F441724

General Info

Members Datasets Scaffolds Average Seq Length
428 241 428 147

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0003695|Ga0451577_0003695_462_941
Length 159
Sequence MRIAIASDHGGFPLKEELVPFIRSLGHEVADLGVHSLEPADYPDAAERVGIAIRTGEAERGIVLCGSGVGAVMAANRMEGIRAGVGHDTYSARQGVEHDAMNVLSLGARVIGGELAREVVAAFLKAKFIPEERYRRRLGKMEDLARRYGPGTWEGRPKA

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
91 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
138 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
139 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
140 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
141 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
142 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
143 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
144 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
145 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
146 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
147 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
148 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
149 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
150 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
151 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
152 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
153 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
154 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
155 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
156 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
157 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
158 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
159 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
160 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
161 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
162 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
163 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
164 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
165 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
166 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
167 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
168 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
169 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
170 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
171 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
172 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
173 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
174 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
175 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
176 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
177 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
178 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
179 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
180 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
181 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
182 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
183 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
184 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
185 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
186 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
187 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
188 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
189 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
190 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
191 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
192 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
193 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
194 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
195 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
196 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
197 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
198 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
199 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
200 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
201 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
202 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
203 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
204 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
205 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
206 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
207 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
208 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
209 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
222 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
223 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
224 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
225 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
226 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
227 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
228 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
231 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
232 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
233 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
234 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
235 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
236 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
237 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
238 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
239 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
240 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
241 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.23
Nodule 0
Rhizoplane 2.34
Rhizosphere 96.5
Stem 0
Stem Tuber 0
Unclassified 0.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10338273 3300005290 Bacteria 804
2 Ga0070683_100007770 3300005329 Bacteria 9081
3 Ga0070683_100012899 3300005329 Bacteria 7273
4 Ga0070683_100033107 3300005329 Bacteria 4711
5 Ga0070683_100051195 3300005329 Bacteria 3823
6 Ga0070683_100233387 3300005329 Bacteria 1749
7 Ga0070683_100364391 3300005329 Unclassified 1376
8 Ga0070670_100032776 3300005331 Bacteria 4476
9 Ga0070677_10241753 3300005333 Bacteria 891
10 Ga0068869_100012137 3300005334 Bacteria 5682
11 Ga0068869_100054131 3300005334 Bacteria 2920
12 Ga0070666_10081837 3300005335 Bacteria 2208
13 Ga0070680_100252745 3300005336 Bacteria 1490
14 Ga0070682_100029554 3300005337 Bacteria 3301
15 Ga0070682_100886011 3300005337 Unclassified 732
16 Ga0070660_100706746 3300005339 Bacteria 845
17 Ga0070689_100022486 3300005340 Bacteria 4707
18 Ga0070689_100026029 3300005340 Unclassified 4400
19 Ga0070689_100157992 3300005340 Bacteria 1831
20 Ga0070689_100510295 3300005340 Bacteria 1031
21 Ga0070687_100036024 3300005343 Bacteria 2462
