F441775

General Info

Members Datasets Scaffolds Average Seq Length
428 160 397 310

Family's Representative Sequence

Representative Sequence 3300049671|Ga0501238_003067|Ga0501238_003067_953_2008
Length 351
Sequence MMALSAMAPSVKSNNDTIAQAVRHCRSLIMGKTSMWNGVLCGLAAGAMWGMVFIAPEWLSAFSPVELAVGRYTAYGAMALGLMAPRLGGLLRRLDRSDLAAMLRHALAGNIVYYMLLVLGVKLAGVAPTSLIIGLLPIVVTLMGHKDHGSVPLRQLALPLLVVGAGIACINIDTFMHAADSGKPLGLTLVGVLCATGALLCWSWYAVDNARYLKRNPHFSSAEWSALYGLSTGVIALLIGGIAFLIWHADITGAAGVASGRDWGMFWTVNVLLALCASVIGNQLWNIASRRVPVTLSGQLILFETLFALLYGFIYKQAWPRPLEWSAIVLRVAGVAWSVRVHALEDELSPA

Samples

Sample ID Description Type Environment
1 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
2 2643221638 Duganella sp. Root336D2 Isolate Unclassified
3 2643221645 Massilia sp. Root351 Isolate Unclassified
4 2643221664 Massilia sp. Root418 Isolate Unclassified
5 2738541280 Massilia sp. GV090 Isolate Unclassified
6 2738541297 Duganella sp. GV083 Isolate Unclassified
7 2738541300 Massilia sp. GV016 Isolate Unclassified
8 2738541357 Duganella sp. GV053 Isolate Unclassified
9 2738543003 Duganella sp. GV066 Isolate Unclassified
10 2738543018 Massilia sp. GV045 Isolate Unclassified
11 2738543026 Duganella sp. GV089 Isolate Unclassified
12 2738543029 Duganella sp. GV039 Isolate Unclassified
13 2738543030 Massilia sp. GV097 Isolate Unclassified
14 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
15 2821131069 Duganella sp. 1224 Isolate Unclassified
16 2842711865 Duganella sp. R-73148 Isolate Unclassified
17 2857553236 Duganella sp. R-74557 Isolate Unclassified
18 2857558681 Duganella sp. R-74565 Isolate Unclassified
19 2857564685 Duganella sp. R-74599 Isolate Unclassified
20 2904424332 Duganella sp. 1411 Isolate Rhizosphere
21 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
22 2919476304 Duganella sp. 3397 Isolate Unclassified
23 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
24 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
25 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
26 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
27 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
28 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
29 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
30 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
31 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
32 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
33 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
34 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
35 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
36 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
37 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
38 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
39 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
40 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
41 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
42 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
43 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
44 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
45 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
46 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
47 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
53 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
54 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
55 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
56 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
57 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
58 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
59 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
60 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
61 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
62 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
63 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
64 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
66 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
67 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
68 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
69 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
71 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
73 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
74 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
79 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
80 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
81 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
82 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
83 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
84 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
85 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
86 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
87 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
88 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
89 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
90 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
91 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
92 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
93 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
94 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
95 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
96 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
97 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
98 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
99 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
100 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
101 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
102 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
103 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
104 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
105 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
106 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
107 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
108 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
109 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
110 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
111 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
112 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
113 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
114 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
115 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
116 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
117 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
118 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
119 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
120 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
121 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
122 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
123 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
124 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
125 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
126 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
127 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
128 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
129 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
130 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
131 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
132 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
133 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
134 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
135 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
136 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
137 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
138 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
139 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
140 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
141 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
142 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
143 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
144 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
145 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
146 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
147 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
148 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
149 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
150 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
151 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
152 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
153 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
154 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
155 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
156 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
157 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
158 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
159 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
160 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.76
Metatranscriptomes 0
Isolates 7.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.56
Nodule 1.17
Rhizoplane 0.47
Rhizosphere 64.49
Stem 0
Stem Tuber 0
Unclassified 13.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25154J39366_1001144 3300002738 Bacteria 10265
2 JGI25158J39367_1003933 3300002739 Bacteria 2253
