F441789

General Info

Members Datasets Scaffolds Average Seq Length
428 263 856 317

Family's Representative Sequence

Representative Sequence 3300053153|Ga0500616_0003360|Ga0500616_0003360_10220_11320
Length 366
Sequence MVVLIVDQAGLGAQATGARCPTENSEAGEYAGSFLREEAADMDRVELRDLNVSAQGLGCMGMSEHYGPTDWDLATETIHRALDLGVTLLDTADIYGSGHNEVLVGRAISARRDEVQLATKFGVDRSGGDAARRIRGAAAYVHHACDASLLRLGVEVIDLYYMHRPPQDVEIEETVGAMAELVTAGKVRHLGLSEVDESLLRRAHHVHPITAVQSEYSLWSREVEAVLPAMSELGIGLVAYSPLGRGFLSGKLDYSAFDARDFRRRNPRFQGAARDANLAIVDTVREVADRLGAEPSQVALAWVHSRSQRHGVAIVPIPGTKRPRWLEQNVAALELHLDEDALERLDPLVELVHGERYGADSIGRPG

Samples

Sample ID Description Type Environment
1 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
56 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
86 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
88 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
134 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
135 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
136 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
137 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
138 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
139 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
140 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
141 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
142 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
143 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
144 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
145 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
146 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
147 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
148 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
149 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
150 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
151 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
152 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
153 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
154 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
155 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
156 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
157 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
158 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
159 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
160 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
161 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
162 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
163 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
164 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
165 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
166 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
167 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
168 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
169 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
170 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
171 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
172 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
173 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
174 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
175 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
176 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
177 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
178 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
179 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
180 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
181 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
182 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
183 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
184 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
185 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
186 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
187 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
188 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
189 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
190 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
191 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
192 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
193 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
194 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
195 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
196 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
197 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
198 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
199 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
200 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
201 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
202 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
203 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