22 Ga0070687_100388471 3300005343 Bacteria 912
23 Ga0070661_100000908 3300005344 Bacteria 21240
24 Ga0070668_100511211 3300005347 Bacteria 1041
25 Ga0070668_102086152 3300005347 Bacteria 523
26 Ga0070675_100018624 3300005354 Bacteria 5527
27 Ga0070675_100038900 3300005354 Bacteria 3879
28 Ga0070675_100231561 3300005354 Bacteria 1612
29 Ga0070671_101017662 3300005355 Bacteria 726
30 Ga0070674_100809197 3300005356 Bacteria 810
31 Ga0070673_100019013 3300005364 Bacteria 4927
32 Ga0070688_100164515 3300005365 Bacteria 1526
33 Ga0070659_100015345 3300005366 Bacteria 5737
34 Ga0070667_100061272 3300005367 Unclassified 3185
35 Ga0070703_10028615 3300005406 Unclassified 1667
36 Ga0070709_10031182 3300005434 Unclassified 3206
37 Ga0070709_10132010 3300005434 Bacteria 1706
38 Ga0070713_100080495 3300005436 Bacteria 2778
39 Ga0070713_100096427 3300005436 Bacteria 2553
40 Ga0070711_100516898 3300005439 Bacteria 986
41 Ga0070711_100931450 3300005439 Unclassified 743
42 Ga0070705_100135786 3300005440 Bacteria 1611
43 Ga0070708_100000061 3300005445 Bacteria 70319
44 Ga0070678_100440056 3300005456 Bacteria 1140
45 Ga0070662_100005041 3300005457 Bacteria 8404
46 Ga0070681_10035410 3300005458 Bacteria 5015
47 Ga0068867_100264845 3300005459 Bacteria 1403
48 Ga0068867_100494028 3300005459 Unclassified 1051
49 Ga0070685_10155532 3300005466 Bacteria 1453
50 Ga0070707_100205412 3300005468 Bacteria 1920
51 Ga0070679_100042758 3300005530 Unclassified 4513
52 Ga0070684_100001555 3300005535 Bacteria 16576
53 Ga0070684_100020409 3300005535 Bacteria 5498
54 Ga0070684_100070160 3300005535 Bacteria 3083
55 Ga0070684_100120472 3300005535 Bacteria 2360
56 Ga0070684_100301621 3300005535 Bacteria 1470
57 Ga0070684_100670076 3300005535 Bacteria 966
58 Ga0070672_100077117 3300005543 Unclassified 2664
59 Ga0070672_100254209 3300005543 Bacteria 1480
60 Ga0070686_100050122 3300005544 Bacteria 2652
61 Ga0070693_100002100 3300005547 Bacteria 9116
62 Ga0070665_100134827 3300005548 Unclassified 2471
63 Ga0070704_101804027 3300005549 Unclassified 566
64 Ga0068855_100266319 3300005563 Bacteria 1907
65 Ga0070664_100088209 3300005564 Bacteria 2682
66 Ga0070664_100239146 3300005564 Bacteria 1630
67 Ga0068857_100006549 3300005577 Bacteria 9993
68 Ga0068857_100040832 3300005577 Bacteria 4113
69 Ga0068857_100855972 3300005577 Bacteria 870
70 Ga0068856_100010283 3300005614 Bacteria 9095
71 Ga0068856_100075534 3300005614 Bacteria 3338
72 Ga0068856_100108156 3300005614 Unclassified 2777
73 Ga0070702_100010499 3300005615 Bacteria 4563
74 Ga0070702_100527874 3300005615 Bacteria 872
75 Ga0068852_100206856 3300005616 Bacteria 1860
76 Ga0068852_100791267 3300005616 Bacteria 962
77 Ga0068852_101213595 3300005616 Bacteria 775
78 Ga0068859_100033059 3300005617 Bacteria 5195
79 Ga0068859_100055779 3300005617 Unclassified 3975
80 Ga0068859_100171770 3300005617 Bacteria 2249
81 Ga0068864_100036389 3300005618 Bacteria 4196
82 Ga0068864_101535911 3300005618 Bacteria 669
83 Ga0068861_100257101 3300005719 Bacteria 1493
84 Ga0068851_10078502 3300005834 Bacteria 1720
85 Ga0068870_10033794 3300005840 Bacteria 2613
86 Ga0068870_10143954 3300005840 Bacteria 1397
87 Ga0068863_100003189 3300005841 Bacteria 16220
88 Ga0068858_100170219 3300005842 Bacteria 2054
89 Ga0068860_100039853 3300005843 Bacteria 4492
90 Ga0068862_100387456 3300005844 Bacteria 1305
91 Ga0068862_100766041 3300005844 Bacteria 940
92 Ga0070717_10454146 3300006028 Bacteria 1155
93 Ga0070717_10676278 3300006028 Bacteria 937
94 Ga0070716_100009509 3300006173 Bacteria 4846
95 Ga0070712_100062894 3300006175 Bacteria 2626
96 Ga0070712_100070202 3300006175 Bacteria 2502
97 Ga0097621_100117312 3300006237 Bacteria 2255
98 Ga0097621_100520504 3300006237 Bacteria 1080
99 Ga0068871_100012100 3300006358 Bacteria 6351
100 Ga0068871_100301519 3300006358 Bacteria 1406
101 Ga0068871_100611023 3300006358 Bacteria 992
102 Ga0075434_100261140 3300006871 Bacteria 1751
103 Ga0075434_100350547 3300006871 Bacteria 1497
104 Ga0075434_101943114 3300006871 Bacteria 594
105 Ga0075429_101673683 3300006880 Bacteria 553
106 Ga0068865_100338514 3300006881 Bacteria 1215
107 Ga0075436_100901150 3300006914 Bacteria 661
108 Ga0075436_101107526 3300006914 Unclassified 596
109 Ga0097620_100033057 3300006931 Bacteria 5195
110 Ga0097620_100055781 3300006931 Unclassified 3975
111 Ga0097620_100171782 3300006931 Bacteria 2249
112 Ga0105240_10353794 3300009093 Bacteria 1666
113 Ga0111539_10215385 3300009094 Bacteria 2237
114 Ga0105245_10007125 3300009098 Bacteria 9809
115 Ga0105245_10041100 3300009098 Bacteria 4122
116 Ga0105245_10465694 3300009098 Bacteria 1275
117 Ga0105247_10124211 3300009101 Bacteria 1676
118 Ga0105247_10755898 3300009101 Bacteria 737
119 Ga0114129_10043421 3300009147 Bacteria 6325
120 Ga0105241_10009522 3300009174 Bacteria 7137
121 Ga0105241_10472144 3300009174 Bacteria 1113
122 Ga0105242_10019444 3300009176 Bacteria 5322
123 Ga0105242_10021520 3300009176 Bacteria 5065
124 Ga0105242_10141898 3300009176 Bacteria 2085
125 Ga0105242_10205311 3300009176 Bacteria 1752
126 Ga0105242_10712377 3300009176 Bacteria 983
127 Ga0105248_10035778 3300009177 Bacteria 5555
128 Ga0105248_10110616 3300009177 Bacteria 3098
129 Ga0105248_10112257 3300009177 Bacteria 3074
130 Ga0105238_10076991 3300009551 Bacteria 3328
131 Ga0105249_10212816 3300009553 Unclassified 1898
132 Ga0105249_12265564 3300009553 Bacteria 616
133 Ga0105239_10030938 3300010375 Bacteria 5888
134 Ga0105239_10143341 3300010375 Unclassified 2663
135 Ga0105239_10291572 3300010375 Bacteria 1837
136 Ga0105246_10021775 3300011119 Bacteria 4129
137 Ga0157373_10014733 3300013100 Bacteria 5728
138 Ga0157371_10013930 3300013102 Bacteria 6090
139 Ga0157371_11422187 3300013102 Unclassified 539
140 Ga0157369_10120100 3300013105 Bacteria 2789
141 Ga0157369_10363499 3300013105 Bacteria 1502
142 Ga0157369_10406336 3300013105 Unclassified 1412
143 Ga0157369_11207683 3300013105 Bacteria 772
144 Ga0157374_10327270 3300013296 Bacteria 1520
145 Ga0157378_10102928 3300013297 Unclassified 2608
146 Ga0157378_10355162 3300013297 Bacteria 1433
147 Ga0163162_10086080 3300013306 Unclassified 3220
148 Ga0163162_11726925 3300013306 Bacteria 715
149 Ga0163162_12315357 3300013306 Bacteria 617
150 Ga0157372_10008852 3300013307 Bacteria 10693
151 Ga0157372_10022936 3300013307 Bacteria 6761
152 Ga0157372_10036414 3300013307 Bacteria 5424
153 Ga0157372_10111878 3300013307 Unclassified 3128
154 Ga0157372_10473697 3300013307 Bacteria 1460
155 Ga0157372_11069800 3300013307 Bacteria 933
156 Ga0157375_10028883 3300013308 Bacteria 5207
157 Ga0157375_10064468 3300013308 Unclassified 3648
158 Ga0157375_10090144 3300013308 Bacteria 3124
159 Ga0157375_11793438 3300013308 Bacteria 727
160 Ga0163163_10023826 3300014325 Bacteria 5817
161 Ga0163163_10817737 3300014325 Bacteria 995
162 Ga0157377_10001649 3300014745 Bacteria 9740