3 JGI25152J39213_1000005 3300002773 Bacteria 160019
4 JGI25150J39212_1000655 3300002774 Bacteria 12871
5 JGI25150J39212_1002372 3300002774 Bacteria 4723
6 JGI25159J45721_1000430 3300002987 Bacteria 19355
7 JGI25159J45721_1004626 3300002987 Bacteria 4508
8 JGI25153J46596_10024648 3300003215 Bacteria 2165
9 rootL2_10025948 3300003322 Bacteria 18633
10 rootL2_10077728 3300003322 Bacteria 2941
11 rootL2_10175561 3300003322 Bacteria 2442
12 rootH1_10066766 3300003323 Bacteria 1593
13 rootH1_10259216 3300003323 Bacteria 1996
14 JGI25161J50226_1000182 3300003374 Bacteria 42010
15 Ga0055529_1000027 3300003763 Bacteria 292744
16 Ga0055529_1000068 3300003763 Bacteria 163911
17 Ga0055526_1000013 3300003771 Bacteria 233580
18 Ga0055526_1000026 3300003771 Bacteria 154116
19 Ga0055526_1000048 3300003771 Bacteria 120076
20 Ga0055526_1000135 3300003771 Bacteria 65528
21 Ga0055526_1000780 3300003771 Bacteria 23749
22 Ga0055526_1001035 3300003771 Bacteria 20352
23 Ga0055526_1002186 3300003771 Bacteria 13404
24 Ga0055537_1000039 3300003773 Bacteria 92151
25 Ga0055537_1004607 3300003773 Bacteria 3902
26 Ga0055537_1011705 3300003773 Bacteria 1758
27 Ga0055524_1000008 3300003775 Bacteria 297761
28 Ga0055524_1000187 3300003775 Bacteria 68927
29 Ga0055524_1000526 3300003775 Bacteria 29329
30 Ga0055524_1015113 3300003775 Bacteria 2828
31 Ga0055534_1001322 3300003784 Bacteria 9954
32 Ga0055528_1000066 3300003790 Bacteria 84724
33 Ga0055530_10000946 3300003791 Bacteria 23742
34 Ga0055531_10009354 3300003794 Bacteria 5018
35 Ga0055543_1000112 3300004625 Bacteria 69589
36 Ga0065165_1000005 3300005262 Bacteria 370361
37 Ga0065165_1001050 3300005262 Bacteria 33276
38 Ga0065165_1017597 3300005262 Bacteria 2625
39 Ga0070717_10054555 3300006028 Bacteria 3296
40 Ga0075363_100022116 3300006048 Bacteria 3212
41 Ga0075362_10027518 3300006177 Bacteria 2435
42 Ga0079104_1009130 3300006946 Bacteria 3385
43 Ga0079104_1009258 3300006946 Bacteria 3351
44 Ga0099826_10000001 3300006948 Bacteria 1155201
45 Ga0105244_10005186 3300009036 Bacteria 8725
46 Ga0105244_10006196 3300009036 Bacteria 7805
47 Ga0105244_10007005 3300009036 Bacteria 7215
48 Ga0105241_10046814 3300009174 Bacteria 3286
49 Ga0105237_10016491 3300009545 Bacteria 7674
50 Ga0105238_10010400 3300009551 Bacteria 9339
51 Ga0105238_10020011 3300009551 Bacteria 6813
52 Ga0105239_10023625 3300010375 Bacteria 6769
53 Ga0157371_10000128 3300013102 Bacteria 116349
54 Ga0182008_10091047 3300014497 Bacteria 1503
55 Ga0182006_1000040 3300015261 Bacteria 209209
56 Ga0182006_1000056 3300015261 Bacteria 169631
57 Ga0182007_10009521 3300015262 Bacteria 3911
58 Ga0182005_1000001 3300015265 Bacteria 1014869
59 Ga0182005_1000013 3300015265 Bacteria 396391
60 Ga0182005_1000066 3300015265 Bacteria 89024
61 Ga0213872_10000032 3300021361 Bacteria 138939
62 Ga0213872_10000808 3300021361 Bacteria 22711
63 Ga0213872_10001264 3300021361 Bacteria 17011
64 Ga0213872_10013245 3300021361 Bacteria 3867
65 Ga0213872_10023549 3300021361 Bacteria 2833
66 Ga0213872_10059851 3300021361 Bacteria 1723
67 Ga0209436_101261 3300025208 Bacteria 9087
68 Ga0209436_109663 3300025208 Bacteria 1818
69 Ga0209437_101730 3300025233 Bacteria 4793
70 Ga0207425_1000001 3300025245 Bacteria 2525432
71 Ga0207425_1000056 3300025245 Bacteria 151802
72 Ga0207425_1000132 3300025245 Bacteria 68018
73 Ga0207425_1000212 3300025245 Bacteria 46073
74 Ga0209646_1000007 3300025246 Bacteria 670994
75 Ga0209129_1000003 3300025258 Bacteria 903689
76 Ga0209565_1000003 3300025263 Bacteria 1099648
77 Ga0209565_1009822 3300025263 Bacteria 2400
78 Ga0209565_1010793 3300025263 Bacteria 2253
79 Ga0209565_1011574 3300025263 Bacteria 2140
80 Ga0209455_1000026 3300025272 Bacteria 653778
81 Ga0209455_1000033 3300025272 Bacteria 504606
82 Ga0209673_1000003 3300025273 Bacteria 980859
83 Ga0209673_1014416 3300025273 Bacteria 3058
84 Ga0209130_1000084 3300025284 Bacteria 160070
85 Ga0209130_1000237 3300025284 Bacteria 70739
86 Ga0209130_1004253 3300025284 Bacteria 5551
87 Ga0209130_1019927 3300025284 Bacteria 1544
88 Ga0209675_1000003 3300025291 Bacteria 1003982
89 Ga0209675_1004244 3300025291 Bacteria 6459
90 Ga0209675_1023142 3300025291 Bacteria 1615
91 Ga0209025_1002422 3300025294 Bacteria 19823
92 Ga0209564_1000002 3300025295 Bacteria 1636803
93 Ga0209564_1000007 3300025295 Bacteria 1028582
94 Ga0209564_1000012 3300025295 Bacteria 792078
95 Ga0209564_1000028 3300025295 Bacteria 510986
96 Ga0209564_1000311 3300025295 Bacteria 95587
97 Ga0209564_1000493 3300025295 Bacteria 65593
98 Ga0209564_1021378 3300025295 Bacteria 2330
99 Ga0209758_1000041 3300025297 Bacteria 410328
100 Ga0209758_1000278 3300025297 Bacteria 102052
101 Ga0209758_1000757 3300025297 Bacteria 46825
102 Ga0209050_1000011 3300025298 Bacteria 914037
103 Ga0209050_1000164 3300025298 Bacteria 154628
104 Ga0209050_1000280 3300025298 Bacteria 108968
105 Ga0209050_1000664 3300025298 Bacteria 52795
106 Ga0209256_1000005 3300025299 Bacteria 1315082
107 Ga0209256_1000068 3300025299 Bacteria 246064
108 Ga0209256_1000395 3300025299 Bacteria 69343
109 Ga0209256_1000660 3300025299 Bacteria 46727
110 Ga0209256_1000702 3300025299 Bacteria 44556
111 Ga0207426_1005069 3300025302 Bacteria 6159
112 Ga0209257_1000003 3300025304 Bacteria 1702593
113 Ga0209257_1005947 3300025304 Bacteria 8195
114 Ga0207655_1006357 3300025728 Bacteria 7841
115 Ga0207655_1007077 3300025728 Bacteria 7330
116 Ga0207655_1038590 3300025728 Bacteria 2085
117 Ga0207711_10499539 3300025941 Bacteria 1134
118 Ga0207667_10028993 3300025949 Bacteria 6008
119 Ga0209281_1009310 3300027111 Bacteria 2314
120 Ga0209282_1000001 3300027666 Bacteria 2450367
121 Ga0307515_10203045 3300028794 Bacteria 1852
122 Ga0307515_10399349 3300028794 Bacteria 1001
123 Ga0316180_1013000 3300030736 Bacteria 3371
124 Ga0316181_1055314 3300030744 Bacteria 2550
125 Ga0316182_1076537 3300030745 Bacteria 1456
126 Ga0307408_100000490 3300031548 Bacteria 34547
127 Ga0307408_100001138 3300031548 Bacteria 20213
128 Ga0307408_100023608 3300031548 Bacteria 4191
129 Ga0307408_100023969 3300031548 Bacteria 4161
130 Ga0307416_100183567 3300032002 Bacteria 1963
131 Ga0373939_0003826 3300035114 Bacteria 3548
132 Ga0395898_0010659 3300037466 Bacteria 9603
133 Ga0436361_0008254 3300039447 Bacteria 11524
134 Ga0436361_0013548 3300039447 Bacteria 13684
135 Ga0436361_0075349 3300039447 Bacteria 1427
136 Ga0436361_0118687 3300039447 Bacteria 8333
137 Ga0436361_0168778 3300039447 Bacteria 51987
138 Ga0436361_0513300 3300039447 Bacteria 7654
139 Ga0466965_0013547 3300044683 Bacteria 3849
140 Ga0466970_0040576 3300044765 Bacteria 2472
141 Ga0495617_000011 3300046452 Bacteria 301936
142 Ga0495617_000042 3300046452 Bacteria 122225
143 Ga0495617_002857 3300046452 Bacteria 6656
144 Ga0495617_028168 3300046452 Bacteria 1888
145 Ga0495617_073761 3300046452 Bacteria 1121
146 Ga0495627_000001 3300046453 Bacteria 1104709
147 Ga0495590_0000010 3300046457 Bacteria 317890
148 Ga0495590_0000022 3300046457 Bacteria 205122
149 Ga0495590_0004835 3300046457 Bacteria 5393
150 Ga0495590_0046669 3300046457 Bacteria 1511
151 Ga0495638_0000027 3300046460 Bacteria 337569
152 Ga0495638_0000229 3300046460 Bacteria 76824
153 Ga0495638_0007698 3300046460 Bacteria 7697
154 Ga0495638_0046474 3300046460 Bacteria 2727
155 Ga0495638_0049579 3300046460 Bacteria 2625
156 Ga0495638_0054324 3300046460 Bacteria 2490
157 Ga0495638_0071034 3300046460 Bacteria 2130
158 Ga0495638_0083423 3300046460 Bacteria 1936
159 Ga0495638_0127121 3300046460 Bacteria 1501
160 Ga0495653_0000029 3300046463 Bacteria 145049
161 Ga0495653_0000096 3300046463 Bacteria 73391
162 Ga0495650_0000044 3300046471 Bacteria 355139
163 Ga0495650_0000066 3300046471 Bacteria 272883
164 Ga0495650_0000359 3300046471 Bacteria 80406
165 Ga0495650_0000481 3300046471 Bacteria 61012
166 Ga0495650_0000633 3300046471 Bacteria 47224
167 Ga0495650_0001268 3300046471 Bacteria 26031
168 Ga0495650_0005109 3300046471 Bacteria 8673
169 Ga0495650_0005921 3300046471 Bacteria 7770
170 Ga0495650_0010852 3300046471 Bacteria 5049
171 Ga0495650_0020315 3300046471 Bacteria 3241
172 Ga0495650_0045129 3300046471 Bacteria 1857
173 Ga0495605_0000027 3300046474 Bacteria 220680
174 Ga0495605_0000041 3300046474 Bacteria 193873
175 Ga0495605_0040584 3300046474 Bacteria 2322
176 Ga0495639_0014218 3300046475 Bacteria 3444
177 Ga0495584_0000995 3300046491 Bacteria 17781
178 Ga0495584_0012900 3300046491 Bacteria 4266
179 Ga0495584_0032037 3300046491 Bacteria 2661
180 Ga0495585_0001481 3300046492 Bacteria 18333
181 Ga0495585_0006638 3300046492 Bacteria 7151
182 Ga0495585_0018226 3300046492 Bacteria 4051
183 Ga0495607_0000845 3300046501 Bacteria 28952
184 Ga0495607_0020015 3300046501 Bacteria 4238
185 Ga0495607_0036840 3300046501 Bacteria 2944
186 Ga0495583_0000006 3300046506 Bacteria 436893
187 Ga0495583_0000021 3300046506 Bacteria 287046
188 Ga0495583_0004667 3300046506 Bacteria 9659
189 Ga0495583_0038059 3300046506 Bacteria 2275
190 Ga0495606_0000004 3300046507 Bacteria 406209
191 Ga0495606_0000125 3300046507 Bacteria 130102
192 Ga0495606_0000128 3300046507 Bacteria 128179
193 Ga0495606_0000147 3300046507 Bacteria 122261
194 Ga0495606_0000396 3300046507 Bacteria 73433
195 Ga0495606_0000557 3300046507 Bacteria 59505
196 Ga0495606_0000618 3300046507 Bacteria 55944
197 Ga0495606_0000699 3300046507 Bacteria 52011
198 Ga0495606_0002142 3300046507 Bacteria 23800
199 Ga0495606_0005100 3300046507 Bacteria 12762
