F441671

General Info

Members Datasets Scaffolds Average Seq Length
428 178 856 260

Family's Representative Sequence

Representative Sequence 3300010375|Ga0105239_10160869|Ga0105239_101608693
Length 293
Sequence MILDIPHPAKTGSSGEDRSAPKTKQQFALVENRVRDHNDSMTKTILGVPFFTGTAEEAVQRMLNGGLLVVPAAPALKDIGTHTAYRDALLAADLVITDSAFMVLVWNMLERDNLRRVSGLKYLRLLLRQPEVRQPGQTFWIMAGNKSANMNRNWLLSEGIEVPDEYVYNAPMYGPVIDDRELLERLEELRPAHIVVTIGGGNQERLGHYLRHRLSYVPGIHCIGAAIAFLSGDQVHIPEWADHLFLGWLFRVLDKPKLYFPRYMGATALFGLLARYRSTLPPVEQPIEQNVLN

Samples

Sample ID Description Type Environment
1 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
43 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
72 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
73 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
74 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
122 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
123 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
124 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
125 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
126 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
127 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
128 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
129 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
130 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
131 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
132 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
133 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
134 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
135 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
136 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
137 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
138 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
139 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
140 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
141 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
142 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
143 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
144 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
145 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
146 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
147 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
148 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
149 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
150 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
151 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
152 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
153 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
154 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
155 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
156 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
157 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
158 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
159 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
160 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
161 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
162 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
163 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
164 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
165 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
166 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
167 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
168 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
169 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
170 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
176 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
177 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
178 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.47
Nodule 0
Rhizoplane 3.27
Rhizosphere 93.93
Stem 0
Stem Tuber 0
Unclassified 12.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105239_10160869 3300010375 Bacteria 2508
2 JGI24743J22301_10032634 3300001991 Bacteria 1029
