclassified 693
69 Ga0070707_100033622 3300005468 Bacteria 4889
70 Ga0070698_100391931 3300005471 Bacteria 1322
71 Ga0070698_100557901 3300005471 Unclassified 1085
72 Ga0070699_100007641 3300005518 Bacteria 9399
73 Ga0070699_100244664 3300005518 Bacteria 1602
74 Ga0070684_100609147 3300005535 Unclassified 1016
75 Ga0070684_101431198 3300005535 Unclassified 651
76 Ga0070684_101978473 3300005535 Unclassified 550
77 Ga0070697_100000208 3300005536 Bacteria 48156
78 Ga0070697_100485253 3300005536 Unclassified 1079
79 Ga0070697_100675136 3300005536 Bacteria 911
80 Ga0070672_100832172 3300005543 Bacteria 813
81 Ga0070686_100370728 3300005544 Bacteria 1081
82 Ga0070695_100031740 3300005545 Bacteria 3298
83 Ga0070695_100147753 3300005545 Bacteria 1637
84 Ga0070695_100386242 3300005545 Bacteria 1058
85 Ga0070696_100009747 3300005546 Bacteria 6427
86 Ga0070693_100369079 3300005547 Bacteria 987
87 Ga0070665_100005750 3300005548 Bacteria 12731
88 Ga0070665_100027820 3300005548 Bacteria 5693
89 Ga0070704_100045687 3300005549 Bacteria 3049
90 Ga0070704_100130175 3300005549 Bacteria 1949
91 Ga0070704_100360779 3300005549 Unclassified 1229
92 Ga0070704_100500721 3300005549 Bacteria 1054
93 Ga0070664_100157141 3300005564 Bacteria 2010
94 Ga0068857_100848427 3300005577 Bacteria 874
95 Ga0068856_100817511 3300005614 Bacteria 951
96 Ga0068852_100149126 3300005616 Bacteria 2173
97 Ga0068859_100066021 3300005617 Bacteria 3653
98 Ga0068859_100126544 3300005617 Bacteria 2624
99 Ga0068859_100724277 3300005617 Bacteria 1085
100 Ga0068859_101753471 3300005617 Bacteria 686
101 Ga0068859_102042998 3300005617 Unclassified 633
102 Ga0068864_100007906 3300005618 Bacteria 8762
103 Ga0068864_100320107 3300005618 Bacteria 1457
104 Ga0068866_10195701 3300005718 Bacteria 1204
105 Ga0068861_100265352 3300005719 Bacteria 1472
106 Ga0068861_100709994 3300005719 Bacteria 935
107 Ga0068861_102554128 3300005719 Bacteria 514
108 Ga0068863_100617510 3300005841 Bacteria 1074
109 Ga0068863_100702061 3300005841 Bacteria 1005
110 Ga0068858_100014131 3300005842 Bacteria 7529
111 Ga0068858_100023621 3300005842 Bacteria 5728
112 Ga0068858_101222620 3300005842 Bacteria 739
113 Ga0068860_100029708 3300005843 Bacteria 5258
114 Ga0068860_100400143 3300005843 Bacteria 1358
115 Ga0068860_101146405 3300005843 Bacteria 797
116 Ga0068862_100015507 3300005844 Bacteria 6328
117 Ga0068862_100230949 3300005844 Bacteria 1678
118 Ga0068862_100504469 3300005844 Bacteria 1149
119 Ga0068862_100623637 3300005844 Bacteria 1038
120 Ga0068862_101551038 3300005844 Bacteria 668
121 Ga0081455_10055887 3300005937 Archaea 3355
122 Ga0081455_10619811 3300005937 Bacteria 702
123 Ga0070717_10001316 3300006028 Bacteria 17016
124 Ga0070717_10001433 3300006028 Bacteria 16433
125 Ga0075432_10088991 3300006058 Bacteria 1128
126 Ga0070716_100001249 3300006173 Bacteria 11202
127 Ga0070716_100404296 3300006173 Unclassified 983
128 Ga0070712_100001236 3300006175 Bacteria 15444
129 Ga0070712_100166626 3300006175 Bacteria 1706
130 Ga0097621_100604201 3300006237 Bacteria 1003
131 Ga0097621_100633275 3300006237 Bacteria 980
132 Ga0068871_100004097 3300006358 Bacteria 10080
133 Ga0068871_101972273 3300006358 Unclassified 555
134 Ga0075428_100018875 3300006844 Bacteria 7626
135 Ga0075428_100685163 3300006844 Bacteria 1092
136 Ga0075431_100120257 3300006847 Bacteria 2710
137 Ga0075433_10048903 3300006852 Bacteria 3678
138 Ga0075433_10053604 3300006852 Bacteria 3517
139 Ga0075433_10125985 3300006852 Bacteria 2274
140 Ga0075433_10725136 3300006852 Bacteria 870
141 Ga0075433_10859931 3300006852 Bacteria 791
142 Ga0075433_10921937 3300006852 Bacteria 762
143 Ga0075434_100150575 3300006871 Bacteria 2347
144 Ga0075434_100216661 3300006871 Bacteria 1934
145 Ga0075434_100360615 3300006871 Bacteria 1474
146 Ga0075434_101007092 3300006871 Unclassified 847
147 Ga0075429_100383299 3300006880 Bacteria 1231
148 Ga0068865_100017850 3300006881 Bacteria 4569