200 Ga0495606_0007352 3300046507 Bacteria 9886
201 Ga0495606_0008537 3300046507 Bacteria 8876
202 Ga0495606_0016214 3300046507 Bacteria 5691
203 Ga0495606_0034284 3300046507 Bacteria 3486
204 Ga0495610_0000007 3300046512 Bacteria 820919
205 Ga0495610_0000008 3300046512 Bacteria 622732
206 Ga0495610_0004263 3300046512 Bacteria 10645
207 Ga0495610_0007569 3300046512 Bacteria 7192
208 Ga0495610_0008857 3300046512 Bacteria 6448
209 Ga0495610_0009209 3300046512 Bacteria 6267
210 Ga0495610_0014110 3300046512 Bacteria 4712
211 Ga0495610_0026645 3300046512 Bacteria 3083
212 Ga0495610_0098542 3300046512 Bacteria 1313
213 Ga0495616_0004525 3300046513 Bacteria 8754
214 Ga0495637_0000067 3300046520 Bacteria 86002
215 Ga0495637_0001034 3300046520 Bacteria 17431
216 Ga0495637_0001897 3300046520 Bacteria 11922
217 Ga0495637_0005373 3300046520 Bacteria 6543
218 Ga0495643_0000022 3300046522 Bacteria 289691
219 Ga0495643_0000065 3300046522 Bacteria 179031
220 Ga0495643_0000318 3300046522 Bacteria 66545
221 Ga0495643_0003467 3300046522 Bacteria 11520
222 Ga0495643_0053206 3300046522 Bacteria 2171
223 Ga0495644_0002052 3300046523 Bacteria 8123
224 Ga0495648_0000004 3300046524 Bacteria 373639
225 Ga0495648_0000078 3300046524 Bacteria 127397
226 Ga0495648_0000223 3300046524 Bacteria 64966
227 Ga0495648_0001086 3300046524 Bacteria 27654
228 Ga0495648_0004292 3300046524 Bacteria 12217
229 Ga0495648_0006148 3300046524 Bacteria 9841
230 Ga0495648_0016677 3300046524 Bacteria 5286
231 Ga0495663_0036804 3300046525 Bacteria 1474
232 Ga0495642_0001002 3300046528 Bacteria 13116
233 Ga0495642_0003930 3300046528 Bacteria 5814
234 Ga0495642_0015282 3300046528 Bacteria 2982
235 Ga0495642_0166539 3300046528 Bacteria 957
236 Ga0495654_0000002 3300046530 Bacteria 1021205
237 Ga0495654_0000025 3300046530 Bacteria 236572
238 Ga0495654_0002388 3300046530 Bacteria 12111
239 Ga0495654_0006029 3300046530 Bacteria 6957
240 Ga0495654_0015222 3300046530 Bacteria 4088
241 Ga0495609_0004354 3300046538 Bacteria 7777
242 Ga0495609_0006453 3300046538 Bacteria 5981
243 Ga0495609_0007864 3300046538 Bacteria 5271
244 Ga0495609_0028414 3300046538 Bacteria 2552
245 Ga0495609_0036185 3300046538 Bacteria 2230
246 Ga0495609_0066204 3300046538 Bacteria 1591
247 Ga0495597_0000035 3300046542 Bacteria 119038
248 Ga0495597_0000107 3300046542 Bacteria 73749
249 Ga0495597_0000147 3300046542 Bacteria 62147
250 Ga0495597_0000161 3300046542 Bacteria 59525
251 Ga0495597_0024593 3300046542 Bacteria 2778
252 Ga0495597_0052077 3300046542 Bacteria 1803
253 Ga0495622_0000009 3300046557 Bacteria 224622
254 Ga0495622_0000043 3300046557 Bacteria 115796
255 Ga0495622_0002366 3300046557 Bacteria 9172
256 Ga0495633_0000024 3300046558 Bacteria 225077
257 Ga0495633_0000068 3300046558 Bacteria 136733
258 Ga0495633_0000381 3300046558 Bacteria 47007
259 Ga0495633_0005641 3300046558 Bacteria 7589
260 Ga0495633_0008709 3300046558 Bacteria 5688
261 Ga0495633_0010288 3300046558 Bacteria 5115
262 Ga0495633_0012311 3300046558 Bacteria 4558
263 Ga0495633_0012378 3300046558 Bacteria 4541
264 Ga0495633_0012710 3300046558 Bacteria 4465
265 Ga0495633_0026084 3300046558 Bacteria 2870
266 Ga0495633_0047778 3300046558 Bacteria 2022
267 Ga0495633_0138527 3300046558 Bacteria 1125
268 Ga0495656_0026312 3300046615 Bacteria 2315
269 Ga0495668_0000006 3300046616 Bacteria 553404
270 Ga0495668_0000027 3300046616 Bacteria 297194
271 Ga0495668_0000096 3300046616 Bacteria 139693
272 Ga0495668_0001010 3300046616 Bacteria 30202
273 Ga0495668_0001045 3300046616 Bacteria 29353
274 Ga0495668_0002385 3300046616 Bacteria 15576
275 Ga0495668_0003650 3300046616 Bacteria 11373
276 Ga0495668_0004306 3300046616 Bacteria 10188
277 Ga0495668_0006229 3300046616 Bacteria 7875
278 Ga0495611_0005186 3300046648 Bacteria 5585
279 Ga0495611_0005326 3300046648 Bacteria 5504
280 Ga0495625_0000053 3300046660 Bacteria 190575
281 Ga0495625_0000257 3300046660 Bacteria 82608
282 Ga0495625_0002769 3300046660 Bacteria 18512
283 Ga0495625_0003391 3300046660 Bacteria 15954
284 Ga0495625_0003737 3300046660 Bacteria 14816
285 Ga0495625_0006585 3300046660 Bacteria 10312
286 Ga0495625_0019246 3300046660 Bacteria 5302
287 Ga0495625_0081307 3300046660 Bacteria 2255
288 Ga0495659_0000001 3300046664 Bacteria 325846
289 Ga0495659_0000161 3300046664 Bacteria 30006
290 Ga0495659_0001691 3300046664 Bacteria 7381
291 Ga0495659_0018898 3300046664 Bacteria 2301
292 Ga0495661_0005218 3300046665 Bacteria 9246
293 Ga0495588_0111171 3300046674 Bacteria 1443
294 Ga0495669_0000429 3300046684 Bacteria 19950
295 Ga0495670_0038892 3300046691 Bacteria 2372
296 Ga0495671_0000002 3300046692 Bacteria 1136189
297 Ga0495671_0000033 3300046692 Bacteria 197509
298 Ga0495671_0000035 3300046692 Bacteria 188543
299 Ga0495671_0015913 3300046692 Bacteria 4025
300 Ga0495671_0036659 3300046692 Bacteria 2483
301 Ga0495649_0007156 3300046694 Bacteria 6852
302 Ga0495649_0032300 3300046694 Bacteria 2884
303 Ga0495649_0040174 3300046694 Bacteria 2563
304 Ga0495649_0057400 3300046694 Bacteria 2099
305 Ga0495649_0057742 3300046694 Bacteria 2092
306 Ga0495649_0063737 3300046694 Bacteria 1980
307 Ga0495649_0100439 3300046694 Bacteria 1538
308 Ga0495660_0000347 3300046810 Bacteria 41013
309 Ga0495660_0000543 3300046810 Bacteria 30889
310 Ga0495660_0002087 3300046810 Bacteria 12954
311 Ga0495660_0004396 3300046810 Bacteria 8536
312 Ga0495660_0004699 3300046810 Bacteria 8238
313 Ga0495660_0021040 3300046810 Bacteria 3738
314 Ga0495660_0026714 3300046810 Bacteria 3270
315 Ga0495660_0032393 3300046810 Bacteria 2935
316 Ga0495636_0000594 3300047318 Bacteria 13305
317 Ga0495636_0106076 3300047318 Bacteria 1232
318 Ga0495672_0000066 3300047320 Bacteria 193318
319 Ga0495672_0000095 3300047320 Bacteria 143883
320 Ga0495672_0005036 3300047320 Bacteria 10568
321 Ga0495672_0008167 3300047320 Bacteria 7764
322 Ga0495683_0033015 3300047323 Bacteria 2636
323 Ga0495687_000910 3300047443 Bacteria 30905
324 Ga0495687_002084 3300047443 Bacteria 16810
325 Ga0495687_004867 3300047443 Bacteria 8818
326 Ga0495687_006262 3300047443 Bacteria 7340
327 Ga0495687_014441 3300047443 Bacteria 4065
328 Ga0495677_0014380 3300047445 Bacteria 2882
329 Ga0495677_0024885 3300047445 Bacteria 2172
330 Ga0495679_012137 3300047446 Bacteria 3291
331 Ga0495679_025880 3300047446 Bacteria 1955
332 Ga0495679_051084 3300047446 Bacteria 1241
333 Ga0495685_000099 3300047447 Bacteria 31691
334 Ga0495685_011546 3300047447 Bacteria 2982
335 Ga0495673_0000005 3300047469 Bacteria 943364
336 Ga0495673_0000031 3300047469 Bacteria 447868
337 Ga0495673_0000059 3300047469 Bacteria 233234
338 Ga0495673_0000064 3300047469 Bacteria 225793
339 Ga0495673_0000074 3300047469 Bacteria 210788
340 Ga0495673_0000166 3300047469 Bacteria 112730
341 Ga0495673_0009172 3300047469 Bacteria 5491
342 Ga0495681_0006688 3300047470 Bacteria 7526
343 Ga0495681_0015108 3300047470 Bacteria 4382
344 Ga0495686_0000874 3300047472 Bacteria 38436
345 Ga0495686_0001028 3300047472 Bacteria 33622
346 Ga0495686_0008269 3300047472 Bacteria 7659
347 Ga0495686_0011150 3300047472 Bacteria 6343
348 Ga0495686_0028400 3300047472 Bacteria 3644
349 Ga0495686_0029727 3300047472 Bacteria 3553
350 Ga0495686_0030737 3300047472 Bacteria 3486
351 Ga0495686_0177173 3300047472 Bacteria 1237
352 Ga0496102_0000254 3300048905 Bacteria 69564
353 Ga0496103_0005857 3300048906 Bacteria 7343
354 Ga0496117_0000001 3300048920 Bacteria 2526244
355 Ga0496117_0120168 3300048920 Bacteria 1616
356 Ga0496118_0000002 3300048921 Bacteria 1690764
357 Ga0496118_0138755 3300048921 Bacteria 1546
358 Ga0496120_0049067 3300048923 Bacteria 2425
359 Ga0496121_0011235 3300048924 Bacteria 9979
360 Ga0496121_0176683 3300048924 Bacteria 1545
361 Ga0496121_0193874 3300048924 Bacteria 1454
362 Ga0496122_0023299 3300048925 Bacteria 5466
363 Ga0496122_0051832 3300048925 Bacteria 3113
364 Ga0496122_0051878 3300048925 Bacteria 3111
365 Ga0496123_0008740 3300048926 Bacteria 9248
366 Ga0496123_0011308 3300048926 Bacteria 7755
367 Ga0496124_0040724 3300048927 Bacteria 4017
368 Ga0496124_0088166 3300048927 Bacteria 2537
369 Ga0496124_0102882 3300048927 Bacteria 2310
370 Ga0496124_0136625 3300048927 Bacteria 1940
371 Ga0496126_0003829 3300048929 Bacteria 18629
372 Ga0496126_0027211 3300048929 Bacteria 5466
373 Ga0495678_000002 3300049459 Bacteria 999613
374 Ga0495678_000588 3300049459 Bacteria 34196
375 Ga0495678_000937 3300049459 Bacteria 25350
376 Ga0495678_001787 3300049459 Bacteria 15903
377 Ga0495678_005057 3300049459 Bacteria 7413
378 Ga0495678_007359 3300049459 Bacteria 5718
379 Ga0495678_026950 3300049459 Bacteria 2444
380 Ga0495678_031237 3300049459 Bacteria 2222
381 Ga0495678_095332 3300049459 Bacteria 1040
382 Ga0495682_0000302 3300049460 Bacteria 37440
383 Ga0501222_004290 3300049662 Bacteria 1937
384 Ga0501227_005408 3300049665 Bacteria 2732
385 Ga0501238_003067 3300049671 Bacteria 2040
386 Ga0501249_003795 3300049679 Bacteria 3050
387 Ga0501269_000250 3300049766 Bacteria 15521
388 Ga0501279_001712 3300049775 Bacteria 2882
389 Ga0501279_002266 3300049775 Bacteria 2530
390 nmdc:mga03683_69752_c1 3300050489 Bacteria 1500
391 nmdc:mga03683_96783_c1 3300050489 Bacteria 1293
392 nmdc:mga03n38_50533_c1 3300050490 Bacteria 1853
393 Ga0500618_000137 3300053125 Bacteria 61561
394 Ga0500618_000166 3300053125 Bacteria 55289
395 Ga0500618_008414 3300053125 Bacteria 2880
396 Ga0500586_000047 3300053145 Bacteria 21273
397 Ga0500586_001137 3300053145 Bacteria 5513