163 Ga0157377_10947610 3300014745 Unclassified 647
164 Ga0157379_10564178 3300014968 Bacteria 1060
165 Ga0157379_10904191 3300014968 Bacteria 837
166 Ga0157379_11119050 3300014968 Bacteria 755
167 Ga0157376_10018230 3300014969 Bacteria 5376
168 Ga0157376_10193520 3300014969 Bacteria 1866
169 Ga0163161_10734036 3300017792 Bacteria 825
170 Ga0163161_11760257 3300017792 Unclassified 550
171 Ga0213876_10222518 3300021384 Unclassified 1003
172 Ga0207656_10133430 3300025321 Bacteria 1165
173 Ga0207699_10007313 3300025906 Bacteria 5395
174 Ga0207645_10151822 3300025907 Bacteria 1512
175 Ga0207643_10053054 3300025908 Bacteria 2303
176 Ga0207705_10670196 3300025909 Unclassified 807
177 Ga0207654_10021240 3300025911 Bacteria 3450
178 Ga0207654_10202659 3300025911 Unclassified 1307
179 Ga0207707_10011758 3300025912 Bacteria 7615
180 Ga0207695_10755923 3300025913 Unclassified 852
181 Ga0207693_10061792 3300025915 Bacteria 2934
182 Ga0207663_10165078 3300025916 Bacteria 1567
183 Ga0207660_10100447 3300025917 Bacteria 2160
184 Ga0207662_10089392 3300025918 Bacteria 1892
185 Ga0207662_10412613 3300025918 Bacteria 918
186 Ga0207649_10102585 3300025920 Bacteria 1896
187 Ga0207652_10159333 3300025921 Unclassified 2023
188 Ga0207652_10312962 3300025921 Bacteria 1417
189 Ga0207681_10655438 3300025923 Bacteria 871
190 Ga0207694_10876841 3300025924 Bacteria 759
191 Ga0207650_10016169 3300025925 Bacteria 5210
192 Ga0207659_10132434 3300025926 Bacteria 1926
193 Ga0207659_10188063 3300025926 Bacteria 1641
194 Ga0207687_10011304 3300025927 Bacteria 5835
195 Ga0207687_10014423 3300025927 Bacteria 5171
196 Ga0207700_10046788 3300025928 Bacteria 3202
197 Ga0207690_10024302 3300025932 Bacteria 3794
198 Ga0207706_10010916 3300025933 Bacteria 8284
199 Ga0207686_10043844 3300025934 Bacteria 2743
200 Ga0207670_10027704 3300025936 Unclassified 3587
201 Ga0207670_10298188 3300025936 Bacteria 1261
202 Ga0207665_10043525 3300025939 Bacteria 3002
203 Ga0207691_10068176 3300025940 Unclassified 3215
204 Ga0207691_10161978 3300025940 Bacteria 1962
205 Ga0207691_10235296 3300025940 Bacteria 1585
206 Ga0207711_10027934 3300025941 Bacteria 4743
207 Ga0207689_10000803 3300025942 Bacteria 30268
208 Ga0207661_10001475 3300025944 Bacteria 15915
209 Ga0207661_10006522 3300025944 Bacteria 8251
210 Ga0207661_10031864 3300025944 Bacteria 4078
211 Ga0207661_10173929 3300025944 Bacteria 1876
212 Ga0207679_10017092 3300025945 Bacteria 4828
213 Ga0207651_10044334 3300025960 Bacteria 2976
214 Ga0207712_10042452 3300025961 Unclassified 3131
215 Ga0207668_11559198 3300025972 Bacteria 596
216 Ga0207640_11705835 3300025981 Unclassified 569
217 Ga0207658_10057493 3300025986 Bacteria 2891
218 Ga0207658_10122700 3300025986 Unclassified 2074
219 Ga0207677_10048969 3300026023 Bacteria 2848
220 Ga0207703_10121051 3300026035 Bacteria 2247
221 Ga0207703_10234408 3300026035 Bacteria 1647
222 Ga0207702_10004994 3300026078 Bacteria 11655
223 Ga0207702_10065423 3300026078 Bacteria 3114
224 Ga0207702_10080976 3300026078 Unclassified 2819
225 Ga0207702_10744890 3300026078 Unclassified 967
226 Ga0207641_10083431 3300026088 Bacteria 2779
227 Ga0207641_10739221 3300026088 Bacteria 971
228 Ga0207676_10003020 3300026095 Bacteria 12002
229 Ga0207676_10362480 3300026095 Bacteria 1344
230 Ga0207676_11419009 3300026095 Bacteria 690
231 Ga0207676_11659366 3300026095 Bacteria 637
232 Ga0207674_10004371 3300026116 Bacteria 17042
233 Ga0207674_10154867 3300026116 Bacteria 2247
234 Ga0207674_10195292 3300026116 Bacteria 1973
235 Ga0207675_100271672 3300026118 Bacteria 1645
236 Ga0207698_10068493 3300026142 Bacteria 2803
237 Ga0207698_11061041 3300026142 Bacteria 822
238 Ga0268266_10331172 3300028379 Unclassified 1427
239 Ga0268265_10021045 3300028380 Unclassified 4563
240 Ga0268265_10750822 3300028380 Bacteria 947
241 Ga0268264_10854921 3300028381 Bacteria 911
242 Ga0268264_10876464 3300028381 Bacteria 900
243 Ga0373934_0006808 3300035086 Bacteria 4243
244 Ga0373934_0257798 3300035086 Unclassified 721
245 Ga0373940_0227160 3300035088 Unclassified 622
246 Ga0373923_0046324 3300035111 Bacteria 1808
247 Ga0373945_0201628 3300035116 Bacteria 826
248 Ga0373953_0139910 3300035117 Unclassified 1035
249 Ga0373954_0033729 3300035118 Bacteria 2368
250 Ga0373957_0013811 3300035120 Unclassified 2748
251 Ga0373943_0150863 3300035170 Unclassified 1259
252 Ga0373955_0045984 3300035172 Unclassified 2358
253 Ga0373924_0022375 3300035410 Bacteria 2472
254 Ga0373931_0088032 3300035691 Bacteria 1725
255 Ga0373935_0306882 3300035692 Bacteria 1123
256 Ga0373935_0410462 3300035692 Unclassified 974
257 Ga0373927_0000189 3300035695 Bacteria 49133
258 Ga0373927_0068034 3300035695 Bacteria 2304
259 Ga0373927_0089217 3300035695 Bacteria 2002
260 Ga0373927_0397645 3300035695 Unclassified 909
261 Ga0373933_0096332 3300035724 Bacteria 1831
262 Ga0373947_0046714 3300035725 Unclassified 2593
263 Ga0373947_0070761 3300035725 Bacteria 2138
264 Ga0373937_0016363 3300036401 Bacteria 6585
265 Ga0373937_0019416 3300036401 Bacteria 6083
266 Ga0373937_0160916 3300036401 Bacteria 2104
267 Ga0373937_0568478 3300036401 Bacteria 1077
268 Ga0373925_0001487 3300037068 Bacteria 20123
269 Ga0400489_11196 3300039093 Unclassified 1210
270 Ga0436365_0163859 3300039437 Unclassified 2409
271 Ga0436365_1691836 3300039437 Bacteria 8704
272 Ga0451577_0003695 3300042876 Bacteria 16744
273 Ga0451577_0063909 3300042876 Bacteria 3282
274 Ga0451577_0232227 3300042876 Unclassified 1668
275 Ga0451577_0437092 3300042876 Bacteria 1188
276 Ga0453684_0002093 3300044712 Bacteria 50497
277 Ga0453684_0003246 3300044712 Bacteria 37201
278 Ga0453684_0046884 3300044712 Bacteria 5740
279 Ga0453684_0309211 3300044712 Bacteria 1794
280 Ga0453684_0346462 3300044712 Bacteria 1676
281 Ga0453684_0391249 3300044712 Bacteria 1559
282 Ga0466959_0084149 3300045049 Bacteria 2290
283 Ga0451576_0717720 3300045051 Bacteria 1050
284 Ga0466967_0146531 3300045976 Bacteria 2203
285 Ga0466967_0308463 3300045976 Bacteria 1524
286 Ga0466967_0580605 3300045976 Bacteria 1105
287 Ga0466967_1411093 3300045976 Unclassified 694
288 Ga0495592_0191167 3300046454 Bacteria 1387
289 Ga0495629_0004608 3300046459 Bacteria 10319
290 Ga0495629_0033129 3300046459 Bacteria 3656
291 Ga0495629_0066740 3300046459 Bacteria 2511
292 Ga0495651_0069605 3300046462 Bacteria 2679
293 Ga0495651_0088356 3300046462 Bacteria 2329
294 Ga0495653_0149583 3300046463 Bacteria 1633
295 Ga0495580_0092038 3300046472 Bacteria 2110
296 Ga0495580_0109787 3300046472 Unclassified 1915
297 Ga0495580_0175855 3300046472 Bacteria 1479
298 Ga0495582_0024072 3300046473 Bacteria 3330
299 Ga0495582_0061029 3300046473 Bacteria 2081
300 Ga0495639_0071193 3300046475 Bacteria 1606
301 Ga0495639_0232089 3300046475 Unclassified 909
302 Ga0495662_0164203 3300046476 Unclassified 1094
303 Ga0495662_0178731 3300046476 Unclassified 1046