3 rootH2_10072901 3300003320 Bacteria 10975
4 rootH2_10210574 3300003320 Unclassified 2367
5 rootL2_10179801 3300003322 Bacteria 4430
6 rootH1_10312020 3300003323 Unclassified 2290
7 Ga0070658_10020811 3300005327 Bacteria 5256
8 Ga0070658_10265478 3300005327 Unclassified 1459
9 Ga0070683_100030716 3300005329 Bacteria 4880
10 Ga0070683_100035052 3300005329 Bacteria 4587
11 Ga0070683_100091538 3300005329 Bacteria 2856
12 Ga0070670_100003122 3300005331 Bacteria 13714
13 Ga0068869_100004293 3300005334 Bacteria 8848
14 Ga0068869_100142367 3300005334 Bacteria 1852
15 Ga0070666_10011448 3300005335 Bacteria 5567
16 Ga0068868_100000274 3300005338 Bacteria 34709
17 Ga0068868_100011948 3300005338 Bacteria 6334
18 Ga0068868_100014214 3300005338 Bacteria 5862
19 Ga0070660_100271133 3300005339 Bacteria 1387
20 Ga0070661_100004427 3300005344 Bacteria 9684
21 Ga0070661_100035566 3300005344 Unclassified 3617
22 Ga0070661_100411227 3300005344 Unclassified 1071
23 Ga0070668_100047796 3300005347 Bacteria 3290
24 Ga0070675_100026066 3300005354 Bacteria 4689
25 Ga0070671_100001209 3300005355 Bacteria 19343
26 Ga0070673_100009466 3300005364 Bacteria 6539
27 Ga0070673_100512219 3300005364 Unclassified 1086
28 Ga0070667_100008428 3300005367 Bacteria 8550
29 Ga0070667_100016103 3300005367 Bacteria 6185
30 Ga0070667_100289623 3300005367 Bacteria 1472
31 Ga0070713_100004295 3300005436 Bacteria 9547
32 Ga0070713_100094650 3300005436 Bacteria 2575
33 Ga0070711_100047398 3300005439 Bacteria 2934
34 Ga0070663_100002116 3300005455 Bacteria 11123
35 Ga0070663_100007198 3300005455 Bacteria 6760
36 Ga0070663_100019903 3300005455 Bacteria 4433
37 Ga0070663_100104058 3300005455 Unclassified 2123
38 Ga0070678_100007168 3300005456 Bacteria 6595
39 Ga0070662_100215839 3300005457 Bacteria 1528
40 Ga0070681_10291101 3300005458 Bacteria 1543
41 Ga0070681_10723779 3300005458 Bacteria 911
42 Ga0070684_100000592 3300005535 Bacteria 24970
43 Ga0070684_100004516 3300005535 Bacteria 10596
44 Ga0070684_100008155 3300005535 Bacteria 8177
45 Ga0070684_100123225 3300005535 Bacteria 2333
46 Ga0068853_100012590 3300005539 Bacteria 6883
47 Ga0068853_100015497 3300005539 Bacteria 6261
48 Ga0068853_100061855 3300005539 Bacteria 3239
49 Ga0068853_100159698 3300005539 Bacteria 2033
50 Ga0070672_100024822 3300005543 Bacteria 4436
51 Ga0070695_100169346 3300005545 Bacteria 1540
52 Ga0070665_100034793 3300005548 Bacteria 5067
53 Ga0070665_100056057 3300005548 Bacteria 3952
54 Ga0070665_100364034 3300005548 Bacteria 1452
55 Ga0068855_100003330 3300005563 Bacteria 19652
56 Ga0068855_100004904 3300005563 Bacteria 16328
57 Ga0068855_100005333 3300005563 Bacteria 15696
58 Ga0068855_100039411 3300005563 Bacteria 5608
59 Ga0068855_100049136 3300005563 Bacteria 4976
60 Ga0068855_100083733 3300005563 Bacteria 3695
61 Ga0068855_100090733 3300005563 Bacteria 3526
62 Ga0068855_100094985 3300005563 Bacteria 3437
63 Ga0070664_100034466 3300005564 Bacteria 4247
64 Ga0070664_100228717 3300005564 Bacteria 1666
65 Ga0068857_100001191 3300005577 Bacteria 20322
66 Ga0068857_100008616 3300005577 Bacteria 8827
67 Ga0068857_100024053 3300005577 Bacteria 5363
68 Ga0068854_100001734 3300005578 Bacteria 13303
69 Ga0068854_100127926 3300005578 Bacteria 1937
70 Ga0068856_100000684 3300005614 Bacteria 36817
71 Ga0068856_100007587 3300005614 Bacteria 10586
72 Ga0068856_100022379 3300005614 Bacteria 6144
73 Ga0068856_100026195 3300005614 Bacteria 5686
74 Ga0068856_100197508 3300005614 Bacteria 2026
75 Ga0068856_100528879 3300005614 Bacteria 1200
76 Ga0068856_100743799 3300005614 Unclassified 1001
77 Ga0068852_100000026 3300005616 Bacteria 114548
78 Ga0068852_100000162 3300005616 Bacteria 44844
79 Ga0068852_100006915 3300005616 Bacteria 8251
80 Ga0068852_100022019 3300005616 Bacteria 5101
81 Ga0068852_100226255 3300005616 Unclassified 1781
82 Ga0068852_100232952 3300005616 Bacteria 1756
83 Ga0068859_100004532 3300005617 Bacteria 14168
84 Ga0068864_100000489 3300005618 Bacteria 34241
85 Ga0068864_100031998 3300005618 Bacteria 4465
86 Ga0068851_10000898 3300005834 Bacteria 12816
87 Ga0068851_10014470 3300005834 Bacteria 3746