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003771 Ga0055526_1000135 Ga0055526_100013547 269
2 3300025295 Ga0209564_1000493 Ga0209564_100049323 269
3 3300048924 Ga0496121_0011235 Ga0496121_0011235_7273_8211 269
4 3300002774 JGI25150J39212_1002372 JGI25150J39212_10023724 270
5 3300025245 Ga0207425_1000132 Ga0207425_100013249 270
6 3300025297 Ga0209758_1000757 Ga0209758_100075736 270
7 3300046460 Ga0495638_0127121 Ga0495638_0127121_570_1490 270
8 3300046542 Ga0495597_0000107 Ga0495597_0000107_46775_47695 270
9 3300046522 Ga0495643_0000022 Ga0495643_0000022_115868_116788 271
10 3300046694 Ga0495649_0057742 Ga0495649_0057742_1001_1921 271
11 3300047320 Ga0495672_0000095 Ga0495672_0000095_74757_75677 271
12 3300049459 Ga0495678_000588 Ga0495678_000588_3359_4279 271
13 3300046460 Ga0495638_0046474 Ga0495638_0046474_1129_2028 273
14 3300046471 Ga0495650_0000359 Ga0495650_0000359_26024_26920 273
15 3300047469 Ga0495673_0000074 Ga0495673_0000074_16751_17722 273
16 3300025233 Ga0209437_101730 Ga0209437_1017306 274
17 3300046520 Ga0495637_0005373 Ga0495637_0005373_3588_4544 274
18 3300046660 Ga0495625_0002769 Ga0495625_0002769_4733_5632 274
19 3300028794 Ga0307515_10399349 Ga0307515_103993491 275
20 3300021361 Ga0213872_10059851 Ga0213872_100598512 276
21 3300025941 Ga0207711_10499539 Ga0207711_104995392 276
22 3300046471 Ga0495650_0045129 Ga0495650_0045129_719_1630 277
23 3300050489 nmdc:mga03683_96783_c1 nmdc:mga03683_96783_c1_38_961 277
24 3300046471 Ga0495650_0020315 Ga0495650_0020315_266_1225 279
25 3300046512 Ga0495610_0000007 Ga0495610_0000007_597860_598807 279
26 3300046512 Ga0495610_0098542 Ga0495610_0098542_206_1162 279
27 3300046520 Ga0495637_0001034 Ga0495637_0001034_16447_17403 279
28 3300046524 Ga0495648_0004292 Ga0495648_0004292_29_976 279
29 3300046530 Ga0495654_0000025 Ga0495654_0000025_178011_178967 279
30 3300046692 Ga0495671_0000033 Ga0495671_0000033_116304_117251 279
31 3300046810 Ga0495660_0032393 Ga0495660_0032393_1653_2594 279
32 3300047323 Ga0495683_0033015 Ga0495683_0033015_1227_2171 280
33 3300047472 Ga0495686_0177173 Ga0495686_0177173_216_1160 280
34 3300046507 Ga0495606_0008537 Ga0495606_0008537_3234_4211 281
35 3300047469 Ga0495673_0000031 Ga0495673_0000031_84950_85897 281
36 3300048929 Ga0496126_0003829 Ga0496126_0003829_4362_5312 281
37 3300003771 Ga0055526_1000026 Ga0055526_100002692 282
38 3300025295 Ga0209564_1000028 Ga0209564_1000028283 282
39 3300046474 Ga0495605_0000027 Ga0495605_0000027_59354_60313 282
40 3300046507 Ga0495606_0007352 Ga0495606_0007352_5866_6825 282
41 3300046524 Ga0495648_0001086 Ga0495648_0001086_10138_11097 282
42 3300047469 Ga0495673_0000005 Ga0495673_0000005_609703_610701 282
43 3300048929 Ga0496126_0027211 Ga0496126_0027211_323_1321 282
44 3300053125 Ga0500618_000137 Ga0500618_000137_22294_23292 282
45 3300046463 Ga0495653_0000096 Ga0495653_0000096_66575_67537 283
46 3300046507 Ga0495606_0000125 Ga0495606_0000125_63267_64226 283
47 3300046507 Ga0495606_0002142 Ga0495606_0002142_8017_8976 283
48 3300046512 Ga0495610_0009209 Ga0495610_0009209_4401_5360 283
49 3300046558 Ga0495633_0000024 Ga0495633_0000024_204164_205123 283
50 3300046558 Ga0495633_0012311 Ga0495633_0012311_2381_3340 283
51 3300046558 Ga0495633_0012378 Ga0495633_0012378_286_1245 283
52 3300046616 Ga0495668_0000027 Ga0495668_0000027_65811_66770 283
53 3300046692 Ga0495671_0000002 Ga0495671_0000002_784545_785504 283
54 3300047472 Ga0495686_0029727 Ga0495686_0029727_1462_2421 283
55 3300048924 Ga0496121_0193874 Ga0496121_0193874_20_934 283
56 3300048925 Ga0496122_0051832 Ga0496122_0051832_801_1763 283
57 3300048925 Ga0496122_0051878 Ga0496122_0051878_913_1872 283
58 3300048926 Ga0496123_0008740 Ga0496123_0008740_1742_2704 283
59 3300053145 Ga0500586_000047 Ga0500586_000047_9979_10938 283
60 3300003322 rootL2_10077728 rootL2_100777282 284
61 3300003322 rootL2_10175561 rootL2_101755614 284
62 3300028794 Ga0307515_10203045 Ga0307515_102030452 284
63 3300046452 Ga0495617_028168 Ga0495617_028168_1002_1859 284
64 3300046452 Ga0495617_073761 Ga0495617_073761_230_1087 284
65 3300046512 Ga0495610_0000008 Ga0495610_0000008_187799_188758 284
66 3300046660 Ga0495625_0081307 Ga0495625_0081307_1011_1970 284
67 3300046684 Ga0495669_0000429 Ga0495669_0000429_24_881 284
68 3300048923 Ga0496120_0049067 Ga0496120_0049067_19_930 284
69 3300048925 Ga0496122_0023299 Ga0496122_0023299_1959_2870 284
70 3300048926 Ga0496123_0011308 Ga0496123_0011308_2924_3835 284
71 3300046507 Ga0495606_0000128 Ga0495606_0000128_61546_62508 285
72 3300014497 Ga0182008_10091047 Ga0182008_100910472 286
73 3300046452 Ga0495617_002857 Ga0495617_002857_1920_2783 287
74 3300046507 Ga0495606_0000004 Ga0495606_0000004_61576_62487 288
75 3300046694 Ga0495649_0100439 Ga0495649_0100439_582_1493 288
76 3300003771 Ga0055526_1000048 Ga0055526_100004860 290
77 3300025295 Ga0209564_1000007 Ga0209564_1000007293 290
78 3300046471 Ga0495650_0000066 Ga0495650_0000066_200142_201101 290
79 3300046512 Ga0495610_0007569 Ga0495610_0007569_3150_4097 290
80 3300046524 Ga0495648_0006148 Ga0495648_0006148_6444_7391 290
81 3300046538 Ga0495609_0028414 Ga0495609_0028414_1023_1970 290
82 3300046616 Ga0495668_0002385 Ga0495668_0002385_3322_4281 290
83 3300047445 Ga0495677_0014380 Ga0495677_0014380_1313_2260 290
84 3300046507 Ga0495606_0005100 Ga0495606_0005100_547_1470 291
85 3300046542 Ga0495597_0000147 Ga0495597_0000147_54115_55062 291
86 3300048924 Ga0496121_0176683 Ga0496121_0176683_503_1501 291
87 3300048927 Ga0496124_0088166 Ga0496124_0088166_352_1350 291
88 3300046501 Ga0495607_0020015 Ga0495607_0020015_48_1004 292
89 3300047472 Ga0495686_0030737 Ga0495686_0030737_1994_2881 292
90 3300053125 Ga0500618_000166 Ga0500618_000166_5049_5987 292
91 3300046616 Ga0495668_0001045 Ga0495668_0001045_5462_6418 293
92 3300048920 Ga0496117_0000001 Ga0496117_0000001_791136_792074 293
93 3300048921 Ga0496118_0000002 Ga0496118_0000002_791136_792074 293
94 3300009036 Ga0105244_10006196 Ga0105244_100061966 294
95 3300025728 Ga0207655_1006357 Ga0207655_10063576 294
96 3300046512 Ga0495610_0004263 Ga0495610_0004263_7842_8825 294
97 3300003215 JGI25153J46596_10024648 JGI25153J46596_100246483 295
98 3300003323 rootH1_10066766 rootH1_100667663 295
99 3300025245 Ga0207425_1000212 Ga0207425_100021220 295
100 3300025294 Ga0209025_1002422 Ga0209025_100242222 295
101 3300025297 Ga0209758_1000278 Ga0209758_100027883 295
102 3300046452 Ga0495617_000011 Ga0495617_000011_89318_90262 295
103 3300046457 Ga0495590_0000022 Ga0495590_0000022_2801_3748 295
104 3300046457 Ga0495590_0046669 Ga0495590_0046669_140_1087 295