149 Ga0068865_100025683 3300006881 Bacteria 3877
150 Ga0075436_100002061 3300006914 Bacteria 13860
151 Ga0097620_100066022 3300006931 Bacteria 3653
152 Ga0097620_100126541 3300006931 Bacteria 2624
153 Ga0097620_100724302 3300006931 Bacteria 1085
154 Ga0097620_101753747 3300006931 Bacteria 686
155 Ga0097620_102042833 3300006931 Unclassified 633
156 Ga0075435_100003680 3300007076 Bacteria 10440
157 Ga0075435_100109942 3300007076 Bacteria 2292
158 Ga0075435_100169224 3300007076 Bacteria 1843
159 Ga0075435_100309239 3300007076 Bacteria 1352
160 Ga0075435_100605535 3300007076 Unclassified 950
161 Ga0075435_100785615 3300007076 Unclassified 829
162 Ga0105240_11551114 3300009093 Bacteria 694
163 Ga0111539_10033903 3300009094 Bacteria 6195
164 Ga0111539_10159308 3300009094 Bacteria 2640
165 Ga0111539_10411569 3300009094 Bacteria 1575
166 Ga0111539_11104419 3300009094 Bacteria 921
167 Ga0111539_11203905 3300009094 Unclassified 880
168 Ga0105245_10035925 3300009098 Bacteria 4400
169 Ga0105245_10597824 3300009098 Bacteria 1129
170 Ga0105247_10140323 3300009101 Bacteria 1583
171 Ga0105247_10262468 3300009101 Bacteria 1185
172 Ga0114129_10002492 3300009147 Bacteria 25557
173 Ga0114129_10007108 3300009147 Bacteria 15926
174 Ga0114129_10039771 3300009147 Bacteria 6633
175 Ga0114129_10357692 3300009147 Bacteria 1932
176 Ga0114129_11082034 3300009147 Bacteria 1005
177 Ga0114129_12005744 3300009147 Bacteria 700
178 Ga0105243_10218487 3300009148 Bacteria 1683
179 Ga0105243_11939909 3300009148 Bacteria 622
180 Ga0105242_10010412 3300009176 Bacteria 7134
181 Ga0105248_10002581 3300009177 Bacteria 20127
182 Ga0105248_10186494 3300009177 Bacteria 2337
183 Ga0105248_10276415 3300009177 Bacteria 1891
184 Ga0105248_10452749 3300009177 Unclassified 1446
185 Ga0105248_10584815 3300009177 Bacteria 1260
186 Ga0105237_10168629 3300009545 Bacteria 2189
187 Ga0105237_10779932 3300009545 Bacteria 962
188 Ga0105238_12518953 3300009551 Bacteria 550
189 Ga0105249_10102712 3300009553 Bacteria 2691
190 Ga0105249_10128010 3300009553 Bacteria 2420
191 Ga0105249_10555554 3300009553 Bacteria 1199
192 Ga0105239_10015517 3300010375 Bacteria 8436
193 Ga0105239_11419842 3300010375 Unclassified 801
194 Ga0157374_12169363 3300013296 Bacteria 582
195 Ga0157378_11511054 3300013297 Unclassified 716
196 Ga0157378_12735683 3300013297 Unclassified 546
197 Ga0163162_10221702 3300013306 Bacteria 2021
198 Ga0163162_10291573 3300013306 Bacteria 1763
199 Ga0157375_11220975 3300013308 Bacteria 882
200 Ga0157375_11576579 3300013308 Bacteria 776
201 Ga0163163_10015093 3300014325 Bacteria 7127
202 Ga0163163_10322522 3300014325 Bacteria 1598
203 Ga0163163_11119843 3300014325 Bacteria 850
204 Ga0157380_10078883 3300014326 Bacteria 2687
205 Ga0157380_10467677 3300014326 Bacteria 1216
206 Ga0157380_11896498 3300014326 Unclassified 656
207 Ga0157377_10088188 3300014745 Bacteria 1827
208 Ga0157379_10058170 3300014968 Bacteria 3456
209 Ga0157379_10165168 3300014968 Bacteria 1998
210 Ga0157379_10417498 3300014968 Bacteria 1235
211 Ga0157379_10732811 3300014968 Bacteria 930
212 Ga0157379_11851352 3300014968 Unclassified 594
213 Ga0157376_10089465 3300014969 Bacteria 2662
214 Ga0157376_11787254 3300014969 Bacteria 651
215 Ga0224572_1046139 3300024225 Unclassified 816
216 Ga0207692_10055414 3300025898 Unclassified 2029
217 Ga0207710_10330585 3300025900 Bacteria 774
218 Ga0207680_10378870 3300025903 Bacteria 997
219 Ga0207699_10002299 3300025906 Bacteria 9029
220 Ga0207645_10103248 3300025907 Unclassified 1840
221 Ga0207645_10143931 3300025907 Bacteria 1554
222 Ga0207705_10027495 3300025909 Bacteria 4057
223 Ga0207705_10512347 3300025909 Bacteria 932
224 Ga0207684_10023654 3300025910 Bacteria 5244
225 Ga0207684_10198848 3300025910 Bacteria 1729
226 Ga0207671_10269116 3300025914 Bacteria 1342
227 Ga0207671_10417224 3300025914 Bacteria 1068
228 Ga0207693_10000191 3300025915 Bacteria 56013
229 Ga0207693_10353867 3300025915 Unclassified 1149