88 Ga0068851_10039490 3300005834 Bacteria 2370
89 Ga0068851_10068762 3300005834 Unclassified 1828
90 Ga0068863_100003404 3300005841 Bacteria 15685
91 Ga0068863_100099900 3300005841 Bacteria 2757
92 Ga0068858_100000718 3300005842 Bacteria 34499
93 Ga0068858_100053743 3300005842 Bacteria 3725
94 Ga0068858_100547484 3300005842 Bacteria 1120
95 Ga0068860_100004073 3300005843 Bacteria 14999
96 Ga0068860_100045055 3300005843 Bacteria 4205
97 Ga0070717_10388395 3300006028 Bacteria 1252
98 Ga0070712_100097454 3300006175 Bacteria 2167
99 Ga0097621_100000090 3300006237 Bacteria 49478
100 Ga0097621_100029517 3300006237 Bacteria 4332
101 Ga0097621_100048822 3300006237 Bacteria 3436
102 Ga0068871_100013809 3300006358 Bacteria 6004
103 Ga0068871_100059586 3300006358 Bacteria 3111
104 Ga0068865_100013180 3300006881 Bacteria 5218
105 Ga0097620_100004532 3300006931 Bacteria 14168
106 Ga0105240_10000002 3300009093 Bacteria 1924170
107 Ga0105240_10000038 3300009093 Bacteria 270341
108 Ga0105240_10000267 3300009093 Bacteria 103103
109 Ga0105240_10015772 3300009093 Bacteria 10253
110 Ga0105240_10015983 3300009093 Bacteria 10174
111 Ga0105240_10019622 3300009093 Bacteria 9030
112 Ga0105240_10023154 3300009093 Bacteria 8223
113 Ga0105240_10047504 3300009093 Bacteria 5432
114 Ga0105240_10064510 3300009093 Bacteria 4550
115 Ga0105240_10196074 3300009093 Bacteria 2371
116 Ga0105240_10204197 3300009093 Bacteria 2314
117 Ga0105245_10000750 3300009098 Bacteria 29290
118 Ga0105245_10024414 3300009098 Bacteria 5308
119 Ga0105245_10036934 3300009098 Bacteria 4342
120 Ga0105245_10289548 3300009098 Bacteria 1604
121 Ga0105247_10003425 3300009101 Bacteria 10354
122 Ga0105247_10028976 3300009101 Bacteria 3352
123 Ga0105247_10227330 3300009101 Bacteria 1265
124 Ga0105243_10080352 3300009148 Bacteria 2659
125 Ga0105241_10002855 3300009174 Bacteria 12900
126 Ga0105241_10004202 3300009174 Bacteria 10639
127 Ga0105241_10022612 3300009174 Bacteria 4658
128 Ga0105241_10050561 3300009174 Bacteria 3168
129 Ga0105241_10072959 3300009174 Bacteria 2669
130 Ga0105241_10076322 3300009174 Bacteria 2613
131 Ga0105241_10409473 3300009174 Bacteria 1191
132 Ga0105242_10335972 3300009176 Unclassified 1391
133 Ga0105248_10000467 3300009177 Bacteria 46062
134 Ga0105248_10005092 3300009177 Bacteria 14501
135 Ga0105248_10066070 3300009177 Bacteria 4061
136 Ga0105248_10126650 3300009177 Bacteria 2881
137 Ga0105248_10330111 3300009177 Bacteria 1718
138 Ga0105237_10023623 3300009545 Bacteria 6296
139 Ga0105237_10148926 3300009545 Bacteria 2336
140 Ga0105237_10159448 3300009545 Bacteria 2254
141 Ga0105237_10168999 3300009545 Bacteria 2186
142 Ga0105237_10212085 3300009545 Bacteria 1936
143 Ga0105237_10216668 3300009545 Bacteria 1914
144 Ga0105237_10397567 3300009545 Bacteria 1383
145 Ga0105238_10000466 3300009551 Bacteria 42492
146 Ga0105238_10000872 3300009551 Bacteria 31125
147 Ga0105238_10006878 3300009551 Bacteria 11358
148 Ga0105238_10019975 3300009551 Bacteria 6819
149 Ga0105238_10031588 3300009551 Bacteria 5391
150 Ga0105238_10050127 3300009551 Unclassified 4203
151 Ga0105238_10054362 3300009551 Bacteria 4021
152 Ga0105238_10094672 3300009551 Bacteria 2974
153 Ga0105238_10160669 3300009551 Bacteria 2222
154 Ga0105238_10405856 3300009551 Bacteria 1356
155 Ga0105249_10096351 3300009553 Bacteria 2776
156 Ga0105239_10004984 3300010375 Bacteria 15679
157 Ga0105239_10006259 3300010375 Bacteria 13840
158 Ga0105239_10027711 3300010375 Bacteria 6234
159 Ga0105239_10029684 3300010375 Bacteria 6012
160 Ga0105239_10125867 3300010375 Bacteria 2848
161 Ga0105239_10274653 3300010375 Bacteria 1896
162 Ga0105239_10287099 3300010375 Bacteria 1853
163 Ga0105246_10002003 3300011119 Bacteria 12298
164 Ga0105246_10016997 3300011119 Bacteria 4619
165 Ga0157371_10359867 3300013102 Unclassified 1060
166 Ga0157370_10000011 3300013104 Bacteria 212362
167 Ga0157370_10023326 3300013104 Bacteria 6144
168 Ga0157370_10097942 3300013104 Unclassified 2751
169 Ga0157370_10135586 3300013104 Bacteria 2294
170 Ga0157369_10000060 3300013105 Bacteria 152332
171 Ga0157369_10000488 3300013105 Bacteria 52650