204 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
205 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
206 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
207 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
208 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
209 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
210 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
211 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
212 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
213 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
214 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
215 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
216 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
217 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
218 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
219 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
220 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
221 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
222 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
223 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
224 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
225 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
226 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
227 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
228 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
237 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
239 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
240 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
241 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
242 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
243 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
244 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
245 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
246 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
247 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
248 2579778521 Frankia torreyi CpI1-S Isolate Unclassified
249 2626541554 Frankia sp. AvcI.1 Isolate Nodule
250 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
251 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
252 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
253 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
254 2844849076 Arthrobacter cupressi DSM 24664 Isolate Rhizosphere
255 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
256 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
257 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
258 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
259 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
260 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
261 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
262 8054913762 Frankia gtarii Agncl-10 Isolate Nodule
263 8054920844 Frankia tisae Agncl-8 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.09
Metatranscriptomes 1.17
Isolates 3.74

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.87
Nodule 0.7
Rhizoplane 3.97
Rhizosphere 87.62
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500616_0003360 3300053153 Bacteria 12302
2 JGI24737J22298_10054528 3300001990 Bacteria 1210
3 JGI25404J52841_10004025 3300003659 Bacteria 2952
4 Ga0070658_10177723 3300005327 Bacteria 1790
5 Ga0070658_10467398 3300005327 Bacteria 1088
6 Ga0070676_10087051 3300005328 Bacteria 1906
7 Ga0070683_100031881 3300005329 Bacteria 4795
8 Ga0070670_100057578 3300005331 Bacteria 3336
9 Ga0070680_100162841 3300005336 Bacteria 1875
10 Ga0070680_100263507 3300005336 Bacteria 1458
11 Ga0070660_100016491 3300005339 Bacteria 5361
12 Ga0070689_100061994 3300005340 Bacteria 2909
13 Ga0070691_10059340 3300005341 Bacteria 1838
14 Ga0070661_100013385 3300005344 Bacteria 5758
15 Ga0070692_10032731 3300005345 Bacteria 2616
16 Ga0070669_100025329 3300005353 Bacteria 4260
17 Ga0070675_100199671 3300005354 Bacteria 1735
18 Ga0070671_100065345 3300005355 Bacteria 3030
19 Ga0070659_100085661 3300005366 Bacteria 2520
20 Ga0070667_100082984 3300005367 Bacteria 2744
21 Ga0070703_10050818 3300005406 Bacteria 1325
22 Ga0070709_10000914 3300005434 Bacteria 16346
23 Ga0070709_10034160 3300005434 Bacteria 3081
24 Ga0070714_100002323 3300005435 Bacteria 13976
25 Ga0070714_100029497 3300005435 Bacteria 4561
26 Ga0070714_100058600 3300005435 Bacteria 3300
27 Ga0070713_100014866 3300005436 Bacteria 5794
28 Ga0070713_100021544 3300005436 Bacteria 4960
29 Ga0070713_100080515 3300005436 Bacteria 2777
30 Ga0070713_100095540 3300005436 Bacteria 2564
31 Ga0070710_10014983 3300005437 Bacteria 3913
32 Ga0070711_100002886 3300005439 Bacteria 9899
33 Ga0070711_100275355 3300005439 Bacteria 1329
34 Ga0070708_100053055 3300005445 Bacteria 3597
35 Ga0070678_100030818 3300005456 Bacteria 3691
36 Ga0070662_100032021 3300005457 Bacteria 3695
37 Ga0070681_10024117 3300005458 Bacteria 6124