230 Ga0207663_10001591 3300025916 Bacteria 10662
231 Ga0207662_10071227 3300025918 Bacteria 2105
232 Ga0207662_10268815 3300025918 Unclassified 1124
233 Ga0207646_10066329 3300025922 Bacteria 3222
234 Ga0207646_10159656 3300025922 Bacteria 2034
235 Ga0207646_10748593 3300025922 Bacteria 872
236 Ga0207681_10157205 3300025923 Bacteria 1710
237 Ga0207681_10862439 3300025923 Bacteria 757
238 Ga0207694_11153981 3300025924 Bacteria 656
239 Ga0207650_10212063 3300025925 Bacteria 1555
240 Ga0207650_10709304 3300025925 Bacteria 850
241 Ga0207650_11235677 3300025925 Unclassified 636
242 Ga0207687_10367974 3300025927 Bacteria 1175
243 Ga0207700_10000358 3300025928 Bacteria 26677
244 Ga0207700_10119051 3300025928 Bacteria 2138
245 Ga0207664_10004104 3300025929 Bacteria 9830
246 Ga0207644_10965923 3300025931 Bacteria 715
247 Ga0207706_10093955 3300025933 Bacteria 2638
248 Ga0207706_10223862 3300025933 Bacteria 1647
249 Ga0207706_10280076 3300025933 Bacteria 1454
250 Ga0207686_10315256 3300025934 Bacteria 1166
251 Ga0207686_10409924 3300025934 Bacteria 1034
252 Ga0207669_10488984 3300025937 Bacteria 982
253 Ga0207704_10078985 3300025938 Bacteria 2118
254 Ga0207704_11127733 3300025938 Unclassified 667
255 Ga0207665_10012260 3300025939 Bacteria 5630
256 Ga0207665_10085206 3300025939 Bacteria 2181
257 Ga0207665_11144780 3300025939 Bacteria 620
258 Ga0207691_10383327 3300025940 Bacteria 1200
259 Ga0207691_10560525 3300025940 Bacteria 968
260 Ga0207711_10007961 3300025941 Bacteria 8865
261 Ga0207711_10534625 3300025941 Bacteria 1093
262 Ga0207711_10623861 3300025941 Bacteria 1006
263 Ga0207689_10089981 3300025942 Bacteria 2521
264 Ga0207661_10976107 3300025944 Bacteria 780
265 Ga0207667_10984479 3300025949 Bacteria 831
266 Ga0207651_10172840 3300025960 Bacteria 1706
267 Ga0207712_10059742 3300025961 Bacteria 2700
268 Ga0207712_10090707 3300025961 Bacteria 2249
269 Ga0207668_10053832 3300025972 Bacteria 2791
270 Ga0207668_10074630 3300025972 Bacteria 2435
271 Ga0207668_10258407 3300025972 Unclassified 1418
272 Ga0207677_10439420 3300026023 Bacteria 1115
273 Ga0207703_10006197 3300026035 Bacteria 9571
274 Ga0207703_10053671 3300026035 Bacteria 3276
275 Ga0207708_10127574 3300026075 Bacteria 1986
276 Ga0207708_10199724 3300026075 Bacteria 1595
277 Ga0207702_10686054 3300026078 Bacteria 1009
278 Ga0207641_10929654 3300026088 Bacteria 864
279 Ga0207648_10034550 3300026089 Bacteria 4456
280 Ga0207648_10142346 3300026089 Bacteria 2114
281 Ga0207648_10244719 3300026089 Bacteria 1598
282 Ga0207676_10376706 3300026095 Bacteria 1320
283 Ga0207674_10960964 3300026116 Bacteria 823
284 Ga0207675_100239622 3300026118 Bacteria 1752
285 Ga0207675_100346025 3300026118 Bacteria 1456
286 Ga0207675_100659706 3300026118 Bacteria 1053
287 Ga0207428_10084541 3300027907 Bacteria 2473
288 Ga0207428_10432446 3300027907 Bacteria 961
289 Ga0265356_1003611 3300028017 Bacteria 1938
290 Ga0268266_10104121 3300028379 Bacteria 2505
291 Ga0268266_10382232 3300028379 Bacteria 1328
292 Ga0268266_11106342 3300028379 Bacteria 766
293 Ga0268265_10077349 3300028380 Bacteria 2613
294 Ga0268265_10540494 3300028380 Bacteria 1104
295 Ga0268265_11040393 3300028380 Bacteria 810
296 Ga0268265_11676508 3300028380 Bacteria 641
297 Ga0268264_10169546 3300028381 Bacteria 1973
298 Ga0268264_10714959 3300028381 Bacteria 996
299 Ga0265338_10032997 3300028800 Bacteria 5036
300 Ga0265338_10129345 3300028800 Bacteria 1997
301 Ga0265338_10353727 3300028800 Bacteria 1055
302 Ga0265338_10386623 3300028800 Bacteria 1000
303 Ga0265338_10470456 3300028800 Bacteria 888
304 Ga0307511_10246226 3300030521 Bacteria 865
305 Ga0265762_1000496 3300030760 Bacteria 6852
306 Ga0265770_1050854 3300030878 Unclassified 749
307 Ga0265332_10373303 3300031238 Unclassified 589
308 Ga0265340_10148761 3300031247 Bacteria 1068
309 Ga0265331_10167778 3300031250 Bacteria 994
310 Ga0265316_10087469 3300031344 Bacteria 2380
311 Ga0307412_10760498 3300031911 Unclassified 837