105 3300046460 Ga0495638_0000229 Ga0495638_0000229_16209_17156 295
106 3300046471 Ga0495650_0000633 Ga0495650_0000633_8933_9877 295
107 3300046471 Ga0495650_0005109 Ga0495650_0005109_2810_3757 295
108 3300046492 Ga0495585_0006638 Ga0495585_0006638_4695_5639 295
109 3300046506 Ga0495583_0004667 Ga0495583_0004667_4871_5818 295
110 3300046522 Ga0495643_0000318 Ga0495643_0000318_62255_63220 295
111 3300046522 Ga0495643_0003467 Ga0495643_0003467_7122_8069 295
112 3300046524 Ga0495648_0000004 Ga0495648_0000004_166974_167921 295
113 3300046524 Ga0495648_0016677 Ga0495648_0016677_2060_3004 295
114 3300046528 Ga0495642_0003930 Ga0495642_0003930_2911_3858 295
115 3300046530 Ga0495654_0006029 Ga0495654_0006029_1412_2356 295
116 3300046542 Ga0495597_0000161 Ga0495597_0000161_3596_4543 295
117 3300046557 Ga0495622_0002366 Ga0495622_0002366_5113_6060 295
118 3300046558 Ga0495633_0000068 Ga0495633_0000068_61957_62904 295
119 3300046558 Ga0495633_0026084 Ga0495633_0026084_733_1677 295
120 3300046616 Ga0495668_0004306 Ga0495668_0004306_4535_5479 295
121 3300046616 Ga0495668_0006229 Ga0495668_0006229_3743_4690 295
122 3300046660 Ga0495625_0000257 Ga0495625_0000257_3446_4393 295
123 3300046691 Ga0495670_0038892 Ga0495670_0038892_914_1861 295
124 3300046694 Ga0495649_0007156 Ga0495649_0007156_3281_4246 295
125 3300046810 Ga0495660_0021040 Ga0495660_0021040_2117_3061 295
126 3300046810 Ga0495660_0026714 Ga0495660_0026714_1411_2358 295
127 3300047320 Ga0495672_0005036 Ga0495672_0005036_3266_4231 295
128 3300047443 Ga0495687_004867 Ga0495687_004867_1278_2225 295
129 3300047443 Ga0495687_006262 Ga0495687_006262_1744_2691 295
130 3300047446 Ga0495679_025880 Ga0495679_025880_940_1884 295
131 3300047469 Ga0495673_0000166 Ga0495673_0000166_4628_5572 295
132 3300049459 Ga0495678_000937 Ga0495678_000937_17888_18853 295
133 3300049459 Ga0495678_005057 Ga0495678_005057_894_1841 295
134 3300049459 Ga0495678_007359 Ga0495678_007359_2868_3815 295
135 3300021361 Ga0213872_10013245 Ga0213872_100132454 296
136 3300046512 Ga0495610_0008857 Ga0495610_0008857_2164_3144 296
137 3300046558 Ga0495633_0008709 Ga0495633_0008709_2493_3473 296
138 3300046660 Ga0495625_0019246 Ga0495625_0019246_1198_2160 296
139 3300053145 Ga0500586_001137 Ga0500586_001137_1492_2472 296
140 3300009174 Ga0105241_10046814 Ga0105241_100468142 297
141 3300009545 Ga0105237_10016491 Ga0105237_100164918 297
142 3300009551 Ga0105238_10010400 Ga0105238_100104009 297
143 3300009551 Ga0105238_10020011 Ga0105238_100200116 297
144 3300010375 Ga0105239_10023625 Ga0105239_100236258 297
145 3300025949 Ga0207667_10028993 Ga0207667_100289933 297
146 3300037466 Ga0395898_0010659 Ga0395898_0010659_5419_6357 297
147 3300046507 Ga0495606_0034284 Ga0495606_0034284_2215_3186 297
148 3300046512 Ga0495610_0014110 Ga0495610_0014110_2694_3665 297
149 3300046463 Ga0495653_0000029 Ga0495653_0000029_92108_93070 298
150 3300046507 Ga0495606_0000699 Ga0495606_0000699_46976_47881 298
151 3300046507 Ga0495606_0000618 Ga0495606_0000618_2546_3508 299
152 3300048927 Ga0496124_0040724 Ga0496124_0040724_2557_3519 299
153 3300009036 Ga0105244_10005186 Ga0105244_100051863 301
154 3300015265 Ga0182005_1000001 Ga0182005_1000001888 301
155 3300025728 Ga0207655_1007077 Ga0207655_10070775 301
156 3300046558 Ga0495633_0010288 Ga0495633_0010288_338_1297 301
157 3300046810 Ga0495660_0000347 Ga0495660_0000347_11965_12948 301
158 3300048920 Ga0496117_0120168 Ga0496117_0120168_626_1555 301
159 3300048921 Ga0496118_0138755 Ga0496118_0138755_206_1135 301
160 iso_pu_bacteria 2738541297 2738827748 301
161 iso_pu_bacteria 2738541357 2739151544 301
162 iso_pu_bacteria 2738543003 2739193464 301
163 iso_pu_bacteria 2738543026 2739319940 301
164 iso_pu_bacteria 2738543029 2739338181 301
165 iso_pu_bacteria 2747842501 2748018852 301
166 3300006946 Ga0079104_1009258 Ga0079104_10092583 302
167 3300015261 Ga0182006_1000056 Ga0182006_1000056157 302
168 3300015265 Ga0182005_1000013 Ga0182005_1000013209 302
169 3300027111 Ga0209281_1009310 Ga0209281_10093103 302
170 3300035114 Ga0373939_0003826 Ga0373939_0003826_2516_3475 302
171 3300044765 Ga0466970_0040576 Ga0466970_0040576_697_1650 302
172 3300046674 Ga0495588_0111171 Ga0495588_0111171_219_1172 302
173 iso_pu_bacteria 2919476304 2919479748 302
174 3300006028 Ga0070717_10054555 Ga0070717_100545554 303
175 3300046528 Ga0495642_0166539 Ga0495642_0166539_15_929 303
176 3300046471 Ga0495650_0000044 Ga0495650_0000044_231554_232519 304
177 3300046507 Ga0495606_0016214 Ga0495606_0016214_2073_3038 304
178 3300046512 Ga0495610_0026645 Ga0495610_0026645_1025_1984 304
179 3300046557 Ga0495622_0000009 Ga0495622_0000009_178774_179739 304
180 3300046558 Ga0495633_0047778 Ga0495633_0047778_1017_1976 304
181 3300047472 Ga0495686_0011150 Ga0495686_0011150_4549_5508 304
182 3300047470 Ga0495681_0006688 Ga0495681_0006688_4368_5339 305
183 iso_pu_bacteria 2821131069 2821136273 305
184 3300039447 Ga0436361_0008254 Ga0436361_0008254_107_1036 306
185 3300039447 Ga0436361_0075349 Ga0436361_0075349_392_1321 306
186 3300046507 Ga0495606_0000396 Ga0495606_0000396_72503_73423 306
187 3300046520 Ga0495637_0001897 Ga0495637_0001897_3489_4409 306
188 3300046694 Ga0495649_0040174 Ga0495649_0040174_47_967 306
189 3300047469 Ga0495673_0000059 Ga0495673_0000059_38960_39880 306
190 3300050489 nmdc:mga03683_69752_c1 nmdc:mga03683_69752_c1_424_1344 306
191 iso_pu_bacteria 2842711865 2842713167 306
192 iso_pu_bacteria 2857564685 2857569373 306
193 iso_pu_bacteria 2643221554 2643792160 308
194 3300003763 Ga0055529_1000027 Ga0055529_1000027204 309
195 3300025272 Ga0209455_1000033 Ga0209455_1000033242 309
196 3300046530 Ga0495654_0015222 Ga0495654_0015222_1027_1959 309
197 3300013102 Ga0157371_10000128 Ga0157371_1000012816 310
198 3300021361 Ga0213872_10000808 Ga0213872_1000080811 310
199 3300039447 Ga0436361_0013548 Ga0436361_0013548_1461_2516 310
200 3300046471 Ga0495650_0000481 Ga0495650_0000481_55384_56343 310
201 3300046501 Ga0495607_0036840 Ga0495607_0036840_1530_2489 310
202 3300046558 Ga0495633_0005641 Ga0495633_0005641_6353_7312 310
203 3300046616 Ga0495668_0003650 Ga0495668_0003650_463_1422 310
204 3300046664 Ga0495659_0018898 Ga0495659_0018898_441_1403 310
205 3300047446 Ga0495679_051084 Ga0495679_051084_115_1080 310
206 3300046474 Ga0495605_0000041 Ga0495605_0000041_187543_188517 311
207 3300047443 Ga0495687_014441 Ga0495687_014441_1249_2208 312
208 3300047472 Ga0495686_0001028 Ga0495686_0001028_19627_20685 312
209 iso_pu_bacteria 2643221638 2644212344 312
210 iso_pu_bacteria 2643221645 2644251492 312
211 iso_pu_bacteria 2643221664 2644357362 312
212 iso_pu_bacteria 2738541280 2738739970 312