38 Ga0070681_10339233 3300005458 Bacteria 1412
39 Ga0070706_100000524 3300005467 Bacteria 44840
40 Ga0070706_100091841 3300005467 Bacteria 2816
41 Ga0070707_100004798 3300005468 Bacteria 12657
42 Ga0070699_100005347 3300005518 Bacteria 11261
43 Ga0070679_100019362 3300005530 Bacteria 6614
44 Ga0070684_100013457 3300005535 Bacteria 6598
45 Ga0070684_100035573 3300005535 Bacteria 4263
46 Ga0070684_100195489 3300005535 Bacteria 1842
47 Ga0070697_100006317 3300005536 Bacteria 9173
48 Ga0070697_100007859 3300005536 Bacteria 8306
49 Ga0068853_100045842 3300005539 Bacteria 3746
50 Ga0070686_100031003 3300005544 Bacteria 3265
51 Ga0070696_100126853 3300005546 Bacteria 1852
52 Ga0070693_100057098 3300005547 Bacteria 2255
53 Ga0070665_100267972 3300005548 Bacteria 1709
54 Ga0070704_100134819 3300005549 Bacteria 1919
55 Ga0070664_100008967 3300005564 Bacteria 8113
56 Ga0070664_100057912 3300005564 Bacteria 3295
57 Ga0068857_100004279 3300005577 Bacteria 12037
58 Ga0068854_100161976 3300005578 Bacteria 1733
59 Ga0068852_100017003 3300005616 Bacteria 5694
60 Ga0068852_100017028 3300005616 Bacteria 5691
61 Ga0068859_100039136 3300005617 Bacteria 4756
62 Ga0068864_100016528 3300005618 Bacteria 6140
63 Ga0068864_100052188 3300005618 Bacteria 3524
64 Ga0068864_100310452 3300005618 Bacteria 1478
65 Ga0068866_10025404 3300005718 Bacteria 2784
66 Ga0068851_10033853 3300005834 Bacteria 2548
67 Ga0068863_100465030 3300005841 Bacteria 1242
68 Ga0068858_100000230 3300005842 Bacteria 60483
69 Ga0068858_100041462 3300005842 Bacteria 4267
70 Ga0068858_100233618 3300005842 Bacteria 1743
71 Ga0068862_100066297 3300005844 Bacteria 3111
72 Ga0081455_10012561 3300005937 Bacteria 8447
73 Ga0081540_1000395 3300005983 Bacteria 43174
74 Ga0081540_1000572 3300005983 Bacteria 35592
75 Ga0070717_10002900 3300006028 Bacteria 12178
76 Ga0070717_10027304 3300006028 Bacteria 4562
77 Ga0070717_10319372 3300006028 Bacteria 1383
78 Ga0075364_10010298 3300006051 Bacteria 5643
79 Ga0070715_10096044 3300006163 Bacteria 1373
80 Ga0070716_100000400 3300006173 Bacteria 17791
81 Ga0070716_100034759 3300006173 Bacteria 2766
82 Ga0070712_100032052 3300006175 Bacteria 3546
83 Ga0070712_100271192 3300006175 Bacteria 1363
84 Ga0097621_100057084 3300006237 Bacteria 3191
85 Ga0068871_100203593 3300006358 Bacteria 1710
86 Ga0075434_100101524 3300006871 Bacteria 2883
87 Ga0068865_100041694 3300006881 Bacteria 3125
88 Ga0097620_100039137 3300006931 Bacteria 4756
89 Ga0105245_10047314 3300009098 Bacteria 3845
90 Ga0105245_10062663 3300009098 Bacteria 3356
91 Ga0105245_10091168 3300009098 Bacteria 2804
92 Ga0105247_10000697 3300009101 Bacteria 26376
93 Ga0105247_10005958 3300009101 Bacteria 7601
94 Ga0105247_10052608 3300009101 Bacteria 2511
95 Ga0105247_10082291 3300009101 Bacteria 2031
96 Ga0105243_10000805 3300009148 Bacteria 29876
97 Ga0105243_10096290 3300009148 Bacteria 2448
98 Ga0105241_10089164 3300009174 Bacteria 2430
99 Ga0105242_10109823 3300009176 Bacteria 2349
100 Ga0105248_10204627 3300009177 Bacteria 2224
101 Ga0105237_10148050 3300009545 Bacteria 2343
102 Ga0105238_10243877 3300009551 Bacteria 1774
103 Ga0105239_10079092 3300010375 Bacteria 3618
104 Ga0157370_10095117 3300013104 Bacteria 2795
105 Ga0157369_10018359 3300013105 Bacteria 7842
106 Ga0157374_10030077 3300013296 Bacteria 4928
107 Ga0157372_10000302 3300013307 Bacteria 54963
108 Ga0163163_10062851 3300014325 Bacteria 3680
109 Ga0163163_10089259 3300014325 Bacteria 3095
110 Ga0163163_10320234 3300014325 Bacteria 1604
111 Ga0157379_10004176 3300014968 Bacteria 12337
112 Ga0157379_10065751 3300014968 Bacteria 3242
113 Ga0157376_10022207 3300014969 Bacteria 4942
114 Ga0163161_10204594 3300017792 Bacteria 1522
115 Ga0197907_10063896 3300020069 Bacteria 2308
116 Ga0206356_11188721 3300020070 Bacteria 1588
117 Ga0206354_11420767 3300020081 Bacteria 3929
118 Ga0206353_11562690 3300020082 Bacteria 5260
119 Ga0213875_10004029 3300021388 Bacteria 8178
120 Ga0213875_10010103 3300021388 Bacteria 4744
121 Ga0224712_10009823 3300022467 Bacteria 2900
122 Ga0224572_1017158 3300024225 Bacteria 1389
123 Ga0207656_10023596 3300025321 Bacteria 2479
124 Ga0207653_10006299 3300025885 Bacteria 3701
125 Ga0207692_10026047 3300025898 Bacteria 2740
126 Ga0207692_10050784 3300025898 Bacteria 2099
127 Ga0207642_10105774 3300025899 Bacteria 1422
128 Ga0207710_10000037 3300025900 Bacteria 243545
129 Ga0207710_10044713 3300025900 Bacteria 1973
130 Ga0207647_10028741 3300025904 Bacteria 3608
131 Ga0207685_10007527 3300025905 Bacteria 3040
132 Ga0207699_10003190 3300025906 Bacteria 7806
133 Ga0207699_10012906 3300025906 Bacteria 4259
134 Ga0207699_10048496 3300025906 Bacteria 2495
135 Ga0207699_10070479 3300025906 Bacteria 2134
136 Ga0207643_10015412 3300025908 Bacteria 4162
137 Ga0207684_10000775 3300025910 Bacteria 37093
138 Ga0207707_10103080 3300025912 Bacteria 2494
139 Ga0207671_10060763 3300025914 Bacteria 2803
140 Ga0207693_10005917 3300025915 Bacteria 10145