172 Ga0157369_10001987 3300013105 Bacteria 24613
173 Ga0157369_10002790 3300013105 Bacteria 20848
174 Ga0157369_10014191 3300013105 Bacteria 9000
175 Ga0157369_10016155 3300013105 Bacteria 8403
176 Ga0157369_10041763 3300013105 Bacteria 5005
177 Ga0157369_10059502 3300013105 Bacteria 4119
178 Ga0157369_10074867 3300013105 Bacteria 3631
179 Ga0157369_10225473 3300013105 Bacteria 1960
180 Ga0157369_10244286 3300013105 Bacteria 1874
181 Ga0157369_10791242 3300013105 Unclassified 975
182 Ga0157374_10001832 3300013296 Bacteria 17895
183 Ga0157374_10013157 3300013296 Bacteria 7216
184 Ga0157374_10135393 3300013296 Bacteria 2388
185 Ga0157374_10742535 3300013296 Unclassified 996
186 Ga0157378_10007414 3300013297 Bacteria 9584
187 Ga0157378_10010498 3300013297 Bacteria 8091
188 Ga0157378_10022344 3300013297 Bacteria 5568
189 Ga0157378_10031403 3300013297 Bacteria 4692
190 Ga0157378_10108648 3300013297 Bacteria 2540
191 Ga0163162_10101556 3300013306 Bacteria 2968
192 Ga0163162_10290838 3300013306 Bacteria 1766
193 Ga0163162_10595350 3300013306 Unclassified 1232
194 Ga0157372_10000240 3300013307 Bacteria 60611
195 Ga0157372_10002911 3300013307 Bacteria 18522
196 Ga0157372_10003111 3300013307 Bacteria 17889
197 Ga0157372_10006449 3300013307 Bacteria 12494
198 Ga0157372_10008746 3300013307 Bacteria 10751
199 Ga0157372_10016003 3300013307 Bacteria 8046
200 Ga0157372_10018789 3300013307 Bacteria 7435
201 Ga0157372_10039523 3300013307 Bacteria 5207
202 Ga0157372_10061009 3300013307 Bacteria 4221
203 Ga0157372_10100548 3300013307 Bacteria 3300
204 Ga0157372_10258131 3300013307 Bacteria 2023
205 Ga0157372_11195959 3300013307 Unclassified 878
206 Ga0157375_10004564 3300013308 Bacteria 12031
207 Ga0157375_10071295 3300013308 Unclassified 3487
208 Ga0157375_10354381 3300013308 Bacteria 1633
209 Ga0157375_10763017 3300013308 Unclassified 1118
210 Ga0163163_10001965 3300014325 Bacteria 17374
211 Ga0163163_10338159 3300014325 Bacteria 1560
212 Ga0157377_10038778 3300014745 Bacteria 2632
213 Ga0157379_10001276 3300014968 Bacteria 20470
214 Ga0157379_10001568 3300014968 Bacteria 18830
215 Ga0157379_10009740 3300014968 Bacteria 8371
216 Ga0157379_10054157 3300014968 Bacteria 3585
217 Ga0157379_10099852 3300014968 Bacteria 2606
218 Ga0157376_10015146 3300014969 Bacteria 5814
219 Ga0157376_10035034 3300014969 Bacteria 4058
220 Ga0157376_10047132 3300014969 Bacteria 3557
221 Ga0157376_10116722 3300014969 Bacteria 2359
222 Ga0157376_10213844 3300014969 Bacteria 1782
223 Ga0157376_10470413 3300014969 Bacteria 1230
224 Ga0213872_10008741 3300021361 Bacteria 4889
225 Ga0213871_10030689 3300021441 Bacteria 1400
226 Ga0207426_1021319 3300025302 Bacteria 2241
227 Ga0207697_10010576 3300025315 Bacteria 3939
228 Ga0207656_10006439 3300025321 Bacteria 4222
229 Ga0207656_10020790 3300025321 Unclassified 2612
230 Ga0207656_10065224 3300025321 Bacteria 1607
231 Ga0207710_10000944 3300025900 Bacteria 15386
232 Ga0207688_10058349 3300025901 Bacteria 2172
233 Ga0207647_10028573 3300025904 Bacteria 3620
234 Ga0207647_10213800 3300025904 Bacteria 1113
235 Ga0207645_10007109 3300025907 Bacteria 7947
236 Ga0207705_10008480 3300025909 Bacteria 7500
237 Ga0207654_10000728 3300025911 Bacteria 18352
238 Ga0207654_10002174 3300025911 Bacteria 10042
239 Ga0207654_10055211 3300025911 Bacteria 2299
240 Ga0207654_10088745 3300025911 Bacteria 1880
241 Ga0207654_10206548 3300025911 Unclassified 1296
242 Ga0207654_10240915 3300025911 Bacteria 1208
243 Ga0207654_10377133 3300025911 Bacteria 982
244 Ga0207695_10000002 3300025913 Bacteria 2188391
245 Ga0207695_10000030 3300025913 Bacteria 533735
246 Ga0207695_10000070 3300025913 Bacteria 318111
247 Ga0207695_10000669 3300025913 Bacteria 67530
248 Ga0207695_10002576 3300025913 Bacteria 26614
249 Ga0207695_10013946 3300025913 Bacteria 9553
250 Ga0207695_10109897 3300025913 Bacteria 2738
251 Ga0207695_10144766 3300025913 Bacteria 2322
252 Ga0207695_10196617 3300025913 Bacteria 1932
253 Ga0207695_10387223 3300025913 Bacteria 1283
254 Ga0207671_10000071 3300025914 Bacteria 159699
255 Ga0207671_10003485 3300025914 Bacteria 15653