312 Ga0307409_100484697 3300031995 Unclassified 1201
313 Ga0307416_100717529 3300032002 Bacteria 1090
314 Ga0373934_0029586 3300035086 Bacteria 2140
315 Ga0373944_0008610 3300035089 Bacteria 2756
316 Ga0373936_0026161 3300035113 Unclassified 2285
317 Ga0373945_0059193 3300035116 Bacteria 1426
318 Ga0373943_0069304 3300035170 Bacteria 1782
319 Ga0373943_0409413 3300035170 Unclassified 784
320 Ga0373943_0430752 3300035170 Bacteria 764
321 Ga0373946_0377018 3300035171 Unclassified 713
322 Ga0373955_0016939 3300035172 Bacteria 3595
323 Ga0373955_0397930 3300035172 Bacteria 837
324 Ga0373935_0212226 3300035692 Unclassified 1342
325 Ga0373935_0495630 3300035692 Unclassified 886
326 Ga0373947_0019404 3300035725 Bacteria 3920
327 Ga0373947_0752422 3300035725 Unclassified 665
328 Ga0373947_1080384 3300035725 Bacteria 547
329 Ga0373937_0031357 3300036401 Bacteria 4817
330 Ga0373937_0201245 3300036401 Bacteria 1872
331 Ga0373937_0257008 3300036401 Bacteria 1647
332 Ga0373937_1493748 3300036401 Unclassified 623
333 Ga0373925_0033842 3300037068 Bacteria 3765
334 Ga0373925_0374743 3300037068 Bacteria 1158
335 Ga0373925_1401844 3300037068 Bacteria 572
336 Ga0439463_166329 3300042016 Unclassified 572
337 Ga0439434_0006591 3300042435 Unclassified 3394
338 Ga0451577_0412685 3300042876 Bacteria 1226
339 Ga0451576_0370226 3300045051 Bacteria 1501
340 Ga0451576_0750340 3300045051 Bacteria 1025
341 Ga0466967_0842591 3300045976 Bacteria 911
342 Ga0495580_0001778 3300046472 Bacteria 18956
343 Ga0495580_0083910 3300046472 Bacteria 2220
344 Ga0495580_0808317 3300046472 Bacteria 607
345 Ga0495582_0021959 3300046473 Unclassified 3492
346 Ga0495582_0482564 3300046473 Bacteria 716
347 Ga0495664_0190352 3300046477 Bacteria 1244
348 Ga0495608_0948341 3300046511 Bacteria 502
349 Ga0495630_0712588 3300046517 Bacteria 768
350 Ga0495630_1396170 3300046517 Unclassified 527
351 Ga0495652_1128234 3300046529 Bacteria 508
352 Ga0495665_0024514 3300046531 Bacteria 3241
353 Ga0495640_0104845 3300046533 Bacteria 1853
354 Ga0495586_0189808 3300046535 Bacteria 1164
355 Ga0495587_0677157 3300046536 Bacteria 566
356 Ga0495645_0153783 3300046543 Unclassified 1596
357 Ga0495667_0348159 3300046559 Bacteria 936
358 Ga0495634_0881113 3300046642 Bacteria 507
359 Ga0495635_0093088 3300046663 Bacteria 2061
360 Ga0495657_0210236 3300046675 Unclassified 1183
361 Ga0495599_0045845 3300046678 Bacteria 2742
362 Ga0495647_0061719 3300046681 Bacteria 1481
363 Ga0495647_0146595 3300046681 Bacteria 1010
364 Ga0495658_0094378 3300046683 Bacteria 1777
365 Ga0495613_0121337 3300046689 Bacteria 1877
366 Ga0495613_0139638 3300046689 Bacteria 1732
367 Ga0495581_0320382 3300047315 Bacteria 906
368 Ga0495581_0444150 3300047315 Bacteria 756
369 Ga0495581_0562701 3300047315 Bacteria 661
370 Ga0495674_0277363 3300047319 Bacteria 1374
371 Ga0495676_0520881 3300047321 Bacteria 779
372 Ga0495680_0074246 3300047322 Bacteria 2583
373 Ga0496100_0094274 3300048903 Bacteria 2050
374 Ga0496100_0303348 3300048903 Unclassified 1196
375 Ga0496101_0183291 3300048904 Bacteria 1613
376 Ga0496102_0001757 3300048905 Bacteria 18871
377 Ga0496102_1385779 3300048905 Bacteria 622
378 Ga0496103_0005489 3300048906 Bacteria 7583
379 Ga0496104_0023491 3300048907 Bacteria 5668
380 Ga0496104_0040830 3300048907 Bacteria 4350
381 Ga0496105_0040800 3300048908 Bacteria 3827
382 Ga0496105_0058036 3300048908 Unclassified 3195
383 Ga0496107_0196465 3300048910 Bacteria 1499
384 Ga0496107_0658222 3300048910 Unclassified 772
385 Ga0496108_0002398 3300048911 Bacteria 14987
386 Ga0496108_0006975 3300048911 Bacteria 9144
387 Ga0496109_0010513 3300048912 Bacteria 7909
388 Ga0496110_0007593 3300048913 Bacteria 8665
389 Ga0496111_0057120 3300048914 Bacteria 2825
390 Ga0496112_0011847 3300048915 Bacteria 7985
391 Ga0496112_0059824 3300048915 Bacteria 3754
392 Ga0496113_0000584 3300048916 Bacteria 18163
393 Ga0496113_0340199 3300048916 Bacteria 1203