141 Ga0207693_10141708 3300025915 Bacteria 1890
142 Ga0207663_10051114 3300025916 Bacteria 2572
143 Ga0207663_10054940 3300025916 Bacteria 2496
144 Ga0207660_10132849 3300025917 Bacteria 1896
145 Ga0207662_10022109 3300025918 Bacteria 3642
146 Ga0207657_10078408 3300025919 Bacteria 2782
147 Ga0207649_10021384 3300025920 Bacteria 3723
148 Ga0207652_10020772 3300025921 Bacteria 5412
149 Ga0207646_10040177 3300025922 Bacteria 4207
150 Ga0207681_10134880 3300025923 Bacteria 1830
151 Ga0207650_10009052 3300025925 Bacteria 6806
152 Ga0207700_10002032 3300025928 Bacteria 11562
153 Ga0207700_10010726 3300025928 Bacteria 5803
154 Ga0207700_10011671 3300025928 Bacteria 5616
155 Ga0207700_10020118 3300025928 Bacteria 4524
156 Ga0207700_10046167 3300025928 Bacteria 3219
157 Ga0207700_10273614 3300025928 Bacteria 1450
158 Ga0207664_10003490 3300025929 Bacteria 10492
159 Ga0207664_10011499 3300025929 Bacteria 6296
160 Ga0207664_10096797 3300025929 Bacteria 2430
161 Ga0207664_10537345 3300025929 Bacteria 1048
162 Ga0207690_10007734 3300025932 Bacteria 6379
163 Ga0207706_10029099 3300025933 Bacteria 4933
164 Ga0207686_10071536 3300025934 Bacteria 2232
165 Ga0207709_10001137 3300025935 Bacteria 19388
166 Ga0207670_10085032 3300025936 Bacteria 2222
167 Ga0207665_10002780 3300025939 Bacteria 11727
168 Ga0207665_10003825 3300025939 Bacteria 10059
169 Ga0207665_10033775 3300025939 Bacteria 3393
170 Ga0207711_10299794 3300025941 Bacteria 1482
171 Ga0207689_10004272 3300025942 Bacteria 13000
172 Ga0207661_10018858 3300025944 Bacteria 5133
173 Ga0207679_10085885 3300025945 Bacteria 2418
174 Ga0207640_10263120 3300025981 Bacteria 1345
175 Ga0207703_10000010 3300026035 Bacteria 343466
176 Ga0207703_10072725 3300026035 Bacteria 2843
177 Ga0207678_10012351 3300026067 Bacteria 7497
178 Ga0207702_10052101 3300026078 Bacteria 3461
179 Ga0207641_10124089 3300026088 Bacteria 2309
180 Ga0207648_10086575 3300026089 Bacteria 2734
181 Ga0207676_10260582 3300026095 Bacteria 1565
182 Ga0207674_10008135 3300026116 Bacteria 12157
183 Ga0207674_10059332 3300026116 Bacteria 3872
184 Ga0207675_100210035 3300026118 Bacteria 1872
185 Ga0207698_10052649 3300026142 Bacteria 3120
186 Ga0207698_10391515 3300026142 Bacteria 1325
187 Ga0268265_10206846 3300028380 Bacteria 1707
188 Ga0373948_0013044 3300034817 Bacteria 1495
189 Ga0373926_0001473 3300035083 Bacteria 7181
190 Ga0373934_0046559 3300035086 Bacteria 1715
191 Ga0373934_0076753 3300035086 Bacteria 1340
192 Ga0373923_0004383 3300035111 Bacteria 4676
193 Ga0373923_0014048 3300035111 Bacteria 2999
194 Ga0373936_0001659 3300035113 Bacteria 8158
195 Ga0373936_0012148 3300035113 Bacteria 3270
196 Ga0373936_0022254 3300035113 Bacteria 2468
197 Ga0373945_0021290 3300035116 Bacteria 2227
198 Ga0373953_0054968 3300035117 Bacteria 1615
199 Ga0373953_0078263 3300035117 Bacteria 1371
200 Ga0373954_0081676 3300035118 Bacteria 1544
201 Ga0373954_0152613 3300035118 Bacteria 1128
202 Ga0373956_0046029 3300035119 Bacteria 1948
203 Ga0373957_0048711 3300035120 Bacteria 1615
204 Ga0373960_0008178 3300035121 Bacteria 2500
205 Ga0373943_0004966 3300035170 Bacteria 6004
206 Ga0373943_0007398 3300035170 Bacteria 4931
207 Ga0373946_0001033 3300035171 Bacteria 9565
208 Ga0373946_0033693 3300035171 Bacteria 2063
209 Ga0373955_0015838 3300035172 Bacteria 3698
210 Ga0373962_0019370 3300035242 Bacteria 1780
211 Ga0373924_0030207 3300035410 Bacteria 2170
212 Ga0373924_0057304 3300035410 Bacteria 1625
213 Ga0373924_0057469 3300035410 Bacteria 1623
214 Ga0373924_0072735 3300035410 Bacteria 1452
215 Ga0373931_0030487 3300035691 Bacteria 2776
216 Ga0373935_0013418 3300035692 Bacteria 4942
217 Ga0373935_0041479 3300035692 Bacteria 2891
218 Ga0373935_0060944 3300035692 Bacteria 2414
219 Ga0373935_0098374 3300035692 Bacteria 1925
220 Ga0373927_0038782 3300035695 Bacteria 3092
221 Ga0373927_0040829 3300035695 Bacteria 3009
222 Ga0373933_0037719 3300035724 Bacteria 2836
223 Ga0373933_0108601 3300035724 Bacteria 1728
224 Ga0373933_0110874 3300035724 Bacteria 1711
225 Ga0373947_0021426 3300035725 Bacteria 3740
226 Ga0373947_0247505 3300035725 Bacteria 1178
227 Ga0373937_0016455 3300036401 Bacteria 6570
228 Ga0373937_0036341 3300036401 Bacteria 4489
229 Ga0373937_0053488 3300036401 Bacteria 3703
230 Ga0373937_0058873 3300036401 Bacteria 3529
231 Ga0373925_0003234 3300037068 Bacteria 12718
232 Ga0373925_0014017 3300037068 Bacteria 5802
233 Ga0373925_0133814 3300037068 Bacteria 1935
234 Ga0373925_0249944 3300037068 Bacteria 1422
235 Ga0373925_0317886 3300037068 Bacteria 1259
236 Ga0395898_0422271 3300037466 Bacteria 1271
237 Ga0436364_0320639 3300037853 Bacteria 2678
238 Ga0436364_0427944 3300037853 Bacteria 10854
239 Ga0436364_0635330 3300037853 Bacteria 60935
240 Ga0436364_0704998 3300037853 Bacteria 1724
241 Ga0436364_1477292 3300037853 Bacteria 2923
242 Ga0436360_1133144 3300039438 Bacteria 1169
243 Ga0436361_0551771 3300039447 Bacteria 1273
244 Ga0436363_0438373 3300039450 Bacteria 1961