256 Ga0207671_10098797 3300025914 Bacteria 2208
257 Ga0207671_10131512 3300025914 Bacteria 1921
258 Ga0207671_10134378 3300025914 Bacteria 1901
259 Ga0207693_10002494 3300025915 Bacteria 16013
260 Ga0207663_10085357 3300025916 Bacteria 2079
261 Ga0207649_10004369 3300025920 Bacteria 7670
262 Ga0207649_10322478 3300025920 Bacteria 1135
263 Ga0207652_10308120 3300025921 Bacteria 1429
264 Ga0207694_10000192 3300025924 Bacteria 61988
265 Ga0207694_10000859 3300025924 Bacteria 27018
266 Ga0207694_10002709 3300025924 Bacteria 14345
267 Ga0207694_10049487 3300025924 Bacteria 3254
268 Ga0207694_10100459 3300025924 Bacteria 2292
269 Ga0207694_10285696 3300025924 Bacteria 1356
270 Ga0207650_10001389 3300025925 Bacteria 17468
271 Ga0207687_10090238 3300025927 Bacteria 2233
272 Ga0207700_10014471 3300025928 Bacteria 5169
273 Ga0207664_10006286 3300025929 Bacteria 8163
274 Ga0207644_10125290 3300025931 Bacteria 1960
275 Ga0207706_10020647 3300025933 Bacteria 5919
276 Ga0207704_10116296 3300025938 Bacteria 1819
277 Ga0207691_10013303 3300025940 Bacteria 7884
278 Ga0207711_10000008 3300025941 Bacteria 597686
279 Ga0207711_10006019 3300025941 Bacteria 10250
280 Ga0207711_10021748 3300025941 Bacteria 5357
281 Ga0207711_10210698 3300025941 Bacteria 1775
282 Ga0207689_10004353 3300025942 Bacteria 12896
283 Ga0207689_10025824 3300025942 Bacteria 4921
284 Ga0207661_10019923 3300025944 Bacteria 5007
285 Ga0207661_10048202 3300025944 Bacteria 3384
286 Ga0207661_10058322 3300025944 Bacteria 3106
287 Ga0207661_10082453 3300025944 Bacteria 2659
288 Ga0207661_10127573 3300025944 Unclassified 2174
289 Ga0207679_10197785 3300025945 Bacteria 1677
290 Ga0207679_10586876 3300025945 Unclassified 1003
291 Ga0207667_10000815 3300025949 Bacteria 40351
292 Ga0207667_10004349 3300025949 Bacteria 17348
293 Ga0207667_10005775 3300025949 Bacteria 15097
294 Ga0207667_10012737 3300025949 Bacteria 9660
295 Ga0207667_10038764 3300025949 Bacteria 5083
296 Ga0207667_10610106 3300025949 Bacteria 1099
297 Ga0207651_10038671 3300025960 Bacteria 3138
298 Ga0207712_10045433 3300025961 Bacteria 3041
299 Ga0207712_10055971 3300025961 Bacteria 2777
300 Ga0207668_10046492 3300025972 Bacteria 2966
301 Ga0207640_10003989 3300025981 Bacteria 7971
302 Ga0207640_10072074 3300025981 Unclassified 2329
303 Ga0207640_10423781 3300025981 Unclassified 1090
304 Ga0207658_10001530 3300025986 Bacteria 17971
305 Ga0207677_10000986 3300026023 Bacteria 15683
306 Ga0207677_10219570 3300026023 Bacteria 1524
307 Ga0207703_10455217 3300026035 Bacteria 1196
308 Ga0207639_10000113 3300026041 Bacteria 62522
309 Ga0207639_10027709 3300026041 Bacteria 4130
310 Ga0207639_10039445 3300026041 Bacteria 3519
311 Ga0207639_10090510 3300026041 Bacteria 2447
312 Ga0207678_10005347 3300026067 Bacteria 11497
313 Ga0207678_10006424 3300026067 Bacteria 10430
314 Ga0207678_10145490 3300026067 Bacteria 2023
315 Ga0207678_10516945 3300026067 Bacteria 1042
316 Ga0207702_10004799 3300026078 Bacteria 11917
317 Ga0207702_10005318 3300026078 Bacteria 11293
318 Ga0207702_10005718 3300026078 Bacteria 10840
319 Ga0207702_10009127 3300026078 Bacteria 8348
320 Ga0207702_10099817 3300026078 Bacteria 2560
321 Ga0207702_11040399 3300026078 Bacteria 812
322 Ga0207641_10001559 3300026088 Bacteria 22459
323 Ga0207641_10293181 3300026088 Unclassified 1534
324 Ga0207674_10000764 3300026116 Bacteria 42010
325 Ga0207674_10003289 3300026116 Bacteria 19873
326 Ga0207674_10093343 3300026116 Unclassified 2998
327 Ga0207675_100208077 3300026118 Bacteria 1881
328 Ga0207683_10005047 3300026121 Bacteria 11332
329 Ga0207698_10000010 3300026142 Bacteria 270583
330 Ga0207698_10000273 3300026142 Bacteria 31333
331 Ga0207698_10010747 3300026142 Bacteria 5905
332 Ga0207698_10016803 3300026142 Bacteria 4945
333 Ga0207698_10093962 3300026142 Bacteria 2464
334 Ga0209588_1001517 3300027671 Bacteria 6117
335 Ga0268266_10030811 3300028379 Bacteria 4555
336 Ga0268266_10099744 3300028379 Bacteria 2557
337 Ga0268265_10776250 3300028380 Bacteria 932
338 Ga0268264_10000331 3300028381 Bacteria 73935
339 Ga0268264_10156479 3300028381 Bacteria 2049