304 Ga0495664_0041081 3300046477 Bacteria 2735
305 Ga0495594_0001749 3300046499 Bacteria 11242
306 Ga0495594_0008152 3300046499 Bacteria 5390
307 Ga0495594_0050580 3300046499 Bacteria 2286
308 Ga0495608_0083792 3300046511 Bacteria 2069
309 Ga0495618_0058119 3300046514 Bacteria 2449
310 Ga0495628_0129680 3300046516 Unclassified 1929
311 Ga0495628_0794663 3300046516 Unclassified 662
312 Ga0495630_0019180 3300046517 Bacteria 5026
313 Ga0495630_0352157 3300046517 Bacteria 1127
314 Ga0495666_0036429 3300046526 Bacteria 2396
315 Ga0495666_0258980 3300046526 Bacteria 792
316 Ga0495652_0005720 3300046529 Bacteria 11644
317 Ga0495652_0102464 3300046529 Unclassified 2319
318 Ga0495652_0500229 3300046529 Bacteria 843
319 Ga0495665_0284562 3300046531 Unclassified 848
320 Ga0495586_0016660 3300046535 Bacteria 3908
321 Ga0495586_0320005 3300046535 Unclassified 890
322 Ga0495587_0022872 3300046536 Bacteria 3845
323 Ga0495645_0009297 3300046543 Bacteria 6873
324 Ga0495645_0022000 3300046543 Bacteria 4611
325 Ga0495645_0105226 3300046543 Bacteria 2003
326 Ga0495645_0108747 3300046543 Bacteria 1963
327 Ga0495645_0443752 3300046543 Bacteria 819
328 Ga0495667_0015790 3300046559 Bacteria 5106
329 Ga0495667_0033295 3300046559 Bacteria 3449
330 Ga0495667_0076069 3300046559 Bacteria 2184
331 Ga0495667_0266381 3300046559 Bacteria 1089
332 Ga0495634_0459317 3300046642 Bacteria 750
333 Ga0495635_0210956 3300046663 Unclassified 1315
334 Ga0495588_0183147 3300046674 Bacteria 1107
335 Ga0495657_0032672 3300046675 Bacteria 3630
336 Ga0495599_0015518 3300046678 Bacteria 4728
337 Ga0495599_0157348 3300046678 Unclassified 1405
338 Ga0495599_0288344 3300046678 Bacteria 993
339 Ga0495623_0118334 3300046679 Bacteria 1598
340 Ga0495623_0162452 3300046679 Bacteria 1311
341 Ga0495658_0137024 3300046683 Bacteria 1494
342 Ga0495613_0048798 3300046689 Unclassified 3126
343 Ga0495613_0188441 3300046689 Bacteria 1459
344 Ga0495613_0613436 3300046689 Unclassified 723
345 Ga0495624_0108202 3300046690 Unclassified 1710
346 Ga0495600_0054241 3300046809 Bacteria 2618
347 Ga0495600_0154595 3300046809 Bacteria 1484
348 Ga0495581_0044463 3300047315 Bacteria 2568
349 Ga0495581_0107633 3300047315 Bacteria 1620
350 Ga0495604_0027797 3300047317 Bacteria 4498
351 Ga0495604_0352479 3300047317 Bacteria 978
352 Ga0495636_0248004 3300047318 Bacteria 823
353 Ga0495674_0037285 3300047319 Unclassified 4368
354 Ga0495674_0119619 3300047319 Bacteria 2226
355 Ga0495674_0225158 3300047319 Bacteria 1549
356 Ga0495674_0265487 3300047319 Bacteria 1409
357 Ga0495672_0003710 3300047320 Bacteria 12885
358 Ga0495675_0042664 3300047444 Bacteria 2889
359 Ga0495675_0045465 3300047444 Bacteria 2795
360 Ga0495675_0153649 3300047444 Bacteria 1421
361 Ga0495684_0024959 3300047471 Bacteria 4597
362 Ga0495684_0123415 3300047471 Unclassified 1949
363 Ga0495684_0132304 3300047471 Bacteria 1873
364 Ga0495593_0031009 3300047673 Bacteria 2923
365 Ga0495593_0179657 3300047673 Unclassified 1066
366 Ga0495593_0181393 3300047673 Unclassified 1060
367 Ga0495602_0137546 3300048088 Unclassified 1938
368 Ga0495602_0280231 3300048088 Unclassified 1228
369 Ga0495602_0341081 3300048088 Bacteria 1084
370 Ga0495602_0553753 3300048088 Unclassified 797
371 Ga0496104_0092064 3300048907 Bacteria 2899
372 Ga0496104_0564992 3300048907 Unclassified 1048
373 Ga0496106_0124827 3300048909 Bacteria 2015
374 Ga0496108_0088588 3300048911 Bacteria 2630
375 Ga0496109_0306717 3300048912 Bacteria 1497
376 Ga0496110_0316606 3300048913 Bacteria 1421
377 Ga0496111_0346885 3300048914 Bacteria 1099
378 Ga0496112_0008544 3300048915 Bacteria 9177
379 Ga0496113_0025565 3300048916 Bacteria 4211
380 Ga0496113_1120060 3300048916 Bacteria 617
381 Ga0501032_0839792 3300049569 Bacteria 579
382 Ga0501033_0016274 3300049570 Bacteria 5632
383 Ga0501034_0031910 3300049571 Bacteria 5352
384 Ga0501034_0385483 3300049571 Bacteria 1326
385 Ga0501036_0054280 3300049572 Bacteria 3394
386 Ga0501038_0036783 3300049574 Bacteria 4296
387 Ga0501040_0138329 3300049576 Bacteria 1715
388 Ga0501040_0200421 3300049576 Unclassified 1417
389 Ga0501041_0230482 3300049577 Bacteria 1163
390 Ga0501042_0284173 3300049578 Bacteria 1195
391 Ga0501043_0385736 3300049579 Bacteria 1060
392 Ga0501046_0269930 3300049580 Unclassified 1248
393 Ga0501046_0458376 3300049580 Bacteria 916
394 Ga0501046_0573844 3300049580 Bacteria 802
395 Ga0501047_0037866 3300049581 Bacteria 4665
396 Ga0501047_0317293 3300049581 Bacteria 1399
397 Ga0501048_0473410 3300049582 Bacteria 898
398 Ga0501070_0228733 3300049586 Bacteria 1524
399 Ga0501072_0082173 3300049588 Bacteria 2554
400 Ga0501073_0095636 3300049589 Bacteria 2063
401 Ga0501075_0247314 3300049591 Bacteria 1359
402 Ga0501076_0128921 3300049592 Bacteria 2051
403 Ga0501076_0148788 3300049592 Bacteria 1904
404 Ga0501076_0594140 3300049592 Bacteria 913
405 Ga0501079_0323070 3300049741 Bacteria 1208
406 Ga0501083_0311173 3300049744 Bacteria 1024
407 Ga0501083_0681674 3300049744 Bacteria 668
408 Ga0501035_0051900 3300049822 Bacteria 3670
409 Ga0501035_0577087 3300049822 Bacteria 919
410 Ga0501044_0033355 3300049823 Bacteria 5412
411 Ga0501044_0073927 3300049823 Bacteria 3464
412 Ga0501044_0398580 3300049823 Unclassified 1289
413 Ga0501045_0080019 3300049824 Bacteria 2409
414 nmdc:mga05p37_37346_c1 3300050507 Bacteria 5955
415 nmdc:mga09592_1614237_c1 3300050508 Bacteria 525
416 nmdc:mga08y16_690868_c1 3300050511 Bacteria 1021
417 nmdc:mga0n895_195464_c1 3300050512 Unclassified 2054
418 nmdc:mga0n895_252151_c1 3300050512 Bacteria 1791
419 nmdc:mga0rr50_507646_c1 3300050513 Unclassified 1025
420 Ga0495601_0107525 3300053077 Unclassified 1805
421 Ga0495601_0139603 3300053077 Bacteria 1580
422 Ga0495601_0514655 3300053077 Unclassified 771
423 Ga0495595_0010726 3300053084 Bacteria 3818
424 Ga0495619_0093615 3300053085 Bacteria 2037
425 Ga0500641_0270133 3300053096 Bacteria 708
426 Ga0501084_0149344 3300054114 Bacteria 1969
427 Ga0530510_0031981 3300061734 Bacteria 3783
428 Ga0530510_1110260 3300061734 Bacteria 606

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005436 Ga0070713_100096427 Ga0070713_1000964272 127
2 3300035116 Ga0373945_0201628 Ga0373945_0201628_283_735 132
3 3300035692 Ga0373935_0306882 Ga0373935_0306882_121_573 132
4 3300035695 Ga0373927_0068034 Ga0373927_0068034_1646_2098 132
5 3300035695 Ga0373927_0089217 Ga0373927_0089217_1327_1779 132
6 3300035725 Ga0373947_0070761 Ga0373947_0070761_1359_1811 132
7 3300046459 Ga0495629_0033129 Ga0495629_0033129_2400_2852 132
8 3300046472 Ga0495580_0092038 Ga0495580_0092038_526_978 132
9 3300046473 Ga0495582_0061029 Ga0495582_0061029_963_1415 132
10 3300046475 Ga0495639_0071193 Ga0495639_0071193_750_1202 132
11 3300046499 Ga0495594_0008152 Ga0495594_0008152_4014_4466 132
12 3300046517 Ga0495630_0019180 Ga0495630_0019180_3841_4293 132
13 3300046526 Ga0495666_0258980 Ga0495666_0258980_125_577 132