245 Ga0436363_0887527 3300039450 Bacteria 1662
246 Ga0439442_014697 3300042002 Bacteria 1612
247 Ga0466972_0036457 3300044658 Bacteria 2406
248 Ga0466966_0068450 3300044684 Bacteria 2229
249 Ga0466966_0072110 3300044684 Bacteria 2163
250 Ga0466961_0075915 3300044693 Bacteria 2130
251 Ga0466963_0039031 3300044694 Bacteria 3108
252 Ga0466963_0050546 3300044694 Bacteria 2751
253 Ga0466963_0114895 3300044694 Bacteria 1850
254 Ga0466963_0136820 3300044694 Bacteria 1695
255 Ga0466963_0186322 3300044694 Bacteria 1449
256 Ga0466963_0205660 3300044694 Bacteria 1377
257 Ga0466964_0009464 3300044706 Bacteria 3670
258 Ga0466968_0097626 3300044735 Bacteria 1309
259 Ga0466970_0041080 3300044765 Bacteria 2457
260 Ga0466957_0004649 3300044842 Bacteria 7670
261 Ga0466957_0091094 3300044842 Bacteria 1910
262 Ga0466957_0221138 3300044842 Bacteria 1250
263 Ga0466958_0020513 3300045836 Bacteria 3855
264 Ga0466958_0090173 3300045836 Bacteria 1897
265 Ga0466967_0013452 3300045976 Bacteria 6324
266 Ga0466967_0021986 3300045976 Bacteria 5194
267 Ga0466967_0040260 3300045976 Bacteria 4022
268 Ga0466967_0055574 3300045976 Bacteria 3487
269 Ga0466967_0075624 3300045976 Bacteria 3027
270 Ga0466967_0136000 3300045976 Bacteria 2285
271 Ga0466967_0281098 3300045976 Bacteria 1597
272 Ga0495592_0035318 3300046454 Bacteria 3766
273 Ga0495592_0050947 3300046454 Bacteria 3075
274 Ga0495629_0003058 3300046459 Bacteria 12714
275 Ga0495629_0009405 3300046459 Bacteria 7149
276 Ga0495629_0082827 3300046459 Bacteria 2239
277 Ga0495638_0013466 3300046460 Bacteria 5567
278 Ga0495641_0034072 3300046461 Bacteria 2410
279 Ga0495641_0143087 3300046461 Bacteria 1068
280 Ga0495651_0020889 3300046462 Bacteria 5083
281 Ga0495651_0037949 3300046462 Bacteria 3751
282 Ga0495651_0049534 3300046462 Bacteria 3242
283 Ga0495653_0025157 3300046463 Bacteria 4788
284 Ga0495653_0108831 3300046463 Bacteria 1995
285 Ga0495653_0118296 3300046463 Bacteria 1892
286 Ga0495580_0003971 3300046472 Bacteria 12485
287 Ga0495582_0134645 3300046473 Bacteria 1397
288 Ga0495639_0001625 3300046475 Bacteria 10027
289 Ga0495662_0002934 3300046476 Bacteria 8606
290 Ga0495662_0026097 3300046476 Bacteria 2822
291 Ga0495662_0106865 3300046476 Bacteria 1370
292 Ga0495664_0009522 3300046477 Bacteria 5438
293 Ga0495664_0042836 3300046477 Bacteria 2682
294 Ga0495664_0247293 3300046477 Bacteria 1079
295 Ga0495608_0014517 3300046511 Bacteria 5463
296 Ga0495608_0016316 3300046511 Bacteria 5138
297 Ga0495608_0019660 3300046511 Bacteria 4646
298 Ga0495608_0115256 3300046511 Bacteria 1725
299 Ga0495618_0050612 3300046514 Bacteria 2624
300 Ga0495618_0185359 3300046514 Bacteria 1321
301 Ga0495618_0219898 3300046514 Bacteria 1198
302 Ga0495618_0248169 3300046514 Bacteria 1117
303 Ga0495628_0064886 3300046516 Bacteria 2858
304 Ga0495628_0123595 3300046516 Bacteria 1983
305 Ga0495630_0018258 3300046517 Bacteria 5150
306 Ga0495630_0383118 3300046517 Bacteria 1077
307 Ga0495666_0006076 3300046526 Bacteria 6080
308 Ga0495652_0071684 3300046529 Bacteria 2890
309 Ga0495652_0236364 3300046529 Bacteria 1363
310 Ga0495665_0004283 3300046531 Bacteria 7713
311 Ga0495665_0043013 3300046531 Bacteria 2402
312 Ga0495640_0005259 3300046533 Bacteria 10291
313 Ga0495586_0011245 3300046535 Bacteria 4758
314 Ga0495586_0013890 3300046535 Bacteria 4273
315 Ga0495587_0042892 3300046536 Bacteria 2695
316 Ga0495587_0044779 3300046536 Bacteria 2631
317 Ga0495587_0180607 3300046536 Bacteria 1197
318 Ga0495667_0006809 3300046559 Bacteria 7760
319 Ga0495667_0017940 3300046559 Bacteria 4780
320 Ga0495667_0028720 3300046559 Bacteria 3745
321 Ga0495667_0036567 3300046559 Bacteria 3276
322 Ga0495667_0070947 3300046559 Bacteria 2272
323 Ga0495634_0065675 3300046642 Bacteria 2404
324 Ga0495634_0104726 3300046642 Bacteria 1824
325 Ga0495634_0106351 3300046642 Bacteria 1808
326 Ga0495635_0050248 3300046663 Bacteria 2874
327 Ga0495635_0101601 3300046663 Bacteria 1965
328 Ga0495635_0125637 3300046663 Bacteria 1749
329 Ga0495657_0072957 3300046675 Bacteria 2237
330 Ga0495657_0131874 3300046675 Bacteria 1564
331 Ga0495599_0059092 3300046678 Bacteria 2398
332 Ga0495599_0128041 3300046678 Bacteria 1577
333 Ga0495623_0098463 3300046679 Bacteria 1784
334 Ga0495658_0023698 3300046683 Bacteria 3261
335 Ga0495613_0012973 3300046689 Bacteria 6190
336 Ga0495600_0011473 3300046809 Bacteria 5522
337 Ga0495600_0049612 3300046809 Bacteria 2738
338 Ga0495581_0002856 3300047315 Bacteria 9862
339 Ga0495581_0064672 3300047315 Bacteria 2113
340 Ga0495604_0134747 3300047317 Bacteria 1771
341 Ga0495674_0043121 3300047319 Bacteria 4017
342 Ga0495674_0074462 3300047319 Bacteria 2924
343 Ga0495674_0087460 3300047319 Bacteria 2666
344 Ga0495674_0200921 3300047319 Bacteria 1653
345 Ga0495672_0035684 3300047320 Bacteria 3061
346 Ga0495676_0074934 3300047321 Bacteria 2589
347 Ga0495676_0136215 3300047321 Bacteria 1765
348 Ga0495676_0173973 3300047321 Bacteria 1513
349 Ga0495680_0020186 3300047322 Bacteria 5611