213 iso_pu_bacteria 2738541300 2738844277 312
214 iso_pu_bacteria 2738543018 2739274163 312
215 iso_pu_bacteria 2738543030 2739343207 312
216 iso_pu_bacteria 2904479285 2904483231 313
217 3300039447 Ga0436361_0168778 Ga0436361_0168778_32233_33180 314
218 3300046528 Ga0495642_0015282 Ga0495642_0015282_544_1488 314
219 iso_pu_bacteria 2738541297 2738828574 315
220 iso_pu_bacteria 2738541357 2739152370 315
221 iso_pu_bacteria 2738543003 2739194290 315
222 iso_pu_bacteria 2738543026 2739320766 315
223 iso_pu_bacteria 2738543029 2739339007 315
224 iso_pu_bacteria 2821131069 2821132816 315
225 iso_pu_bacteria 2842711865 2842717543 315
226 iso_pu_bacteria 2857553236 2857555801 315
227 iso_pu_bacteria 2857558681 2857561961 315
228 iso_pu_bacteria 2857564685 2857568731 315
229 iso_pu_bacteria 2904424332 2904427014 315
230 3300002739 JGI25158J39367_1003933 JGI25158J39367_10039331 316
231 3300002773 JGI25152J39213_1000005 JGI25152J39213_100000597 316
232 3300002774 JGI25150J39212_1000655 JGI25150J39212_100065511 316
233 3300002987 JGI25159J45721_1000430 JGI25159J45721_100043025 316
234 3300002987 JGI25159J45721_1004626 JGI25159J45721_10046264 316
235 3300003323 rootH1_10259216 rootH1_102592162 316
236 3300003374 JGI25161J50226_1000182 JGI25161J50226_100018225 316
237 3300003771 Ga0055526_1000780 Ga0055526_100078017 316
238 3300003771 Ga0055526_1001035 Ga0055526_100103519 316
239 3300003771 Ga0055526_1002186 Ga0055526_100218612 316
240 3300003773 Ga0055537_1000039 Ga0055537_100003930 316
241 3300003773 Ga0055537_1004607 Ga0055537_10046072 316
242 3300003773 Ga0055537_1011705 Ga0055537_10117052 316
243 3300003775 Ga0055524_1000008 Ga0055524_1000008280 316
244 3300003775 Ga0055524_1000187 Ga0055524_100018718 316
245 3300003775 Ga0055524_1000526 Ga0055524_100052616 316
246 3300003775 Ga0055524_1015113 Ga0055524_10151134 316
247 3300003784 Ga0055534_1001322 Ga0055534_10013226 316
248 3300003790 Ga0055528_1000066 Ga0055528_100006632 316
249 3300003791 Ga0055530_10000946 Ga0055530_100009464 316
250 3300003794 Ga0055531_10009354 Ga0055531_100093544 316
251 3300004625 Ga0055543_1000112 Ga0055543_100011258 316
252 3300005262 Ga0065165_1000005 Ga0065165_1000005240 316
253 3300005262 Ga0065165_1001050 Ga0065165_100105026 316
254 3300005262 Ga0065165_1017597 Ga0065165_10175971 316
255 3300006948 Ga0099826_10000001 Ga0099826_10000001322 316
256 3300025208 Ga0209436_101261 Ga0209436_1012616 316
257 3300025208 Ga0209436_109663 Ga0209436_1096632 316
258 3300025245 Ga0207425_1000001 Ga0207425_1000001219 316
259 3300025245 Ga0207425_1000056 Ga0207425_10000564 316
260 3300025258 Ga0209129_1000003 Ga0209129_1000003219 316
261 3300025263 Ga0209565_1000003 Ga0209565_1000003334 316
262 3300025263 Ga0209565_1009822 Ga0209565_10098222 316
263 3300025263 Ga0209565_1010793 Ga0209565_10107932 316
264 3300025263 Ga0209565_1011574 Ga0209565_10115742 316
265 3300025273 Ga0209673_1000003 Ga0209673_1000003220 316
266 3300025273 Ga0209673_1014416 Ga0209673_10144162 316
267 3300025284 Ga0209130_1000084 Ga0209130_100008432 316
268 3300025284 Ga0209130_1000237 Ga0209130_100023725 316
269 3300025284 Ga0209130_1004253 Ga0209130_10042536 316
270 3300025284 Ga0209130_1019927 Ga0209130_10199272 316
271 3300025291 Ga0209675_1000003 Ga0209675_1000003704 316
272 3300025291 Ga0209675_1004244 Ga0209675_10042446 316
273 3300025291 Ga0209675_1023142 Ga0209675_10231421 316
274 3300025295 Ga0209564_1000012 Ga0209564_1000012512 316
275 3300025295 Ga0209564_1000311 Ga0209564_100031127 316
276 3300025295 Ga0209564_1021378 Ga0209564_10213783 316
277 3300025297 Ga0209758_1000041 Ga0209758_1000041167 316
278 3300025298 Ga0209050_1000011 Ga0209050_1000011201 316
279 3300025298 Ga0209050_1000164 Ga0209050_100016453 316
280 3300025298 Ga0209050_1000280 Ga0209050_100028043 316
281 3300025298 Ga0209050_1000664 Ga0209050_100066448 316
282 3300025299 Ga0209256_1000005 Ga0209256_10000051226 316
283 3300025299 Ga0209256_1000068 Ga0209256_100006896 316
284 3300025299 Ga0209256_1000395 Ga0209256_100039521 316
285 3300025299 Ga0209256_1000660 Ga0209256_100066018 316
286 3300025299 Ga0209256_1000702 Ga0209256_100070234 316
287 3300025302 Ga0207426_1005069 Ga0207426_10050692 316
288 3300025304 Ga0209257_1000003 Ga0209257_1000003973 316
289 3300025304 Ga0209257_1005947 Ga0209257_10059474 316
290 3300027666 Ga0209282_1000001 Ga0209282_10000011460 316
291 3300030736 Ga0316180_1013000 Ga0316180_10130001 316
292 3300030745 Ga0316182_1076537 Ga0316182_10765371 316
293 3300031548 Ga0307408_100000490 Ga0307408_1000004905 316
294 3300031548 Ga0307408_100001138 Ga0307408_1000011388 316
295 3300031548 Ga0307408_100023608 Ga0307408_1000236082 316
296 3300031548 Ga0307408_100023969 Ga0307408_1000239693 316
297 3300032002 Ga0307416_100183567 Ga0307416_1001835672 316
298 3300044683 Ga0466965_0013547 Ga0466965_0013547_2247_3200 316
299 3300046457 Ga0495590_0004835 Ga0495590_0004835_2116_3069 316
300 3300046460 Ga0495638_0049579 Ga0495638_0049579_1366_2319 316
301 3300046460 Ga0495638_0054324 Ga0495638_0054324_1505_2458 316
302 3300046474 Ga0495605_0040584 Ga0495605_0040584_674_1627 316
303 3300046491 Ga0495584_0000995 Ga0495584_0000995_8378_9331 316
304 3300046491 Ga0495584_0012900 Ga0495584_0012900_3251_4204 316
305 3300046491 Ga0495584_0032037 Ga0495584_0032037_490_1443 316
306 3300046492 Ga0495585_0018226 Ga0495585_0018226_2054_3007 316
307 3300046506 Ga0495583_0000021 Ga0495583_0000021_132755_133708 316
308 3300046506 Ga0495583_0038059 Ga0495583_0038059_867_1820 316
309 3300046513 Ga0495616_0004525 Ga0495616_0004525_2505_3458 316
310 3300046522 Ga0495643_0053206 Ga0495643_0053206_1041_1994 316
311 3300046523 Ga0495644_0002052 Ga0495644_0002052_4488_5441 316
312 3300046524 Ga0495648_0000223 Ga0495648_0000223_16799_17752 316
313 3300046538 Ga0495609_0004354 Ga0495609_0004354_4621_5574 316
314 3300046538 Ga0495609_0006453 Ga0495609_0006453_3016_3969 316
315 3300046538 Ga0495609_0036185 Ga0495609_0036185_659_1612 316
316 3300046542 Ga0495597_0024593 Ga0495597_0024593_1361_2314 316
317 3300046542 Ga0495597_0052077 Ga0495597_0052077_95_1048 316
318 3300046558 Ga0495633_0012710 Ga0495633_0012710_2511_3464 316
319 3300046615 Ga0495656_0026312 Ga0495656_0026312_490_1443 316
320 3300046616 Ga0495668_0000006 Ga0495668_0000006_245825_246778 316
321 3300046648 Ga0495611_0005186 Ga0495611_0005186_1614_2567 316
322 3300046648 Ga0495611_0005326 Ga0495611_0005326_3031_3984 316
323 3300046660 Ga0495625_0003737 Ga0495625_0003737_5021_5974 316
324 3300046660 Ga0495625_0006585 Ga0495625_0006585_7465_8418 316
325 3300046664 Ga0495659_0000001 Ga0495659_0000001_254769_255722 316