14 3300046535 Ga0495586_0016660 Ga0495586_0016660_1647_2099 132
15 3300046674 Ga0495588_0183147 Ga0495588_0183147_22_474 132
16 3300046683 Ga0495658_0137024 Ga0495658_0137024_934_1386 132
17 3300046689 Ga0495613_0188441 Ga0495613_0188441_291_743 132
18 3300047315 Ga0495581_0107633 Ga0495581_0107633_1121_1573 132
19 3300047319 Ga0495674_0119619 Ga0495674_0119619_788_1240 132
20 3300047471 Ga0495684_0024959 Ga0495684_0024959_3440_3892 132
21 3300047673 Ga0495593_0031009 Ga0495593_0031009_93_545 132
22 3300048088 Ga0495602_0341081 Ga0495602_0341081_382_834 132
23 3300049576 Ga0501040_0138329 Ga0501040_0138329_770_1246 132
24 3300049576 Ga0501040_0200421 Ga0501040_0200421_686_1153 132
25 3300049580 Ga0501046_0458376 Ga0501046_0458376_207_674 132
26 3300049588 Ga0501072_0082173 Ga0501072_0082173_94_561 132
27 3300049592 Ga0501076_0148788 Ga0501076_0148788_1131_1598 132
28 3300049744 Ga0501083_0311173 Ga0501083_0311173_443_910 132
29 3300005406 Ga0070703_10028615 Ga0070703_100286152 133
30 3300005445 Ga0070708_100000061 Ga0070708_10000006114 133
31 3300005468 Ga0070707_100205412 Ga0070707_1002054122 133
32 3300005535 Ga0070684_100670076 Ga0070684_1006700761 133
33 3300005614 Ga0068856_100075534 Ga0068856_1000755344 133
34 3300006175 Ga0070712_100062894 Ga0070712_1000628944 133
35 3300006358 Ga0068871_100611023 Ga0068871_1006110232 133
36 3300013105 Ga0157369_10120100 Ga0157369_101201003 133
37 3300013105 Ga0157369_10363499 Ga0157369_103634992 133
38 3300013307 Ga0157372_10022936 Ga0157372_100229363 133
39 3300013307 Ga0157372_10473697 Ga0157372_104736973 133
40 3300025915 Ga0207693_10061792 Ga0207693_100617922 133
41 3300026078 Ga0207702_10065423 Ga0207702_100654233 133
42 3300028379 Ga0268266_10331172 Ga0268266_103311721 133
43 3300035410 Ga0373924_0022375 Ga0373924_0022375_1800_2258 133
44 3300035724 Ga0373933_0096332 Ga0373933_0096332_1078_1536 133
45 3300036401 Ga0373937_0016363 Ga0373937_0016363_4971_5429 133
46 3300046454 Ga0495592_0191167 Ga0495592_0191167_374_832 133
47 3300046511 Ga0495608_0083792 Ga0495608_0083792_162_620 133
48 3300046543 Ga0495645_0108747 Ga0495645_0108747_905_1363 133
49 3300046559 Ga0495667_0033295 Ga0495667_0033295_520_978 133
50 3300046679 Ga0495623_0162452 Ga0495623_0162452_418_876 133
51 3300046689 Ga0495613_0048798 Ga0495613_0048798_2267_2725 133
52 3300047444 Ga0495675_0045465 Ga0495675_0045465_592_1050 133
53 3300048907 Ga0496104_0092064 Ga0496104_0092064_1301_1759 133
54 3300049591 Ga0501075_0247314 Ga0501075_0247314_208_675 133
55 3300049592 Ga0501076_0594140 Ga0501076_0594140_401_868 133
56 3300049744 Ga0501083_0681674 Ga0501083_0681674_157_624 133
57 3300053077 Ga0495601_0139603 Ga0495601_0139603_123_581 133
58 3300053084 Ga0495595_0010726 Ga0495595_0010726_1354_1812 133
59 3300054114 Ga0501084_0149344 Ga0501084_0149344_1372_1839 133
60 3300005439 Ga0070711_100931450 Ga0070711_1009314502 134
61 3300025916 Ga0207663_10165078 Ga0207663_101650783 134
62 3300025928 Ga0207700_10046788 Ga0207700_100467883 134
63 3300035086 Ga0373934_0006808 Ga0373934_0006808_2166_2618 134
64 3300035086 Ga0373934_0257798 Ga0373934_0257798_144_602 134
65 3300035111 Ga0373923_0046324 Ga0373923_0046324_1339_1797 134
66 3300035117 Ga0373953_0139910 Ga0373953_0139910_409_867 134
67 3300035118 Ga0373954_0033729 Ga0373954_0033729_264_722 134
68 3300035120 Ga0373957_0013811 Ga0373957_0013811_1312_1764 134
69 3300035172 Ga0373955_0045984 Ga0373955_0045984_763_1215 134
70 3300036401 Ga0373937_0019416 Ga0373937_0019416_3602_4054 134
71 3300036401 Ga0373937_0160916 Ga0373937_0160916_1614_2072 134
72 3300046462 Ga0495651_0069605 Ga0495651_0069605_1614_2072 134
73 3300046462 Ga0495651_0088356 Ga0495651_0088356_1490_1942 134
74 3300046477 Ga0495664_0041081 Ga0495664_0041081_1132_1590 134
75 3300046516 Ga0495628_0129680 Ga0495628_0129680_1041_1493 134
76 3300046529 Ga0495652_0005720 Ga0495652_0005720_10274_10732 134
77 3300046529 Ga0495652_0102464 Ga0495652_0102464_1626_2078 134
78 3300046536 Ga0495587_0022872 Ga0495587_0022872_3244_3702 134
79 3300046543 Ga0495645_0009297 Ga0495645_0009297_5335_5787 134
80 3300046543 Ga0495645_0022000 Ga0495645_0022000_2831_3289 134
81 3300046559 Ga0495667_0015790 Ga0495667_0015790_1705_2157 134
82 3300046663 Ga0495635_0210956 Ga0495635_0210956_52_510 134
83 3300046675 Ga0495657_0032672 Ga0495657_0032672_79_537 134
84 3300046678 Ga0495599_0015518 Ga0495599_0015518_2438_2896 134
85 3300046678 Ga0495599_0157348 Ga0495599_0157348_707_1159 134
86 3300046809 Ga0495600_0054241 Ga0495600_0054241_1462_1914 134
87 3300047317 Ga0495604_0027797 Ga0495604_0027797_2462_2920 134
88 3300047444 Ga0495675_0042664 Ga0495675_0042664_97_555 134
89 3300048088 Ga0495602_0137546 Ga0495602_0137546_144_602 134
90 3300048088 Ga0495602_0553753 Ga0495602_0553753_81_533 134
91 3300053077 Ga0495601_0514655 Ga0495601_0514655_299_757 134
92 3300053085 Ga0495619_0093615 Ga0495619_0093615_1311_1769 134
93 3300005347 Ga0070668_100511211 Ga0070668_1005112111 137
94 3300005356 Ga0070674_100809197 Ga0070674_1008091971 137
95 3300005459 Ga0068867_100494028 Ga0068867_1004940282 137
96 3300006237 Ga0097621_100520504 Ga0097621_1005205042 137
97 3300006358 Ga0068871_100301519 Ga0068871_1003015193 137
98 3300009098 Ga0105245_10465694 Ga0105245_104656942 137
99 3300009176 Ga0105242_10141898 Ga0105242_101418981 137
100 3300013297 Ga0157378_10102928 Ga0157378_101029281 137
101 3300013306 Ga0163162_12315357 Ga0163162_123153571 137
102 3300017792 Ga0163161_10734036 Ga0163161_107340362 137
103 3300025940 Ga0207691_10161978 Ga0207691_101619782 137
104 3300005436 Ga0070713_100080495 Ga0070713_1000804952 138
105 3300044712 Ga0453684_0003246 Ga0453684_0003246_15041_15499 138
106 3300042876 Ga0451577_0437092 Ga0451577_0437092_61_540 142
107 3300044712 Ga0453684_0391249 Ga0453684_0391249_98_577 142
108 3300006028 Ga0070717_10676278 Ga0070717_106762782 145
109 3300050512 nmdc:mga0n895_195464_c1 nmdc:mga0n895_195464_c1_1501_1947 146
110 3300005535 Ga0070684_100301621 Ga0070684_1003016212 147
111 3300005549 Ga0070704_101804027 Ga0070704_1018040271 147
112 3300006914 Ga0075436_101107526 Ga0075436_1011075261 147
113 3300035170 Ga0373943_0150863 Ga0373943_0150863_282_725 147
114 3300035695 Ga0373927_0000189 Ga0373927_0000189_16597_17040 147
115 3300035725 Ga0373947_0046714 Ga0373947_0046714_1230_1673 147
116 3300037068 Ga0373925_0001487 Ga0373925_0001487_15816_16259 147
117 3300046476 Ga0495662_0164203 Ga0495662_0164203_269_712 147
118 3300046690 Ga0495624_0108202 Ga0495624_0108202_1204_1647 147
119 3300050513 nmdc:mga0rr50_507646_c1 nmdc:mga0rr50_507646_c1_448_891 147
120 3300005329 Ga0070683_100051195 Ga0070683_1000511953 148
121 3300005331 Ga0070670_100032776 Ga0070670_1000327763 148
122 3300005333 Ga0070677_10241753 Ga0070677_102417532 148
123 3300005334 Ga0068869_100012137 Ga0068869_1000121374 148