350 Ga0495680_0023581 3300047322 Bacteria 5114
351 Ga0495680_0035623 3300047322 Bacteria 4006
352 Ga0495675_0063642 3300047444 Bacteria 2333
353 Ga0495684_0014222 3300047471 Bacteria 6123
354 Ga0495684_0215579 3300047471 Bacteria 1409
355 Ga0495593_0009613 3300047673 Bacteria 5614
356 Ga0495602_0260218 3300048088 Bacteria 1287
357 Ga0495602_0271055 3300048088 Bacteria 1255
358 Ga0495602_0314091 3300048088 Bacteria 1142
359 Ga0495614_0011584 3300048089 Bacteria 3877
360 Ga0495614_0060448 3300048089 Bacteria 1628
361 Ga0496102_0000636 3300048905 Bacteria 35737
362 Ga0496102_0016681 3300048905 Bacteria 6424
363 Ga0496102_0218655 3300048905 Bacteria 1795
364 Ga0496103_0108987 3300048906 Bacteria 1757
365 Ga0496104_0119600 3300048907 Bacteria 2529
366 Ga0496105_0013598 3300048908 Bacteria 6463
367 Ga0496106_0078151 3300048909 Bacteria 2538
368 Ga0496109_0291798 3300048912 Bacteria 1538
369 Ga0496110_0276706 3300048913 Bacteria 1528
370 Ga0496110_0399147 3300048913 Bacteria 1253
371 Ga0496112_0477838 3300048915 Bacteria 1183
372 Ga0496114_0006734 3300048917 Bacteria 9052
373 Ga0496114_0117597 3300048917 Bacteria 2283
374 Ga0496114_0355325 3300048917 Bacteria 1296
375 Ga0496115_0030661 3300048918 Bacteria 4232
376 Ga0496115_0482440 3300048918 Bacteria 998
377 Ga0496116_0000296 3300048919 Bacteria 84170
378 Ga0496118_0000539 3300048921 Bacteria 62235
379 Ga0496119_0000388 3300048922 Bacteria 60765
380 Ga0496119_0016325 3300048922 Bacteria 5656
381 Ga0496121_0004241 3300048924 Bacteria 19496
382 Ga0496121_0259265 3300048924 Bacteria 1201
383 Ga0496126_0013521 3300048929 Bacteria 8295
384 Ga0496126_0031571 3300048929 Bacteria 5001
385 Ga0496126_0116009 3300048929 Bacteria 2328
386 Ga0496126_0241444 3300048929 Bacteria 1509
387 Ga0501031_0133700 3300049568 Bacteria 1620
388 Ga0501032_0004017 3300049569 Bacteria 11151
389 Ga0501038_0001921 3300049574 Bacteria 19179
390 Ga0501039_0405743 3300049575 Bacteria 1070
391 Ga0501043_0027406 3300049579 Bacteria 4473
392 Ga0501046_0070477 3300049580 Bacteria 2718
393 Ga0501047_0021131 3300049581 Bacteria 6250
394 Ga0501048_0001498 3300049582 Bacteria 17679
395 Ga0501070_0017844 3300049586 Bacteria 5959
396 Ga0501035_0032659 3300049822 Bacteria 4734
397 Ga0501035_0072163 3300049822 Bacteria 3056
398 Ga0501044_0038059 3300049823 Bacteria 5023
399 nmdc:mga00v17_22238_c1 3300050491 Bacteria 3656
400 nmdc:mga0yw44_84589_c1 3300050492 Bacteria 1994
401 nmdc:mga0n895_88634_c1 3300050512 Bacteria 3094
402 Ga0495601_0013634 3300053077 Bacteria 4890
403 Ga0495601_0015987 3300053077 Bacteria 4541
404 Ga0495601_0163909 3300053077 Bacteria 1453
405 Ga0495595_0002242 3300053084 Bacteria 7519
406 Ga0495595_0037335 3300053084 Bacteria 2208
407 Ga0495595_0217818 3300053084 Bacteria 952
408 Ga0495619_0049203 3300053085 Bacteria 2779
409 Ga0500559_0067757 3300053136 Bacteria 1603
410 Ga0500559_0094503 3300053136 Bacteria 1372
411 Ga0500627_0003052 3300053158 Bacteria 5102
412 Ga0500645_000126 3300053730 Bacteria 60162
413 2579857094 2579778521 Bacteria 7624758
414 2626633836 2626541554 Bacteria 7741902
415 2738703621 2738541274 Bacteria 6909446
416 2739237573 2738543011 Bacteria 5731169
417 2739330503 2738543028 Bacteria 6917070
418 2793977300 2791355406 Bacteria 11364898
419 2844850650 2844849076 Bacteria 4091819
420 2889305069 2889300758 Bacteria 5690814
421 2902802810 2902799365 Bacteria 5419524
422 2939746334 2939743619 Bacteria 5762299
423 8047903468 8047893842 Bacteria 11723082
424 8048356726 8048356638 Bacteria 11044339
425 8048379094 8048369669 Bacteria 11666822
426 8048388199 8048379754 Bacteria 11877923
427 8054916550 8054913762 Bacteria 7713009
428 8054925050 8054920844 Bacteria 7068637
429 Ga0500616_0003360
430 JGI24737J22298_10054528
431 JGI25404J52841_10004025
432 Ga0070658_10177723
433 Ga0070658_10467398
434 Ga0070676_10087051
435 Ga0070683_100031881
436 Ga0070670_100057578
437 Ga0070680_100162841
438 Ga0070680_100263507
439 Ga0070660_100016491
440 Ga0070689_100061994
441 Ga0070691_10059340
442 Ga0070661_100013385
443 Ga0070692_10032731
444 Ga0070669_100025329
445 Ga0070675_100199671
446 Ga0070671_100065345
447 Ga0070659_100085661
448 Ga0070667_100082984
449 Ga0070703_10050818
450 Ga0070709_10000914
451 Ga0070709_10034160
452 Ga0070714_100002323
453 Ga0070714_100029497
454 Ga0070714_100058600
455 Ga0070713_100014866
456 Ga0070713_100021544
457 Ga0070713_100080515
458 Ga0070713_100095540
459 Ga0070710_10014983
460 Ga0070711_100002886
461 Ga0070711_100275355
462 Ga0070708_100053055
463 Ga0070678_100030818
464 Ga0070662_100032021
465 Ga0070681_10024117
466 Ga0070681_10339233
467 Ga0070706_100000524
468 Ga0070706_100091841
469 Ga0070707_100004798
470 Ga0070699_100005347
471 Ga0070679_100019362
472 Ga0070684_100013457
473 Ga0070684_100035573
474 Ga0070684_100195489
475 Ga0070697_100006317
476 Ga0070697_100007859
477 Ga0068853_100045842
478 Ga0070686_100031003
479 Ga0070696_100126853
480 Ga0070693_100057098
481 Ga0070665_100267972