394 Ga0496114_0225363 3300048917 Bacteria 1646
395 Ga0496115_0010079 3300048918 Bacteria 7045
396 Ga0496115_0655386 3300048918 Bacteria 829
397 Ga0501294_039439 3300049517 Unclassified 579
398 Ga0501299_056453 3300049522 Unclassified 823
399 Ga0501257_173215 3300049686 Bacteria 607
400 Ga0501225_0346003 3300049705 Unclassified 513
401 Ga0501272_038328 3300049769 Unclassified 632
402 Ga0501283_007208 3300049779 Bacteria 1578
403 nmdc:mga05p37_126907_c1 3300050507 Bacteria 3133
404 nmdc:mga05p37_22008_c1 3300050507 Bacteria 7724
405 nmdc:mga09592_409241_c1 3300050508 Bacteria 1172
406 nmdc:mga0qj67_8647_c1 3300050509 Bacteria 7553
407 nmdc:mga08y16_1364880_c1 3300050511 Bacteria 673
408 nmdc:mga08y16_242469_c1 3300050511 Bacteria 1863
409 nmdc:mga08y16_24763_c1 3300050511 Bacteria 6333
410 nmdc:mga0n895_102158_c1 3300050512 Bacteria 2877
411 nmdc:mga0n895_110239_c1 3300050512 Bacteria 2768
412 nmdc:mga0n895_501635_c1 3300050512 Bacteria 1223
413 nmdc:mga0rr50_152089_c1 3300050513 Bacteria 1871
414 nmdc:mga0rr50_288605_c1 3300050513 Bacteria 1370
415 nmdc:mga0rr50_402694_c1 3300050513 Bacteria 1156
416 nmdc:mga0rr50_51765_c1 3300050513 Bacteria 3049
417 nmdc:mga0rr50_993890_c1 3300050513 Unclassified 715
418 nmdc:mga08x19_14067_c1 3300050514 Bacteria 4849
419 nmdc:mga08x19_297800_c1 3300050514 Bacteria 1120
420 nmdc:mga0a205_127608_c1 3300050515 Bacteria 2444
421 nmdc:mga0a205_325078_c1 3300050515 Bacteria 1408
422 nmdc:mga0a205_467344_c1 3300050515 Bacteria 1120
423 nmdc:mga0a205_78027_c1 3300050515 Bacteria 2169
424 nmdc:mga0a205_78098_c1 3300050515 Bacteria 3198
425 Ga0495595_0134148 3300053084 Bacteria 1212
426 Ga0495619_0048903 3300053085 Bacteria 2787
427 2644426568 2643221676 Bacteria 8119172
428 2904755735 2904755435 Bacteria 7986759
429 2919428874 2919425241 Bacteria 8055701
430 Ga0224572_1010127
431 Ga0065712_10317388
432 Ga0065715_10254355
433 Ga0065707_10100169
434 Ga0065707_10409652
435 Ga0070658_10029306
436 Ga0070658_10627103
437 Ga0070676_10039313
438 Ga0070683_100914651
439 Ga0070690_101430851
440 Ga0070670_100624994
441 Ga0070670_100881689
442 Ga0070677_10393126
443 Ga0068869_100328645
444 Ga0070666_10205815
445 Ga0070682_100288862
446 Ga0068868_100191553
447 Ga0068868_100426873
448 Ga0068868_101530730
449 Ga0070660_100522938
450 Ga0070689_100616865
451 Ga0070687_100082312
452 Ga0070687_100453269
453 Ga0070687_101004620
454 Ga0070661_100364618
455 Ga0070661_100878653
456 Ga0070692_10396327
457 Ga0070692_11035229
458 Ga0070668_100107206
459 Ga0070668_101118018
460 Ga0070669_100065793
461 Ga0070675_100160221
462 Ga0070675_100423205
463 Ga0070675_101832612
464 Ga0070674_100003987
465 Ga0070673_100826187
466 Ga0070673_101447519
467 Ga0070673_102269263
468 Ga0070688_100162146
469 Ga0070688_100239847
470 Ga0070659_100872642
471 Ga0070709_10002008
472 Ga0070714_100001532
473 Ga0070713_100000060
474 Ga0070713_100364847
475 Ga0070710_10070130
476 Ga0070711_100000525
477 Ga0070711_100483707
478 Ga0070705_100080241
479 Ga0070705_100272030
480 Ga0070700_100919240
481 Ga0070694_100036501
482 Ga0070694_100419605
483 Ga0070708_100629628
484 Ga0070708_100634287
485 Ga0070708_100892379
486 Ga0070678_100161851
487 Ga0070678_100639467
488 Ga0070662_100074761
489 Ga0068867_100170292
490 Ga0068867_100251335
491 Ga0068867_100275800
492 Ga0068867_100657733
493 Ga0068867_102263074
494 Ga0070706_100027884
495 Ga0070706_100216737
496 Ga0070706_100286970
497 Ga0070706_101213253
498 Ga0070707_100033622
499 Ga0070698_100391931
500 Ga0070698_100557901
501 Ga0070699_100007641
502 Ga0070699_100244664
503 Ga0070684_100609147
504 Ga0070684_101431198
505 Ga0070684_101978473
506 Ga0070697_100000208
507 Ga0070697_100485253
508 Ga0070697_100675136
509 Ga0070672_100832172
510 Ga0070686_100370728
511 Ga0070695_100031740
512 Ga0070695_100147753
513 Ga0070695_100386242
514 Ga0070696_100009747
515 Ga0070693_100369079
516 Ga0070665_100005750
517 Ga0070665_100027820
518 Ga0070704_100045687