340 Ga0265337_1003984 3300028556 Bacteria 6248
341 Ga0265334_10009172 3300028573 Unclassified 4191
342 Ga0265322_10012066 3300028654 Bacteria 2500
343 Ga0265336_10014792 3300028666 Bacteria 2579
344 Ga0265338_10000914 3300028800 Bacteria 49757
345 Ga0265338_10001350 3300028800 Bacteria 39984
346 Ga0265338_10192180 3300028800 Unclassified 1546
347 Ga0265338_10252318 3300028800 Bacteria 1301
348 Ga0265330_10000704 3300031235 Bacteria 21206
349 Ga0265330_10062680 3300031235 Bacteria 1616
350 Ga0265328_10009411 3300031239 Bacteria 3981
351 Ga0265325_10001139 3300031241 Bacteria 19089
352 Ga0265340_10021026 3300031247 Bacteria 3348
353 Ga0265340_10128078 3300031247 Unclassified 1165
354 Ga0265339_10000029 3300031249 Bacteria 139089
355 Ga0265339_10020090 3300031249 Unclassified 3907
356 Ga0265339_10099260 3300031249 Bacteria 1518
357 Ga0265339_10193124 3300031249 Unclassified 1008
358 Ga0265327_10000403 3300031251 Bacteria 80871
359 Ga0265316_10027265 3300031344 Bacteria 4734
360 Ga0265316_10045421 3300031344 Bacteria 3487
361 Ga0265342_10000688 3300031712 Bacteria 35355
362 Ga0265342_10002940 3300031712 Bacteria 14326
363 Ga0265342_10145779 3300031712 Bacteria 1318
364 Ga0265342_10149079 3300031712 Bacteria 1300
365 Ga0373937_0008149 3300036401 Bacteria 9098
366 Ga0373937_0377282 3300036401 Unclassified 1345
367 Ga0395898_0192593 3300037466 Bacteria 1948
368 Ga0395898_0282883 3300037466 Unclassified 1582
369 Ga0436364_0702450 3300037853 Unclassified 2565
370 Ga0436365_0115427 3300039437 Unclassified 984
371 Ga0436360_0204520 3300039438 Bacteria 8806
372 Ga0436361_0324465 3300039447 Bacteria 7177
373 Ga0436361_0786173 3300039447 Bacteria 5619
374 Ga0436363_1302326 3300039450 Unclassified 1167
375 Ga0466963_0095568 3300044694 Bacteria 2028
376 Ga0466957_0294654 3300044842 Bacteria 1089
377 Ga0466959_0100473 3300045049 Bacteria 2071
378 Ga0466967_0004773 3300045976 Bacteria 9231
379 Ga0495592_0124686 3300046454 Bacteria 1809
380 Ga0495629_0018004 3300046459 Bacteria 5064
381 Ga0495629_0084362 3300046459 Bacteria 2217
382 Ga0495651_0085397 3300046462 Bacteria 2377
383 Ga0495628_0334483 3300046516 Unclassified 1116
384 Ga0495652_0107633 3300046529 Unclassified 2249
385 Ga0495652_0255556 3300046529 Bacteria 1296
386 Ga0495640_0204652 3300046533 Unclassified 1250
387 Ga0495640_0329281 3300046533 Unclassified 945
388 Ga0495587_0012106 3300046536 Bacteria 5447
389 Ga0495645_0005957 3300046543 Bacteria 8427
390 Ga0495645_0018465 3300046543 Bacteria 5008
391 Ga0495623_0091755 3300046679 Bacteria 1863
392 Ga0495613_0266470 3300046689 Unclassified 1192
393 Ga0495600_0158840 3300046809 Bacteria 1462
394 Ga0495604_0198772 3300047317 Bacteria 1392
395 Ga0495684_0071085 3300047471 Bacteria 2645
396 Ga0495684_0094138 3300047471 Bacteria 2269
397 Ga0495684_0152820 3300047471 Bacteria 1725
398 Ga0495686_0000610 3300047472 Bacteria 49508
399 Ga0495602_0101907 3300048088 Unclassified 2354
400 Ga0495602_0143043 3300048088 Bacteria 1891
401 Ga0495602_0158623 3300048088 Unclassified 1769
402 Ga0496100_0066429 3300048903 Bacteria 2392
403 Ga0496101_0111467 3300048904 Bacteria 2060
404 Ga0496102_0004972 3300048905 Bacteria 11257
405 Ga0496102_0427544 3300048905 Bacteria 1244
406 Ga0496104_0012480 3300048907 Bacteria 7642
407 Ga0496104_0026389 3300048907 Bacteria 5364
408 Ga0496104_0413963 3300048907 Unclassified 1260
409 Ga0496105_0173109 3300048908 Bacteria 1769
410 Ga0496105_0193784 3300048908 Unclassified 1661
411 Ga0496106_0042032 3300048909 Bacteria 3427
412 Ga0496107_0133287 3300048910 Bacteria 1835
413 Ga0496114_0123912 3300048917 Bacteria 2225
414 Ga0496115_0131822 3300048918 Bacteria 2060
415 Ga0496115_0177892 3300048918 Bacteria 1759
416 Ga0496126_0000183 3300048929 Bacteria 140790
417 Ga0496126_0001522 3300048929 Bacteria 35736
418 Ga0496126_0130477 3300048929 Bacteria 2172
419 Ga0501032_0109678 3300049569 Bacteria 1827
420 Ga0501033_0143368 3300049570 Bacteria 1727
421 Ga0501033_0164104 3300049570 Unclassified 1598
422 Ga0501037_0420356 3300049573 Unclassified 915
423 Ga0501043_0426187 3300049579 Unclassified 1000