124 3300005335 Ga0070666_10081837 Ga0070666_100818372 148
125 3300005336 Ga0070680_100252745 Ga0070680_1002527452 148
126 3300005337 Ga0070682_100029554 Ga0070682_1000295542 148
127 3300005340 Ga0070689_100022486 Ga0070689_1000224865 148
128 3300005343 Ga0070687_100388471 Ga0070687_1003884711 148
129 3300005344 Ga0070661_100000908 Ga0070661_10000090821 148
130 3300005354 Ga0070675_100018624 Ga0070675_1000186244 148
131 3300005364 Ga0070673_100019013 Ga0070673_1000190135 148
132 3300005366 Ga0070659_100015345 Ga0070659_1000153455 148
133 3300005440 Ga0070705_100135786 Ga0070705_1001357862 148
134 3300005457 Ga0070662_100005041 Ga0070662_1000050418 148
135 3300005458 Ga0070681_10035410 Ga0070681_100354103 148
136 3300005535 Ga0070684_100001555 Ga0070684_10000155515 148
137 3300005547 Ga0070693_100002100 Ga0070693_1000021004 148
138 3300005563 Ga0068855_100266319 Ga0068855_1002663193 148
139 3300005564 Ga0070664_100088209 Ga0070664_1000882093 148
140 3300005577 Ga0068857_100006549 Ga0068857_1000065493 148
141 3300005614 Ga0068856_100010283 Ga0068856_1000102834 148
142 3300005615 Ga0070702_100010499 Ga0070702_1000104993 148
143 3300005616 Ga0068852_100206856 Ga0068852_1002068563 148
144 3300005617 Ga0068859_100033059 Ga0068859_1000330593 148
145 3300005618 Ga0068864_100036389 Ga0068864_1000363893 148
146 3300005834 Ga0068851_10078502 Ga0068851_100785022 148
147 3300005840 Ga0068870_10033794 Ga0068870_100337942 148
148 3300005841 Ga0068863_100003189 Ga0068863_10000318915 148
149 3300005842 Ga0068858_100170219 Ga0068858_1001702193 148
150 3300005843 Ga0068860_100039853 Ga0068860_1000398534 148
151 3300006237 Ga0097621_100117312 Ga0097621_1001173123 148
152 3300006358 Ga0068871_100012100 Ga0068871_1000121002 148
153 3300006931 Ga0097620_100033057 Ga0097620_1000330574 148
154 3300009098 Ga0105245_10007125 Ga0105245_1000712510 148
155 3300009174 Ga0105241_10009522 Ga0105241_100095224 148
156 3300009177 Ga0105248_10035778 Ga0105248_100357785 148
157 3300009551 Ga0105238_10076991 Ga0105238_100769914 148
158 3300010375 Ga0105239_10030938 Ga0105239_100309384 148
159 3300011119 Ga0105246_10021775 Ga0105246_100217753 148
160 3300013100 Ga0157373_10014733 Ga0157373_100147336 148
161 3300013102 Ga0157371_10013930 Ga0157371_100139305 148
162 3300013105 Ga0157369_11207683 Ga0157369_112076832 148
163 3300013296 Ga0157374_10327270 Ga0157374_103272703 148
164 3300013307 Ga0157372_10008852 Ga0157372_100088524 148
165 3300014325 Ga0163163_10023826 Ga0163163_100238265 148
166 3300014745 Ga0157377_10001649 Ga0157377_100016494 148
167 3300014969 Ga0157376_10018230 Ga0157376_100182304 148
168 3300025321 Ga0207656_10133430 Ga0207656_101334302 148
169 3300025908 Ga0207643_10053054 Ga0207643_100530543 148
170 3300025911 Ga0207654_10021240 Ga0207654_100212403 148
171 3300025912 Ga0207707_10011758 Ga0207707_100117584 148
172 3300025917 Ga0207660_10100447 Ga0207660_101004473 148
173 3300025918 Ga0207662_10412613 Ga0207662_104126132 148
174 3300025920 Ga0207649_10102585 Ga0207649_101025852 148
175 3300025924 Ga0207694_10876841 Ga0207694_108768411 148
176 3300025925 Ga0207650_10016169 Ga0207650_100161693 148
177 3300025926 Ga0207659_10132434 Ga0207659_101324343 148
178 3300025927 Ga0207687_10014423 Ga0207687_100144234 148
179 3300025932 Ga0207690_10024302 Ga0207690_100243024 148
180 3300025933 Ga0207706_10010916 Ga0207706_100109164 148
181 3300025941 Ga0207711_10027934 Ga0207711_100279344 148
182 3300025942 Ga0207689_10000803 Ga0207689_1000080327 148
183 3300025944 Ga0207661_10001475 Ga0207661_1000147513 148
184 3300025945 Ga0207679_10017092 Ga0207679_100170924 148
185 3300025960 Ga0207651_10044334 Ga0207651_100443343 148
186 3300025986 Ga0207658_10057493 Ga0207658_100574933 148
187 3300026023 Ga0207677_10048969 Ga0207677_100489693 148
188 3300026035 Ga0207703_10121051 Ga0207703_101210512 148
189 3300026088 Ga0207641_10083431 Ga0207641_100834313 148
190 3300026095 Ga0207676_10003020 Ga0207676_1000302012 148
191 3300026116 Ga0207674_10004371 Ga0207674_100043715 148
192 3300026142 Ga0207698_10068493 Ga0207698_100684931 148
193 3300028380 Ga0268265_10750822 Ga0268265_107508221 148
194 3300028381 Ga0268264_10854921 Ga0268264_108549212 148
195 3300045049 Ga0466959_0084149 Ga0466959_0084149_652_1098 148
196 3300046499 Ga0495594_0001749 Ga0495594_0001749_2293_2739 148
197 3300046499 Ga0495594_0050580 Ga0495594_0050580_1352_1798 148
198 3300049569 Ga0501032_0839792 Ga0501032_0839792_88_534 148
199 3300049570 Ga0501033_0016274 Ga0501033_0016274_5099_5545 148
200 3300049571 Ga0501034_0031910 Ga0501034_0031910_3399_3845 148
201 3300049572 Ga0501036_0054280 Ga0501036_0054280_620_1066 148
202 3300049574 Ga0501038_0036783 Ga0501038_0036783_107_553 148
203 3300049579 Ga0501043_0385736 Ga0501043_0385736_563_1009 148
204 3300049580 Ga0501046_0573844 Ga0501046_0573844_344_790 148
205 3300049586 Ga0501070_0228733 Ga0501070_0228733_391_837 148
206 3300049589 Ga0501073_0095636 Ga0501073_0095636_1590_2036 148
207 3300049822 Ga0501035_0051900 Ga0501035_0051900_1462_1908 148
208 3300049823 Ga0501044_0033355 Ga0501044_0033355_2905_3351 148
209 3300049823 Ga0501044_0073927 Ga0501044_0073927_940_1386 148
210 3300005329 Ga0070683_100364391 Ga0070683_1003643912 149
211 3300005334 Ga0068869_100054131 Ga0068869_1000541314 149
212 3300005340 Ga0070689_100026029 Ga0070689_1000260294 149
213 3300005343 Ga0070687_100036024 Ga0070687_1000360242 149
214 3300005354 Ga0070675_100038900 Ga0070675_1000389004 149
215 3300005365 Ga0070688_100164515 Ga0070688_1001645153 149
216 3300005367 Ga0070667_100061272 Ga0070667_1000612723 149
217 3300005456 Ga0070678_100440056 Ga0070678_1004400562 149
218 3300005459 Ga0068867_100264845 Ga0068867_1002648452 149
219 3300005466 Ga0070685_10155532 Ga0070685_101555323 149
220 3300005543 Ga0070672_100077117 Ga0070672_1000771173 149
221 3300005577 Ga0068857_100040832 Ga0068857_1000408324 149
222 3300005615 Ga0070702_100527874 Ga0070702_1005278741 149
223 3300005616 Ga0068852_100791267 Ga0068852_1007912672 149
224 3300005617 Ga0068859_100055779 Ga0068859_1000557794 149
225 3300005617 Ga0068859_100171770 Ga0068859_1001717702 149
226 3300005840 Ga0068870_10143954 Ga0068870_101439543 149
227 3300005844 Ga0068862_100387456 Ga0068862_1003874562 149
228 3300006871 Ga0075434_100261140 Ga0075434_1002611402 149
229 3300006880 Ga0075429_101673683 Ga0075429_1016736832 149
230 3300006881 Ga0068865_100338514 Ga0068865_1003385142 149
231 3300006931 Ga0097620_100055781 Ga0097620_1000557814 149
232 3300006931 Ga0097620_100171782 Ga0097620_1001717822 149
233 3300009093 Ga0105240_10353794 Ga0105240_103537942 149
234 3300009147 Ga0114129_10043421 Ga0114129_100434215 149
235 3300009176 Ga0105242_10019444 Ga0105242_100194444 149
236 3300009176 Ga0105242_10205311 Ga0105242_102053112 149
237 3300009176 Ga0105242_10712377 Ga0105242_107123772 149