519 Ga0070704_100130175
520 Ga0070704_100360779
521 Ga0070704_100500721
522 Ga0070664_100157141
523 Ga0068857_100848427
524 Ga0068856_100817511
525 Ga0068852_100149126
526 Ga0068859_100066021
527 Ga0068859_100126544
528 Ga0068859_100724277
529 Ga0068859_101753471
530 Ga0068859_102042998
531 Ga0068864_100007906
532 Ga0068864_100320107
533 Ga0068866_10195701
534 Ga0068861_100265352
535 Ga0068861_100709994
536 Ga0068861_102554128
537 Ga0068863_100617510
538 Ga0068863_100702061
539 Ga0068858_100014131
540 Ga0068858_100023621
541 Ga0068858_101222620
542 Ga0068860_100029708
543 Ga0068860_100400143
544 Ga0068860_101146405
545 Ga0068862_100015507
546 Ga0068862_100230949
547 Ga0068862_100504469
548 Ga0068862_100623637
549 Ga0068862_101551038
550 Ga0081455_10055887
551 Ga0081455_10619811
552 Ga0070717_10001316
553 Ga0070717_10001433
554 Ga0075432_10088991
555 Ga0070716_100001249
556 Ga0070716_100404296
557 Ga0070712_100001236
558 Ga0070712_100166626
559 Ga0097621_100604201
560 Ga0097621_100633275
561 Ga0068871_100004097
562 Ga0068871_101972273
563 Ga0075428_100018875
564 Ga0075428_100685163
565 Ga0075431_100120257
566 Ga0075433_10048903
567 Ga0075433_10053604
568 Ga0075433_10125985
569 Ga0075433_10725136
570 Ga0075433_10859931
571 Ga0075433_10921937
572 Ga0075434_100150575
573 Ga0075434_100216661
574 Ga0075434_100360615
575 Ga0075434_101007092
576 Ga0075429_100383299
577 Ga0068865_100017850
578 Ga0068865_100025683
579 Ga0075436_100002061
580 Ga0097620_100066022
581 Ga0097620_100126541
582 Ga0097620_100724302
583 Ga0097620_101753747
584 Ga0097620_102042833
585 Ga0075435_100003680
586 Ga0075435_100109942
587 Ga0075435_100169224
588 Ga0075435_100309239
589 Ga0075435_100605535
590 Ga0075435_100785615
591 Ga0105240_11551114
592 Ga0111539_10033903
593 Ga0111539_10159308
594 Ga0111539_10411569
595 Ga0111539_11104419
596 Ga0111539_11203905
597 Ga0105245_10035925
598 Ga0105245_10597824
599 Ga0105247_10140323
600 Ga0105247_10262468
601 Ga0114129_10002492
602 Ga0114129_10007108
603 Ga0114129_10039771
604 Ga0114129_10357692
605 Ga0114129_11082034
606 Ga0114129_12005744
607 Ga0105243_10218487
608 Ga0105243_11939909
609 Ga0105242_10010412
610 Ga0105248_10002581
611 Ga0105248_10186494
612 Ga0105248_10276415
613 Ga0105248_10452749
614 Ga0105248_10584815
615 Ga0105237_10168629
616 Ga0105237_10779932
617 Ga0105238_12518953
618 Ga0105249_10102712
619 Ga0105249_10128010
620 Ga0105249_10555554
621 Ga0105239_10015517
622 Ga0105239_11419842
623 Ga0157374_12169363
624 Ga0157378_11511054
625 Ga0157378_12735683
626 Ga0163162_10221702
627 Ga0163162_10291573
628 Ga0157375_11220975
629 Ga0157375_11576579
630 Ga0163163_10015093
631 Ga0163163_10322522
632 Ga0163163_11119843
633 Ga0157380_10078883
634 Ga0157380_10467677
635 Ga0157380_11896498
636 Ga0157377_10088188
637 Ga0157379_10058170
638 Ga0157379_10165168
639 Ga0157379_10417498
640 Ga0157379_10732811
641 Ga0157379_11851352
642 Ga0157376_10089465
643 Ga0157376_11787254
644 Ga0224572_1046139
645 Ga0207692_10055414
646 Ga0207710_10330585
647 Ga0207680_10378870
648 Ga0207699_10002299
649 Ga0207645_10103248
650 Ga0207645_10143931
651 Ga0207705_10027495
652 Ga0207705_10512347
653 Ga0207684_10023654
654 Ga0207684_10198848
655 Ga0207671_10269116
656 Ga0207671_10417224
657 Ga0207693_10000191
658 Ga0207693_10353867
659 Ga0207663_10001591
660 Ga0207662_10071227
661 Ga0207662_10268815
662 Ga0207646_10066329
663 Ga0207646_10159656
664 Ga0207646_10748593
665 Ga0207681_10157205
666 Ga0207681_10862439
667 Ga0207694_11153981
668 Ga0207650_10212063
669 Ga0207650_10709304
670 Ga0207650_11235677
671 Ga0207687_10367974
672 Ga0207700_10000358
673 Ga0207700_10119051
674 Ga0207664_10004104
675 Ga0207644_10965923
676 Ga0207706_10093955
677 Ga0207706_10223862
678 Ga0207706_10280076
679 Ga0207686_10315256
680 Ga0207686_10409924
681 Ga0207669_10488984
682 Ga0207704_10078985
683 Ga0207704_11127733
684 Ga0207665_10012260
685 Ga0207665_10085206
686 Ga0207665_11144780
687 Ga0207691_10383327