482 Ga0070704_100134819
483 Ga0070664_100008967
484 Ga0070664_100057912
485 Ga0068857_100004279
486 Ga0068854_100161976
487 Ga0068852_100017003
488 Ga0068852_100017028
489 Ga0068859_100039136
490 Ga0068864_100016528
491 Ga0068864_100052188
492 Ga0068864_100310452
493 Ga0068866_10025404
494 Ga0068851_10033853
495 Ga0068863_100465030
496 Ga0068858_100000230
497 Ga0068858_100041462
498 Ga0068858_100233618
499 Ga0068862_100066297
500 Ga0081455_10012561
501 Ga0081540_1000395
502 Ga0081540_1000572
503 Ga0070717_10002900
504 Ga0070717_10027304
505 Ga0070717_10319372
506 Ga0075364_10010298
507 Ga0070715_10096044
508 Ga0070716_100000400
509 Ga0070716_100034759
510 Ga0070712_100032052
511 Ga0070712_100271192
512 Ga0097621_100057084
513 Ga0068871_100203593
514 Ga0075434_100101524
515 Ga0068865_100041694
516 Ga0097620_100039137
517 Ga0105245_10047314
518 Ga0105245_10062663
519 Ga0105245_10091168
520 Ga0105247_10000697
521 Ga0105247_10005958
522 Ga0105247_10052608
523 Ga0105247_10082291
524 Ga0105243_10000805
525 Ga0105243_10096290
526 Ga0105241_10089164
527 Ga0105242_10109823
528 Ga0105248_10204627
529 Ga0105237_10148050
530 Ga0105238_10243877
531 Ga0105239_10079092
532 Ga0157370_10095117
533 Ga0157369_10018359
534 Ga0157374_10030077
535 Ga0157372_10000302
536 Ga0163163_10062851
537 Ga0163163_10089259
538 Ga0163163_10320234
539 Ga0157379_10004176
540 Ga0157379_10065751
541 Ga0157376_10022207
542 Ga0163161_10204594
543 Ga0197907_10063896
544 Ga0206356_11188721
545 Ga0206354_11420767
546 Ga0206353_11562690
547 Ga0213875_10004029
548 Ga0213875_10010103
549 Ga0224712_10009823
550 Ga0224572_1017158
551 Ga0207656_10023596
552 Ga0207653_10006299
553 Ga0207692_10026047
554 Ga0207692_10050784
555 Ga0207642_10105774
556 Ga0207710_10000037
557 Ga0207710_10044713
558 Ga0207647_10028741
559 Ga0207685_10007527
560 Ga0207699_10003190
561 Ga0207699_10012906
562 Ga0207699_10048496
563 Ga0207699_10070479
564 Ga0207643_10015412
565 Ga0207684_10000775
566 Ga0207707_10103080
567 Ga0207671_10060763
568 Ga0207693_10005917
569 Ga0207693_10141708
570 Ga0207663_10051114
571 Ga0207663_10054940
572 Ga0207660_10132849
573 Ga0207662_10022109
574 Ga0207657_10078408
575 Ga0207649_10021384
576 Ga0207652_10020772
577 Ga0207646_10040177
578 Ga0207681_10134880
579 Ga0207650_10009052
580 Ga0207700_10002032
581 Ga0207700_10010726
582 Ga0207700_10011671
583 Ga0207700_10020118
584 Ga0207700_10046167
585 Ga0207700_10273614
586 Ga0207664_10003490
587 Ga0207664_10011499
588 Ga0207664_10096797
589 Ga0207664_10537345
590 Ga0207690_10007734
591 Ga0207706_10029099
592 Ga0207686_10071536
593 Ga0207709_10001137
594 Ga0207670_10085032
595 Ga0207665_10002780
596 Ga0207665_10003825
597 Ga0207665_10033775
598 Ga0207711_10299794
599 Ga0207689_10004272
600 Ga0207661_10018858
601 Ga0207679_10085885
602 Ga0207640_10263120
603 Ga0207703_10000010
604 Ga0207703_10072725
605 Ga0207678_10012351
606 Ga0207702_10052101
607 Ga0207641_10124089
608 Ga0207648_10086575
609 Ga0207676_10260582
610 Ga0207674_10008135
611 Ga0207674_10059332
612 Ga0207675_100210035
613 Ga0207698_10052649
614 Ga0207698_10391515
615 Ga0268265_10206846
616 Ga0373948_0013044
617 Ga0373926_0001473
618 Ga0373934_0046559
619 Ga0373934_0076753
620 Ga0373923_0004383
621 Ga0373923_0014048
622 Ga0373936_0001659
623 Ga0373936_0012148
624 Ga0373936_0022254
625 Ga0373945_0021290
626 Ga0373953_0054968
627 Ga0373953_0078263
628 Ga0373954_0081676
629 Ga0373954_0152613
630 Ga0373956_0046029
631 Ga0373957_0048711
632 Ga0373960_0008178
633 Ga0373943_0004966
634 Ga0373943_0007398
635 Ga0373946_0001033
636 Ga0373946_0033693
637 Ga0373955_0015838
638 Ga0373962_0019370
639 Ga0373924_0030207
640 Ga0373924_0057304
641 Ga0373924_0057469
642 Ga0373924_0072735
643 Ga0373931_0030487
644 Ga0373935_0013418
645 Ga0373935_0041479
646 Ga0373935_0060944
647 Ga0373935_0098374
648 Ga0373927_0038782
649 Ga0373927_0040829
650 Ga0373933_0037719
651 Ga0373933_0108601
652 Ga0373933_0110874
653 Ga0373947_0021426
654 Ga0373947_0247505
655 Ga0373937_0016455
656 Ga0373937_0036341
657 Ga0373937_0053488
658 Ga0373937_0058873
659 Ga0373925_0003234
660 Ga0373925_0014017
661 Ga0373925_0133814
662 Ga0373925_0249944
663 Ga0373925_0317886
664 Ga0395898_0422271
665 Ga0436364_0320639
666 Ga0436364_0427944
667 Ga0436364_0635330
668 Ga0436364_0704998
669 Ga0436364_1477292
670 Ga0436360_1133144
671 Ga0436361_0551771
672 Ga0436363_0438373
673 Ga0436363_0887527
674 Ga0439442_014697
675 Ga0466972_0036457
676 Ga0466966_0068450
677 Ga0466966_0072110
678 Ga0466961_0075915
679 Ga0466963_0039031
680 Ga0466963_0050546
681 Ga0466963_0114895
682 Ga0466963_0136820
683 Ga0466963_0186322
684 Ga0466963_0205660
685 Ga0466964_0009464
686 Ga0466968_0097626
687 Ga0466970_0041080
688 Ga0466957_0004649
689 Ga0466957_0091094
690 Ga0466957_0221138
691 Ga0466958_0020513
692 Ga0466958_0090173
693 Ga0466967_0013452
694 Ga0466967_0021986
695 Ga0466967_0040260
696 Ga0466967_0055574
697 Ga0466967_0075624
698 Ga0466967_0136000
699 Ga0466967_0281098