424 Ga0501035_0029801 3300049822 Bacteria 4977
425 Ga0501044_0041812 3300049823 Bacteria 4771
426 Ga0495601_0036629 3300053077 Unclassified 3065
427 Ga0495619_0050891 3300053085 Bacteria 2736
428 Ga0500644_0010918 3300053088 Unclassified 2469
429 Ga0105239_10160869
430 JGI24743J22301_10032634
431 rootH2_10072901
432 rootH2_10210574
433 rootL2_10179801
434 rootH1_10312020
435 Ga0070658_10020811
436 Ga0070658_10265478
437 Ga0070683_100030716
438 Ga0070683_100035052
439 Ga0070683_100091538
440 Ga0070670_100003122
441 Ga0068869_100004293
442 Ga0068869_100142367
443 Ga0070666_10011448
444 Ga0068868_100000274
445 Ga0068868_100011948
446 Ga0068868_100014214
447 Ga0070660_100271133
448 Ga0070661_100004427
449 Ga0070661_100035566
450 Ga0070661_100411227
451 Ga0070668_100047796
452 Ga0070675_100026066
453 Ga0070671_100001209
454 Ga0070673_100009466
455 Ga0070673_100512219
456 Ga0070667_100008428
457 Ga0070667_100016103
458 Ga0070667_100289623
459 Ga0070713_100004295
460 Ga0070713_100094650
461 Ga0070711_100047398
462 Ga0070663_100002116
463 Ga0070663_100007198
464 Ga0070663_100019903
465 Ga0070663_100104058
466 Ga0070678_100007168
467 Ga0070662_100215839
468 Ga0070681_10291101
469 Ga0070681_10723779
470 Ga0070684_100000592
471 Ga0070684_100004516
472 Ga0070684_100008155
473 Ga0070684_100123225
474 Ga0068853_100012590
475 Ga0068853_100015497
476 Ga0068853_100061855
477 Ga0068853_100159698
478 Ga0070672_100024822
479 Ga0070695_100169346
480 Ga0070665_100034793
481 Ga0070665_100056057
482 Ga0070665_100364034
483 Ga0068855_100003330
484 Ga0068855_100004904
485 Ga0068855_100005333
486 Ga0068855_100039411
487 Ga0068855_100049136
488 Ga0068855_100083733
489 Ga0068855_100090733
490 Ga0068855_100094985
491 Ga0070664_100034466
492 Ga0070664_100228717
493 Ga0068857_100001191
494 Ga0068857_100008616
495 Ga0068857_100024053
496 Ga0068854_100001734
497 Ga0068854_100127926
498 Ga0068856_100000684
499 Ga0068856_100007587
500 Ga0068856_100022379
501 Ga0068856_100026195
502 Ga0068856_100197508
503 Ga0068856_100528879
504 Ga0068856_100743799
505 Ga0068852_100000026
506 Ga0068852_100000162
507 Ga0068852_100006915
508 Ga0068852_100022019
509 Ga0068852_100226255
510 Ga0068852_100232952
511 Ga0068859_100004532
512 Ga0068864_100000489
513 Ga0068864_100031998
514 Ga0068851_10000898
515 Ga0068851_10014470
516 Ga0068851_10039490
517 Ga0068851_10068762
518 Ga0068863_100003404
519 Ga0068863_100099900
520 Ga0068858_100000718
521 Ga0068858_100053743
522 Ga0068858_100547484
523 Ga0068860_100004073
524 Ga0068860_100045055
525 Ga0070717_10388395
526 Ga0070712_100097454
527 Ga0097621_100000090
528 Ga0097621_100029517
529 Ga0097621_100048822
530 Ga0068871_100013809
531 Ga0068871_100059586
532 Ga0068865_100013180
533 Ga0097620_100004532
534 Ga0105240_10000002
535 Ga0105240_10000038
536 Ga0105240_10000267
537 Ga0105240_10015772
538 Ga0105240_10015983
539 Ga0105240_10019622
540 Ga0105240_10023154
541 Ga0105240_10047504
542 Ga0105240_10064510
543 Ga0105240_10196074
544 Ga0105240_10204197
545 Ga0105245_10000750
546 Ga0105245_10024414
547 Ga0105245_10036934
548 Ga0105245_10289548
549 Ga0105247_10003425
550 Ga0105247_10028976
551 Ga0105247_10227330
552 Ga0105243_10080352
553 Ga0105241_10002855
554 Ga0105241_10004202
555 Ga0105241_10022612
556 Ga0105241_10050561
557 Ga0105241_10072959
558 Ga0105241_10076322
559 Ga0105241_10409473
560 Ga0105242_10335972
561 Ga0105248_10000467
562 Ga0105248_10005092
563 Ga0105248_10066070
564 Ga0105248_10126650
565 Ga0105248_10330111
566 Ga0105237_10023623
567 Ga0105237_10148926
568 Ga0105237_10159448
569 Ga0105237_10168999
570 Ga0105237_10212085
571 Ga0105237_10216668
572 Ga0105237_10397567
573 Ga0105238_10000466
574 Ga0105238_10000872
575 Ga0105238_10006878
576 Ga0105238_10019975
577 Ga0105238_10031588
578 Ga0105238_10050127
579 Ga0105238_10054362
580 Ga0105238_10094672
581 Ga0105238_10160669
582 Ga0105238_10405856
583 Ga0105249_10096351
584 Ga0105239_10004984
585 Ga0105239_10006259
586 Ga0105239_10027711
587 Ga0105239_10029684
588 Ga0105239_10125867
589 Ga0105239_10274653
590 Ga0105239_10287099
591 Ga0105246_10002003