688 Ga0207691_10560525
689 Ga0207711_10007961
690 Ga0207711_10534625
691 Ga0207711_10623861
692 Ga0207689_10089981
693 Ga0207661_10976107
694 Ga0207667_10984479
695 Ga0207651_10172840
696 Ga0207712_10059742
697 Ga0207712_10090707
698 Ga0207668_10053832
699 Ga0207668_10074630
700 Ga0207668_10258407
701 Ga0207677_10439420
702 Ga0207703_10006197
703 Ga0207703_10053671
704 Ga0207708_10127574
705 Ga0207708_10199724
706 Ga0207702_10686054
707 Ga0207641_10929654
708 Ga0207648_10034550
709 Ga0207648_10142346
710 Ga0207648_10244719
711 Ga0207676_10376706
712 Ga0207674_10960964
713 Ga0207675_100239622
714 Ga0207675_100346025
715 Ga0207675_100659706
716 Ga0207428_10084541
717 Ga0207428_10432446
718 Ga0265356_1003611
719 Ga0268266_10104121
720 Ga0268266_10382232
721 Ga0268266_11106342
722 Ga0268265_10077349
723 Ga0268265_10540494
724 Ga0268265_11040393
725 Ga0268265_11676508
726 Ga0268264_10169546
727 Ga0268264_10714959
728 Ga0265338_10032997
729 Ga0265338_10129345
730 Ga0265338_10353727
731 Ga0265338_10386623
732 Ga0265338_10470456
733 Ga0307511_10246226
734 Ga0265762_1000496
735 Ga0265770_1050854
736 Ga0265332_10373303
737 Ga0265340_10148761
738 Ga0265331_10167778
739 Ga0265316_10087469
740 Ga0307412_10760498
741 Ga0307409_100484697
742 Ga0307416_100717529
743 Ga0373934_0029586
744 Ga0373944_0008610
745 Ga0373936_0026161
746 Ga0373945_0059193
747 Ga0373943_0069304
748 Ga0373943_0409413
749 Ga0373943_0430752
750 Ga0373946_0377018
751 Ga0373955_0016939
752 Ga0373955_0397930
753 Ga0373935_0212226
754 Ga0373935_0495630
755 Ga0373947_0019404
756 Ga0373947_0752422
757 Ga0373947_1080384
758 Ga0373937_0031357
759 Ga0373937_0201245
760 Ga0373937_0257008
761 Ga0373937_1493748
762 Ga0373925_0033842
763 Ga0373925_0374743
764 Ga0373925_1401844
765 Ga0439463_166329
766 Ga0439434_0006591
767 Ga0451577_0412685
768 Ga0451576_0370226
769 Ga0451576_0750340
770 Ga0466967_0842591
771 Ga0495580_0001778
772 Ga0495580_0083910
773 Ga0495580_0808317
774 Ga0495582_0021959
775 Ga0495582_0482564
776 Ga0495664_0190352
777 Ga0495608_0948341
778 Ga0495630_0712588
779 Ga0495630_1396170
780 Ga0495652_1128234
781 Ga0495665_0024514
782 Ga0495640_0104845
783 Ga0495586_0189808
784 Ga0495587_0677157
785 Ga0495645_0153783
786 Ga0495667_0348159
787 Ga0495634_0881113
788 Ga0495635_0093088
789 Ga0495657_0210236
790 Ga0495599_0045845
791 Ga0495647_0061719
792 Ga0495647_0146595
793 Ga0495658_0094378
794 Ga0495613_0121337
795 Ga0495613_0139638
796 Ga0495581_0320382
797 Ga0495581_0444150
798 Ga0495581_0562701
799 Ga0495674_0277363
800 Ga0495676_0520881
801 Ga0495680_0074246
802 Ga0496100_0094274
803 Ga0496100_0303348
804 Ga0496101_0183291
805 Ga0496102_0001757
806 Ga0496102_1385779
807 Ga0496103_0005489
808 Ga0496104_0023491
809 Ga0496104_0040830
810 Ga0496105_0040800
811 Ga0496105_0058036
812 Ga0496107_0196465
813 Ga0496107_0658222
814 Ga0496108_0002398
815 Ga0496108_0006975
816 Ga0496109_0010513
817 Ga0496110_0007593
818 Ga0496111_0057120
819 Ga0496112_0011847
820 Ga0496112_0059824
821 Ga0496113_0000584
822 Ga0496113_0340199
823 Ga0496114_0225363
824 Ga0496115_0010079
825 Ga0496115_0655386
826 Ga0501294_039439
827 Ga0501299_056453
828 Ga0501257_173215
829 Ga0501225_0346003
830 Ga0501272_038328
831 Ga0501283_007208
832 nmdc:mga05p37_126907_c1
833 nmdc:mga05p37_22008_c1
834 nmdc:mga09592_409241_c1
835 nmdc:mga0qj67_8647_c1
836 nmdc:mga08y16_1364880_c1
837 nmdc:mga08y16_242469_c1
838 nmdc:mga08y16_24763_c1
839 nmdc:mga0n895_102158_c1
840 nmdc:mga0n895_110239_c1
841 nmdc:mga0n895_501635_c1
842 nmdc:mga0rr50_152089_c1
843 nmdc:mga0rr50_288605_c1
844 nmdc:mga0rr50_402694_c1
845 nmdc:mga0rr50_51765_c1
846 nmdc:mga0rr50_993890_c1
847 nmdc:mga08x19_14067_c1
848 nmdc:mga08x19_297800_c1
849 nmdc:mga0a205_127608_c1
850 nmdc:mga0a205_325078_c1
851 nmdc:mga0a205_467344_c1
852 nmdc:mga0a205_78027_c1
853 nmdc:mga0a205_78098_c1
854 Ga0495595_0134148
855 Ga0495619_0048903
856 2644426568
857 2904755735
858 2919428874