700 Ga0495592_0035318
701 Ga0495592_0050947
702 Ga0495629_0003058
703 Ga0495629_0009405
704 Ga0495629_0082827
705 Ga0495638_0013466
706 Ga0495641_0034072
707 Ga0495641_0143087
708 Ga0495651_0020889
709 Ga0495651_0037949
710 Ga0495651_0049534
711 Ga0495653_0025157
712 Ga0495653_0108831
713 Ga0495653_0118296
714 Ga0495580_0003971
715 Ga0495582_0134645
716 Ga0495639_0001625
717 Ga0495662_0002934
718 Ga0495662_0026097
719 Ga0495662_0106865
720 Ga0495664_0009522
721 Ga0495664_0042836
722 Ga0495664_0247293
723 Ga0495608_0014517
724 Ga0495608_0016316
725 Ga0495608_0019660
726 Ga0495608_0115256
727 Ga0495618_0050612
728 Ga0495618_0185359
729 Ga0495618_0219898
730 Ga0495618_0248169
731 Ga0495628_0064886
732 Ga0495628_0123595
733 Ga0495630_0018258
734 Ga0495630_0383118
735 Ga0495666_0006076
736 Ga0495652_0071684
737 Ga0495652_0236364
738 Ga0495665_0004283
739 Ga0495665_0043013
740 Ga0495640_0005259
741 Ga0495586_0011245
742 Ga0495586_0013890
743 Ga0495587_0042892
744 Ga0495587_0044779
745 Ga0495587_0180607
746 Ga0495667_0006809
747 Ga0495667_0017940
748 Ga0495667_0028720
749 Ga0495667_0036567
750 Ga0495667_0070947
751 Ga0495634_0065675
752 Ga0495634_0104726
753 Ga0495634_0106351
754 Ga0495635_0050248
755 Ga0495635_0101601
756 Ga0495635_0125637
757 Ga0495657_0072957
758 Ga0495657_0131874
759 Ga0495599_0059092
760 Ga0495599_0128041
761 Ga0495623_0098463
762 Ga0495658_0023698
763 Ga0495613_0012973
764 Ga0495600_0011473
765 Ga0495600_0049612
766 Ga0495581_0002856
767 Ga0495581_0064672
768 Ga0495604_0134747
769 Ga0495674_0043121
770 Ga0495674_0074462
771 Ga0495674_0087460
772 Ga0495674_0200921
773 Ga0495672_0035684
774 Ga0495676_0074934
775 Ga0495676_0136215
776 Ga0495676_0173973
777 Ga0495680_0020186
778 Ga0495680_0023581
779 Ga0495680_0035623
780 Ga0495675_0063642
781 Ga0495684_0014222
782 Ga0495684_0215579
783 Ga0495593_0009613
784 Ga0495602_0260218
785 Ga0495602_0271055
786 Ga0495602_0314091
787 Ga0495614_0011584
788 Ga0495614_0060448
789 Ga0496102_0000636
790 Ga0496102_0016681
791 Ga0496102_0218655
792 Ga0496103_0108987
793 Ga0496104_0119600
794 Ga0496105_0013598
795 Ga0496106_0078151
796 Ga0496109_0291798
797 Ga0496110_0276706
798 Ga0496110_0399147
799 Ga0496112_0477838
800 Ga0496114_0006734
801 Ga0496114_0117597
802 Ga0496114_0355325
803 Ga0496115_0030661
804 Ga0496115_0482440
805 Ga0496116_0000296
806 Ga0496118_0000539
807 Ga0496119_0000388
808 Ga0496119_0016325
809 Ga0496121_0004241
810 Ga0496121_0259265
811 Ga0496126_0013521
812 Ga0496126_0031571
813 Ga0496126_0116009
814 Ga0496126_0241444
815 Ga0501031_0133700
816 Ga0501032_0004017
817 Ga0501038_0001921
818 Ga0501039_0405743
819 Ga0501043_0027406
820 Ga0501046_0070477
821 Ga0501047_0021131
822 Ga0501048_0001498
823 Ga0501070_0017844
824 Ga0501035_0032659
825 Ga0501035_0072163
826 Ga0501044_0038059
827 nmdc:mga00v17_22238_c1
828 nmdc:mga0yw44_84589_c1
829 nmdc:mga0n895_88634_c1
830 Ga0495601_0013634
831 Ga0495601_0015987
832 Ga0495601_0163909
833 Ga0495595_0002242
834 Ga0495595_0037335
835 Ga0495595_0217818
836 Ga0495619_0049203
837 Ga0500559_0067757
838 Ga0500559_0094503
839 Ga0500627_0003052
840 Ga0500645_000126
841 2579857094
842 2626633836
843 2738703621
844 2739237573
845 2739330503
846 2793977300
847 2844850650
848 2889305069
849 2902802810
850 2939746334
851 8047903468
852 8048356726
853 8048379094
854 8048388199
855 8054916550
856 8054925050

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

55

350

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hnq-assembly1.cif.gz_A the structure of a alcohol dehydrogenase akr13b2 with nadp 0.9059 4 283
3v0t-assembly1.cif.gz_A crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding 0.902 13 290
1pz0-assembly1.cif.gz_A structure of nadph-dependent family 11 aldo-keto reductase akr11a(holo) 0.8985 2 287
3v0u-assembly1.cif.gz_A crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding 0.892 2 295
1pz1-assembly2.cif.gz_B structure of nadph-dependent family 11 aldo-keto reductase akr11b(holo) 0.8785 4 295
ID Description Score Start End Superfamily
af_F4HPY8_8_325_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9269 2 295 3.20.20.100
af_A0A0R0ETH2_7_234_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9184 2 197 3.20.20.100
af_A0A0P0W8U8_11_146_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9057 2 106 3.20.20.100
af_A0A1D6KUU8_358_629_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.902 53 295 3.20.20.100
af_Q09923_6_337_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8949 2 295 3.20.20.100
ID Description Score Start End GO Terms
AF-A0A7U9L275-F1-model_v4 Oxidoreductase 0.95 2 295 GO:0004033
GO:0005737
AF-A0A7U9L275-F1-model_v4 Oxidoreductase 0.9437 2 295 GO:0004033
GO:0005737
AF-A0A5F0GU12-F1-model_v4 deleted 0.9434 2 295
AF-A0A7Y3ANP0-F1-model_v4 Aldo/keto reductase 0.9433 2 154 GO:0004033
GO:0005737
AF-A0A2T0YGG9-F1-model_v4 Aryl-alcohol dehydrogenase-like predicted oxidoreductase 0.9421 6 295 GO:0004033
GO:0005737

Map