238 3300009177 Ga0105248_10110616 Ga0105248_101106164 149
239 3300009553 Ga0105249_10212816 Ga0105249_102128163 149
240 3300010375 Ga0105239_10143341 Ga0105239_101433414 149
241 3300013306 Ga0163162_10086080 Ga0163162_100860804 149
242 3300013308 Ga0157375_10064468 Ga0157375_100644684 149
243 3300014745 Ga0157377_10947610 Ga0157377_109476102 149
244 3300017792 Ga0163161_11760257 Ga0163161_117602572 149
245 3300025907 Ga0207645_10151822 Ga0207645_101518223 149
246 3300025918 Ga0207662_10089392 Ga0207662_100893923 149
247 3300025926 Ga0207659_10188063 Ga0207659_101880632 149
248 3300025936 Ga0207670_10027704 Ga0207670_100277044 149
249 3300025940 Ga0207691_10068176 Ga0207691_100681763 149
250 3300025961 Ga0207712_10042452 Ga0207712_100424522 149
251 3300025986 Ga0207658_10122700 Ga0207658_101227003 149
252 3300026095 Ga0207676_11659366 Ga0207676_116593661 149
253 3300026116 Ga0207674_10195292 Ga0207674_101952923 149
254 3300028380 Ga0268265_10021045 Ga0268265_100210454 149
255 3300039093 Ga0400489_11196 Ga0400489_11196_673_1146 149
256 3300042876 Ga0451577_0003695 Ga0451577_0003695_462_941 149
257 3300042876 Ga0451577_0063909 Ga0451577_0063909_1942_2397 149
258 3300042876 Ga0451577_0232227 Ga0451577_0232227_726_1196 149
259 3300044712 Ga0453684_0002093 Ga0453684_0002093_570_1049 149
260 3300044712 Ga0453684_0046884 Ga0453684_0046884_3225_3695 149
261 3300044712 Ga0453684_0309211 Ga0453684_0309211_1129_1590 149
262 3300044712 Ga0453684_0346462 Ga0453684_0346462_141_596 149
263 3300046459 Ga0495629_0004608 Ga0495629_0004608_3668_4117 149
264 3300046463 Ga0495653_0149583 Ga0495653_0149583_158_610 149
265 3300046472 Ga0495580_0175855 Ga0495580_0175855_482_937 149
266 3300046516 Ga0495628_0794663 Ga0495628_0794663_77_529 149
267 3300046517 Ga0495630_0352157 Ga0495630_0352157_347_799 149
268 3300046529 Ga0495652_0500229 Ga0495652_0500229_341_793 149
269 3300046531 Ga0495665_0284562 Ga0495665_0284562_10_459 149
270 3300046543 Ga0495645_0105226 Ga0495645_0105226_1006_1455 149
271 3300046543 Ga0495645_0443752 Ga0495645_0443752_231_683 149
272 3300046559 Ga0495667_0076069 Ga0495667_0076069_1250_1702 149
273 3300046642 Ga0495634_0459317 Ga0495634_0459317_241_693 149
274 3300046678 Ga0495599_0288344 Ga0495599_0288344_34_486 149
275 3300046679 Ga0495623_0118334 Ga0495623_0118334_459_911 149
276 3300046689 Ga0495613_0613436 Ga0495613_0613436_221_670 149
277 3300046809 Ga0495600_0154595 Ga0495600_0154595_127_579 149
278 3300047315 Ga0495581_0044463 Ga0495581_0044463_1988_2437 149
279 3300047317 Ga0495604_0352479 Ga0495604_0352479_367_819 149
280 3300047318 Ga0495636_0248004 Ga0495636_0248004_163_612 149
281 3300047319 Ga0495674_0037285 Ga0495674_0037285_3411_3863 149
282 3300047319 Ga0495674_0225158 Ga0495674_0225158_14_466 149
283 3300047444 Ga0495675_0153649 Ga0495675_0153649_803_1255 149
284 3300047471 Ga0495684_0132304 Ga0495684_0132304_940_1392 149
285 3300047673 Ga0495593_0181393 Ga0495593_0181393_330_779 149
286 3300050507 nmdc:mga05p37_37346_c1 nmdc:mga05p37_37346_c1_593_1042 149
287 3300050508 nmdc:mga09592_1614237_c1 nmdc:mga09592_1614237_c1_57_506 149
288 3300050512 nmdc:mga0n895_252151_c1 nmdc:mga0n895_252151_c1_631_1089 149
289 3300053096 Ga0500641_0270133 Ga0500641_0270133_73_522 149
290 3300005290 Ga0065712_10338273 Ga0065712_103382731 150
291 3300005329 Ga0070683_100007770 Ga0070683_1000077707 150
292 3300005329 Ga0070683_100012899 Ga0070683_1000128994 150
293 3300005329 Ga0070683_100033107 Ga0070683_1000331073 150
294 3300005329 Ga0070683_100233387 Ga0070683_1002333872 150
295 3300005337 Ga0070682_100886011 Ga0070682_1008860112 150
296 3300005339 Ga0070660_100706746 Ga0070660_1007067461 150
297 3300005340 Ga0070689_100157992 Ga0070689_1001579922 150
298 3300005340 Ga0070689_100510295 Ga0070689_1005102952 150
299 3300005347 Ga0070668_102086152 Ga0070668_1020861521 150
300 3300005354 Ga0070675_100231561 Ga0070675_1002315612 150
301 3300005355 Ga0070671_101017662 Ga0070671_1010176621 150
302 3300005434 Ga0070709_10031182 Ga0070709_100311822 150
303 3300005434 Ga0070709_10132010 Ga0070709_101320102 150
304 3300005439 Ga0070711_100516898 Ga0070711_1005168982 150
305 3300005530 Ga0070679_100042758 Ga0070679_1000427586 150
306 3300005535 Ga0070684_100020409 Ga0070684_1000204092 150
307 3300005535 Ga0070684_100070160 Ga0070684_1000701604 150
308 3300005535 Ga0070684_100120472 Ga0070684_1001204721 150
309 3300005543 Ga0070672_100254209 Ga0070672_1002542092 150
310 3300005544 Ga0070686_100050122 Ga0070686_1000501222 150
311 3300005548 Ga0070665_100134827 Ga0070665_1001348273 150
312 3300005564 Ga0070664_100239146 Ga0070664_1002391462 150
313 3300005577 Ga0068857_100855972 Ga0068857_1008559722 150
314 3300005614 Ga0068856_100108156 Ga0068856_1001081562 150
315 3300005616 Ga0068852_101213595 Ga0068852_1012135951 150
316 3300005618 Ga0068864_101535911 Ga0068864_1015359112 150
317 3300005719 Ga0068861_100257101 Ga0068861_1002571012 150
318 3300005844 Ga0068862_100766041 Ga0068862_1007660412 150
319 3300006028 Ga0070717_10454146 Ga0070717_104541462 150
320 3300006173 Ga0070716_100009509 Ga0070716_1000095094 150
321 3300006175 Ga0070712_100070202 Ga0070712_1000702022 150
322 3300006871 Ga0075434_100350547 Ga0075434_1003505473 150
323 3300006871 Ga0075434_101943114 Ga0075434_1019431141 150
324 3300006914 Ga0075436_100901150 Ga0075436_1009011501 150
325 3300009094 Ga0111539_10215385 Ga0111539_102153853 150
326 3300009098 Ga0105245_10041100 Ga0105245_100411002 150
327 3300009101 Ga0105247_10124211 Ga0105247_101242112 150
328 3300009101 Ga0105247_10755898 Ga0105247_107558981 150
329 3300009174 Ga0105241_10472144 Ga0105241_104721442 150
330 3300009176 Ga0105242_10021520 Ga0105242_100215203 150
331 3300009177 Ga0105248_10112257 Ga0105248_101122574 150
332 3300009553 Ga0105249_12265564 Ga0105249_122655642 150
333 3300010375 Ga0105239_10291572 Ga0105239_102915722 150
334 3300013102 Ga0157371_11422187 Ga0157371_114221871 150
335 3300013105 Ga0157369_10406336 Ga0157369_104063363 150
336 3300013297 Ga0157378_10355162 Ga0157378_103551622 150
337 3300013306 Ga0163162_11726925 Ga0163162_117269251 150
338 3300013307 Ga0157372_10036414 Ga0157372_100364145 150
339 3300013307 Ga0157372_10111878 Ga0157372_101118782 150
340 3300013307 Ga0157372_11069800 Ga0157372_110698002 150
341 3300013308 Ga0157375_10028883 Ga0157375_100288832 150
342 3300013308 Ga0157375_10090144 Ga0157375_100901442 150
343 3300013308 Ga0157375_11793438 Ga0157375_117934381 150
344 3300014325 Ga0163163_10817737 Ga0163163_108177371 150
345 3300014968 Ga0157379_10564178 Ga0157379_105641782 150
346 3300014968 Ga0157379_10904191 Ga0157379_109041911 150
347 3300014968 Ga0157379_11119050 Ga0157379_111190501 150
348 3300014969 Ga0157376_10193520 Ga0157376_101935202 150
349 3300021384 Ga0213876_10222518 Ga0213876_102225181 150
350 3300025906 Ga0207699_10007313 Ga0207699_100073134 150