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

29

141

0.89

PF22677

Ble-like_N

Bleomycin resistance protein-like N-terminal

29

59

0.89

PF18029

Glyoxalase_6

Glyoxalase-like domain

32

142

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
2i7r-assembly1.cif.gz_B conserved domain protein 0.8799 12 128
2i7r-assembly1.cif.gz_B conserved domain protein 0.8659 12 128
4nb1-assembly1.cif.gz_A crystal structure of fosb from staphylococcus aureus at 1.80 angstrom resolution with l-cysteine-cys9 disulfide 0.8316 10 127
3ey8-assembly1.cif.gz_A structure from the mobile metagenome of v. pseudocholerae. vpc_cass1 0.8301 10 127
4hc5-assembly2.cif.gz_C crystal structure of member of glyoxalase/bleomycin resistance protein/dioxygenase superfamily from sphaerobacter thermophilus dsm 20745 0.8252 11 128
ID Description Score Start End Superfamily
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8823 71 129 3.30.720.110
af_O06412_6_120_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8802 15 127 3.10.180.10
2i7rB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8776 13 127 3.10.180.10
2i7rB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8633 13 127 3.10.180.10
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8547 71 129 3.30.720.110
ID Description Score Start End GO Terms
AF-A0A1G0SVR9-F1-model_v4 VOC domain-containing protein 0.9846 10 130 GO:0004462
GO:0046872
AF-A0A2V7MXD9-F1-model_v4 Glyoxalase 0.9816 12 132
AF-A0A2V5WJX5-F1-model_v4 Glyoxalase 0.9807 7 131
AF-A0A6A7L796-F1-model_v4 VOC family protein 0.9766 10 132
AF-A0A2V7XAT9-F1-model_v4 Glyoxalase 0.9738 10 132

Map