326 3300046664 Ga0495659_0000161 Ga0495659_0000161_21666_22619 316
327 3300046664 Ga0495659_0001691 Ga0495659_0001691_368_1321 316
328 3300046692 Ga0495671_0000035 Ga0495671_0000035_111734_112687 316
329 3300046692 Ga0495671_0015913 Ga0495671_0015913_473_1426 316
330 3300046694 Ga0495649_0032300 Ga0495649_0032300_1454_2407 316
331 3300046694 Ga0495649_0057400 Ga0495649_0057400_805_1776 316
332 3300046810 Ga0495660_0000543 Ga0495660_0000543_18884_19837 316
333 3300047318 Ga0495636_0000594 Ga0495636_0000594_4989_5942 316
334 3300047318 Ga0495636_0106076 Ga0495636_0106076_146_1099 316
335 3300047320 Ga0495672_0000066 Ga0495672_0000066_56080_57033 316
336 3300047320 Ga0495672_0008167 Ga0495672_0008167_3810_4763 316
337 3300047443 Ga0495687_002084 Ga0495687_002084_15835_16788 316
338 3300047447 Ga0495685_000099 Ga0495685_000099_5845_6798 316
339 3300047447 Ga0495685_011546 Ga0495685_011546_1717_2670 316
340 3300047469 Ga0495673_0009172 Ga0495673_0009172_1399_2352 316
341 3300047470 Ga0495681_0015108 Ga0495681_0015108_1165_2118 316
342 3300047472 Ga0495686_0000874 Ga0495686_0000874_929_1882 316
343 3300047472 Ga0495686_0008269 Ga0495686_0008269_2738_3691 316
344 3300048905 Ga0496102_0000254 Ga0496102_0000254_3751_4704 316
345 3300048927 Ga0496124_0102882 Ga0496124_0102882_520_1503 316
346 3300049459 Ga0495678_001787 Ga0495678_001787_13122_14075 316
347 3300049459 Ga0495678_095332 Ga0495678_095332_33_986 316
348 3300049460 Ga0495682_0000302 Ga0495682_0000302_28297_29250 316
349 3300049662 Ga0501222_004290 Ga0501222_004290_935_1888 316
350 3300049665 Ga0501227_005408 Ga0501227_005408_1759_2712 316
351 3300049671 Ga0501238_003067 Ga0501238_003067_953_2008 316
352 3300049775 Ga0501279_001712 Ga0501279_001712_1909_2862 316
353 3300049775 Ga0501279_002266 Ga0501279_002266_956_1909 316
354 3300046525 Ga0495663_0036804 Ga0495663_0036804_289_1245 317
355 3300002738 JGI25154J39366_1001144 JGI25154J39366_10011447 319
356 3300003322 rootL2_10025948 rootL2_100259484 319
357 3300003763 Ga0055529_1000068 Ga0055529_100006876 319
358 3300003771 Ga0055526_1000013 Ga0055526_100001362 319
359 3300006048 Ga0075363_100022116 Ga0075363_1000221164 319
360 3300006177 Ga0075362_10027518 Ga0075362_100275183 319
361 3300006946 Ga0079104_1009130 Ga0079104_10091303 319
362 3300009036 Ga0105244_10007005 Ga0105244_100070055 319
363 3300015261 Ga0182006_1000040 Ga0182006_1000040106 319
364 3300015262 Ga0182007_10009521 Ga0182007_100095214 319
365 3300015265 Ga0182005_1000066 Ga0182005_100006610 319
366 3300021361 Ga0213872_10000032 Ga0213872_1000003277 319
367 3300021361 Ga0213872_10001264 Ga0213872_100012642 319
368 3300021361 Ga0213872_10023549 Ga0213872_100235494 319
369 3300025246 Ga0209646_1000007 Ga0209646_1000007266 319
370 3300025272 Ga0209455_1000026 Ga0209455_1000026436 319
371 3300025295 Ga0209564_1000002 Ga0209564_1000002947 319
372 3300025728 Ga0207655_1038590 Ga0207655_10385902 319
373 3300030744 Ga0316181_1055314 Ga0316181_10553143 319
374 3300039447 Ga0436361_0118687 Ga0436361_0118687_143_1114 319
375 3300039447 Ga0436361_0513300 Ga0436361_0513300_1839_2807 319
376 3300046452 Ga0495617_000042 Ga0495617_000042_31183_32142 319
377 3300046453 Ga0495627_000001 Ga0495627_000001_994969_995940 319
378 3300046457 Ga0495590_0000010 Ga0495590_0000010_267586_268545 319
379 3300046460 Ga0495638_0000027 Ga0495638_0000027_256459_257418 319
380 3300046460 Ga0495638_0007698 Ga0495638_0007698_5855_6814 319
381 3300046460 Ga0495638_0071034 Ga0495638_0071034_110_1069 319
382 3300046460 Ga0495638_0083423 Ga0495638_0083423_312_1271 319
383 3300046471 Ga0495650_0001268 Ga0495650_0001268_16913_17872 319
384 3300046471 Ga0495650_0005921 Ga0495650_0005921_2834_3793 319
385 3300046471 Ga0495650_0010852 Ga0495650_0010852_2475_3434 319
386 3300046475 Ga0495639_0014218 Ga0495639_0014218_855_1814 319
387 3300046492 Ga0495585_0001481 Ga0495585_0001481_2998_3957 319
388 3300046501 Ga0495607_0000845 Ga0495607_0000845_17569_18528 319
389 3300046506 Ga0495583_0000006 Ga0495583_0000006_294077_295036 319
390 3300046507 Ga0495606_0000147 Ga0495606_0000147_100865_101824 319
391 3300046507 Ga0495606_0000557 Ga0495606_0000557_28963_29922 319
392 3300046520 Ga0495637_0000067 Ga0495637_0000067_36256_37215 319
393 3300046522 Ga0495643_0000065 Ga0495643_0000065_42768_43727 319
394 3300046524 Ga0495648_0000078 Ga0495648_0000078_71724_72683 319
395 3300046528 Ga0495642_0001002 Ga0495642_0001002_2457_3416 319
396 3300046530 Ga0495654_0000002 Ga0495654_0000002_727244_728203 319
397 3300046530 Ga0495654_0002388 Ga0495654_0002388_5145_6104 319
398 3300046538 Ga0495609_0007864 Ga0495609_0007864_3326_4297 319
399 3300046538 Ga0495609_0066204 Ga0495609_0066204_134_1093 319
400 3300046542 Ga0495597_0000035 Ga0495597_0000035_1398_2357 319
401 3300046557 Ga0495622_0000043 Ga0495622_0000043_79290_80249 319
402 3300046558 Ga0495633_0000381 Ga0495633_0000381_7833_8792 319
403 3300046558 Ga0495633_0138527 Ga0495633_0138527_136_1101 319
404 3300046616 Ga0495668_0000096 Ga0495668_0000096_41800_42759 319
405 3300046616 Ga0495668_0001010 Ga0495668_0001010_27401_28360 319
406 3300046660 Ga0495625_0000053 Ga0495625_0000053_37935_38894 319
407 3300046660 Ga0495625_0003391 Ga0495625_0003391_8956_9915 319
408 3300046665 Ga0495661_0005218 Ga0495661_0005218_4754_5713 319
409 3300046692 Ga0495671_0036659 Ga0495671_0036659_545_1504 319
410 3300046694 Ga0495649_0063737 Ga0495649_0063737_112_1071 319
411 3300046810 Ga0495660_0002087 Ga0495660_0002087_3194_4153 319
412 3300046810 Ga0495660_0004396 Ga0495660_0004396_6443_7414 319
413 3300046810 Ga0495660_0004699 Ga0495660_0004699_2338_3297 319
414 3300047443 Ga0495687_000910 Ga0495687_000910_27847_28806 319
415 3300047445 Ga0495677_0024885 Ga0495677_0024885_657_1616 319
416 3300047446 Ga0495679_012137 Ga0495679_012137_854_1813 319
417 3300047469 Ga0495673_0000064 Ga0495673_0000064_169485_170444 319
418 3300047472 Ga0495686_0028400 Ga0495686_0028400_1053_2012 319
419 3300048906 Ga0496103_0005857 Ga0496103_0005857_4387_5346 319
420 3300048927 Ga0496124_0136625 Ga0496124_0136625_691_1650 319
421 3300049459 Ga0495678_000002 Ga0495678_000002_828420_829391 319
422 3300049459 Ga0495678_026950 Ga0495678_026950_667_1626 319
423 3300049459 Ga0495678_031237 Ga0495678_031237_436_1404 319
424 3300049679 Ga0501249_003795 Ga0501249_003795_1188_2147 319
425 3300049766 Ga0501269_000250 Ga0501269_000250_8597_9556 319
426 3300050490 nmdc:mga03n38_50533_c1 nmdc:mga03n38_50533_c1_741_1700 319
427 3300053125 Ga0500618_008414 Ga0500618_008414_1251_2210 319
428 iso_pu_bacteria 2919476304 2919478173 319