351 3300025909 Ga0207705_10670196 Ga0207705_106701961 150
352 3300025911 Ga0207654_10202659 Ga0207654_102026592 150
353 3300025913 Ga0207695_10755923 Ga0207695_107559232 150
354 3300025921 Ga0207652_10159333 Ga0207652_101593333 150
355 3300025921 Ga0207652_10312962 Ga0207652_103129621 150
356 3300025923 Ga0207681_10655438 Ga0207681_106554381 150
357 3300025927 Ga0207687_10011304 Ga0207687_100113045 150
358 3300025934 Ga0207686_10043844 Ga0207686_100438441 150
359 3300025936 Ga0207670_10298188 Ga0207670_102981882 150
360 3300025939 Ga0207665_10043525 Ga0207665_100435252 150
361 3300025940 Ga0207691_10235296 Ga0207691_102352962 150
362 3300025944 Ga0207661_10006522 Ga0207661_100065224 150
363 3300025944 Ga0207661_10031864 Ga0207661_100318643 150
364 3300025944 Ga0207661_10173929 Ga0207661_101739293 150
365 3300025972 Ga0207668_11559198 Ga0207668_115591982 150
366 3300025981 Ga0207640_11705835 Ga0207640_117058351 150
367 3300026035 Ga0207703_10234408 Ga0207703_102344082 150
368 3300026078 Ga0207702_10004994 Ga0207702_1000499410 150
369 3300026078 Ga0207702_10080976 Ga0207702_100809762 150
370 3300026078 Ga0207702_10744890 Ga0207702_107448902 150
371 3300026088 Ga0207641_10739221 Ga0207641_107392211 150
372 3300026095 Ga0207676_10362480 Ga0207676_103624802 150
373 3300026095 Ga0207676_11419009 Ga0207676_114190092 150
374 3300026116 Ga0207674_10154867 Ga0207674_101548673 150
375 3300026118 Ga0207675_100271672 Ga0207675_1002716722 150
376 3300026142 Ga0207698_11061041 Ga0207698_110610411 150
377 3300028381 Ga0268264_10876464 Ga0268264_108764642 150
378 3300035088 Ga0373940_0227160 Ga0373940_0227160_20_472 150
379 3300035691 Ga0373931_0088032 Ga0373931_0088032_123_575 150
380 3300035692 Ga0373935_0410462 Ga0373935_0410462_287_745 150
381 3300035695 Ga0373927_0397645 Ga0373927_0397645_191_649 150
382 3300036401 Ga0373937_0568478 Ga0373937_0568478_275_745 150
383 3300039437 Ga0436365_0163859 Ga0436365_0163859_279_761 150
384 3300039437 Ga0436365_1691836 Ga0436365_1691836_5366_5821 150
385 3300045051 Ga0451576_0717720 Ga0451576_0717720_395_847 150
386 3300045976 Ga0466967_0146531 Ga0466967_0146531_1034_1495 150
387 3300045976 Ga0466967_0308463 Ga0466967_0308463_1043_1501 150
388 3300045976 Ga0466967_0580605 Ga0466967_0580605_262_717 150
389 3300045976 Ga0466967_1411093 Ga0466967_1411093_165_617 150
390 3300046459 Ga0495629_0066740 Ga0495629_0066740_1069_1527 150
391 3300046472 Ga0495580_0109787 Ga0495580_0109787_253_711 150
392 3300046473 Ga0495582_0024072 Ga0495582_0024072_2720_3178 150
393 3300046475 Ga0495639_0232089 Ga0495639_0232089_196_654 150
394 3300046476 Ga0495662_0178731 Ga0495662_0178731_130_588 150
395 3300046514 Ga0495618_0058119 Ga0495618_0058119_1643_2101 150
396 3300046526 Ga0495666_0036429 Ga0495666_0036429_172_630 150
397 3300046535 Ga0495586_0320005 Ga0495586_0320005_307_759 150
398 3300046559 Ga0495667_0266381 Ga0495667_0266381_579_1037 150
399 3300047319 Ga0495674_0265487 Ga0495674_0265487_16_474 150
400 3300047320 Ga0495672_0003710 Ga0495672_0003710_4007_4459 150
401 3300047471 Ga0495684_0123415 Ga0495684_0123415_394_852 150
402 3300047673 Ga0495593_0179657 Ga0495593_0179657_443_901 150
403 3300048088 Ga0495602_0280231 Ga0495602_0280231_608_1087 150
404 3300048907 Ga0496104_0564992 Ga0496104_0564992_231_701 150
405 3300048909 Ga0496106_0124827 Ga0496106_0124827_106_558 150
406 3300048911 Ga0496108_0088588 Ga0496108_0088588_1129_1581 150
407 3300048912 Ga0496109_0306717 Ga0496109_0306717_646_1098 150
408 3300048913 Ga0496110_0316606 Ga0496110_0316606_605_1057 150
409 3300048914 Ga0496111_0346885 Ga0496111_0346885_151_603 150
410 3300048915 Ga0496112_0008544 Ga0496112_0008544_3780_4232 150
411 3300048916 Ga0496113_0025565 Ga0496113_0025565_755_1207 150
412 3300048916 Ga0496113_1120060 Ga0496113_1120060_81_560 150
413 3300049571 Ga0501034_0385483 Ga0501034_0385483_28_489 150
414 3300049577 Ga0501041_0230482 Ga0501041_0230482_196_678 150
415 3300049578 Ga0501042_0284173 Ga0501042_0284173_91_573 150
416 3300049580 Ga0501046_0269930 Ga0501046_0269930_673_1134 150
417 3300049581 Ga0501047_0037866 Ga0501047_0037866_2064_2525 150
418 3300049581 Ga0501047_0317293 Ga0501047_0317293_125_583 150
419 3300049582 Ga0501048_0473410 Ga0501048_0473410_331_813 150
420 3300049592 Ga0501076_0128921 Ga0501076_0128921_1243_1725 150
421 3300049741 Ga0501079_0323070 Ga0501079_0323070_411_893 150
422 3300049822 Ga0501035_0577087 Ga0501035_0577087_205_666 150
423 3300049823 Ga0501044_0398580 Ga0501044_0398580_56_517 150
424 3300049824 Ga0501045_0080019 Ga0501045_0080019_354_836 150
425 3300050511 nmdc:mga08y16_690868_c1 nmdc:mga08y16_690868_c1_311_763 150
426 3300053077 Ga0495601_0107525 Ga0495601_0107525_675_1154 150
427 3300061734 Ga0530510_0031981 Ga0530510_0031981_1185_1667 150
428 3300061734 Ga0530510_1110260 Ga0530510_1110260_109_591 150

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02502

LacAB_rpiB

Ribose/Galactose Isomerase

3

141

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2vvr-assembly1.cif.gz_A crystal structure of the h99n mutant of ribose-5-phosphate isomerase b from e. coli soaked with ribose 5-phosphate 0.9737 2 147
1nn4-assembly1.cif.gz_A structural genomics, rpib/alsb 0.973 2 146
6fxl-assembly1.cif.gz_B structure of trypanosoma cruzi type b ribose 5-phosphate isomerase (tcrpib) 0.9694 2 150
3ph4-assembly1.cif.gz_A clostridium thermocellum ribose-5-phosphate isomerase b with d-allose 0.9692 1 150
3k7o-assembly1.cif.gz_A-2 structure of type b ribose 5-phosphate isomerase from trypanosoma cruzi 0.9679 2 148
ID Description Score Start End Superfamily
1nn4D00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.972 2 147 3.40.1400.10
3s5pB00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9632 1 129 3.40.1400.10
5ifzB00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9628 1 129 3.40.1400.10
6fxsA00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9607 2 144 3.40.1400.10
af_P9WKD7_1_162_3.40.1400.10 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9571 1 150 3.40.1400.10
ID Description Score Start End GO Terms
AF-A0A2V6T654-F1-model_v4 Glucose-6-phosphate isomerase (EC 5.3.1.9) 0.9925 1 146 GO:0004347
GO:0005829
GO:0006094
GO:0006096
GO:0048029
GO:0051156
GO:0097367
AF-A0A2V6SL96-F1-model_v4 Glucose-6-phosphate isomerase (EC 5.3.1.9) 0.9924 1 146 GO:0004347
GO:0005829
GO:0006094
GO:0006096
GO:0048029
GO:0051156
GO:0097367
AF-A0A7C1V9Z5-F1-model_v4 RpiB/LacA/LacB family sugar-phosphate isomerase 0.9912 15 149 GO:0005975
GO:0016861
AF-A0A8B5WR16-F1-model_v4 RpiB/LacA/LacB family sugar-phosphate isomerase 0.9911 1 149 GO:0005975
GO:0016861
AF-A0A538DK80-F1-model_v4 RpiB/LacA/LacB family sugar-phosphate isomerase 0.991 1 148 GO:0004061
GO:0005975
GO:0016861
GO:0019441

Feature Viewer

pLDDT pTM Quality
95.94 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map