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00892

EamA

EamA-like transporter family

36

172

0.9

PF00892

EamA

EamA-like transporter family

189

340

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
5i20-assembly2.cif.gz_B crystal structure of protein 0.8465 4 309
5i20-assembly2.cif.gz_B crystal structure of protein 0.83 4 309
5i20-assembly1.cif.gz_A crystal structure of protein 0.828 4 312
5i20-assembly5.cif.gz_E crystal structure of protein 0.8248 4 308
5i20-assembly3.cif.gz_C crystal structure of protein 0.8181 4 308
ID Description Score Start End Superfamily
af_Q8RY83_36_351_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.6696 2 313 1.20.1740.10
af_Q8RY83_36_351_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.6609 2 313 1.20.1740.10
af_Q20583_6_327_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.6345 3 310 1.20.1740.10
af_A0A0P0YAS8_28_439_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.6153 4 306 1.20.1740.10
af_Q20583_6_327_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.6146 3 310 1.20.1740.10
ID Description Score Start End GO Terms
AF-A0A1W6LF69-F1-model_v4 Multidrug DMT transporter permease 0.9729 1 312 GO:0016020
AF-A0A2R4CA81-F1-model_v4 EamA family transporter 0.9654 1 309 GO:0016020
AF-A0A1W6LF69-F1-model_v4 Multidrug DMT transporter permease 0.9606 1 312 GO:0016020
AF-A0A0K1XCC8-F1-model_v4 Multidrug DMT transporter permease 0.9599 1 308 GO:0016020
AF-V2IC44-F1-model_v4 Multidrug DMT transporter permease 0.9561 1 314 GO:0016020

Feature Viewer

pLDDT pTM Quality
86.73 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map