592 Ga0105246_10016997
593 Ga0157371_10359867
594 Ga0157370_10000011
595 Ga0157370_10023326
596 Ga0157370_10097942
597 Ga0157370_10135586
598 Ga0157369_10000060
599 Ga0157369_10000488
600 Ga0157369_10001987
601 Ga0157369_10002790
602 Ga0157369_10014191
603 Ga0157369_10016155
604 Ga0157369_10041763
605 Ga0157369_10059502
606 Ga0157369_10074867
607 Ga0157369_10225473
608 Ga0157369_10244286
609 Ga0157369_10791242
610 Ga0157374_10001832
611 Ga0157374_10013157
612 Ga0157374_10135393
613 Ga0157374_10742535
614 Ga0157378_10007414
615 Ga0157378_10010498
616 Ga0157378_10022344
617 Ga0157378_10031403
618 Ga0157378_10108648
619 Ga0163162_10101556
620 Ga0163162_10290838
621 Ga0163162_10595350
622 Ga0157372_10000240
623 Ga0157372_10002911
624 Ga0157372_10003111
625 Ga0157372_10006449
626 Ga0157372_10008746
627 Ga0157372_10016003
628 Ga0157372_10018789
629 Ga0157372_10039523
630 Ga0157372_10061009
631 Ga0157372_10100548
632 Ga0157372_10258131
633 Ga0157372_11195959
634 Ga0157375_10004564
635 Ga0157375_10071295
636 Ga0157375_10354381
637 Ga0157375_10763017
638 Ga0163163_10001965
639 Ga0163163_10338159
640 Ga0157377_10038778
641 Ga0157379_10001276
642 Ga0157379_10001568
643 Ga0157379_10009740
644 Ga0157379_10054157
645 Ga0157379_10099852
646 Ga0157376_10015146
647 Ga0157376_10035034
648 Ga0157376_10047132
649 Ga0157376_10116722
650 Ga0157376_10213844
651 Ga0157376_10470413
652 Ga0213872_10008741
653 Ga0213871_10030689
654 Ga0207426_1021319
655 Ga0207697_10010576
656 Ga0207656_10006439
657 Ga0207656_10020790
658 Ga0207656_10065224
659 Ga0207710_10000944
660 Ga0207688_10058349
661 Ga0207647_10028573
662 Ga0207647_10213800
663 Ga0207645_10007109
664 Ga0207705_10008480
665 Ga0207654_10000728
666 Ga0207654_10002174
667 Ga0207654_10055211
668 Ga0207654_10088745
669 Ga0207654_10206548
670 Ga0207654_10240915
671 Ga0207654_10377133
672 Ga0207695_10000002
673 Ga0207695_10000030
674 Ga0207695_10000070
675 Ga0207695_10000669
676 Ga0207695_10002576
677 Ga0207695_10013946
678 Ga0207695_10109897
679 Ga0207695_10144766
680 Ga0207695_10196617
681 Ga0207695_10387223
682 Ga0207671_10000071
683 Ga0207671_10003485
684 Ga0207671_10098797
685 Ga0207671_10131512
686 Ga0207671_10134378
687 Ga0207693_10002494
688 Ga0207663_10085357
689 Ga0207649_10004369
690 Ga0207649_10322478
691 Ga0207652_10308120
692 Ga0207694_10000192
693 Ga0207694_10000859
694 Ga0207694_10002709
695 Ga0207694_10049487
696 Ga0207694_10100459
697 Ga0207694_10285696
698 Ga0207650_10001389
699 Ga0207687_10090238
700 Ga0207700_10014471
701 Ga0207664_10006286
702 Ga0207644_10125290
703 Ga0207706_10020647
704 Ga0207704_10116296
705 Ga0207691_10013303
706 Ga0207711_10000008
707 Ga0207711_10006019
708 Ga0207711_10021748
709 Ga0207711_10210698
710 Ga0207689_10004353
711 Ga0207689_10025824
712 Ga0207661_10019923
713 Ga0207661_10048202
714 Ga0207661_10058322
715 Ga0207661_10082453
716 Ga0207661_10127573
717 Ga0207679_10197785
718 Ga0207679_10586876
719 Ga0207667_10000815
720 Ga0207667_10004349
721 Ga0207667_10005775
722 Ga0207667_10012737
723 Ga0207667_10038764
724 Ga0207667_10610106
725 Ga0207651_10038671
726 Ga0207712_10045433
727 Ga0207712_10055971
728 Ga0207668_10046492
729 Ga0207640_10003989
730 Ga0207640_10072074
731 Ga0207640_10423781
732 Ga0207658_10001530
733 Ga0207677_10000986
734 Ga0207677_10219570
735 Ga0207703_10455217
736 Ga0207639_10000113
737 Ga0207639_10027709
738 Ga0207639_10039445
739 Ga0207639_10090510
740 Ga0207678_10005347
741 Ga0207678_10006424
742 Ga0207678_10145490
743 Ga0207678_10516945
744 Ga0207702_10004799
745 Ga0207702_10005318
746 Ga0207702_10005718
747 Ga0207702_10009127
748 Ga0207702_10099817
749 Ga0207702_11040399
750 Ga0207641_10001559
751 Ga0207641_10293181
752 Ga0207674_10000764
753 Ga0207674_10003289
754 Ga0207674_10093343
755 Ga0207675_100208077
756 Ga0207683_10005047
757 Ga0207698_10000010
758 Ga0207698_10000273
759 Ga0207698_10010747
760 Ga0207698_10016803
761 Ga0207698_10093962
762 Ga0209588_1001517
763 Ga0268266_10030811
764 Ga0268266_10099744
765 Ga0268265_10776250
766 Ga0268264_10000331
767 Ga0268264_10156479
768 Ga0265337_1003984
769 Ga0265334_10009172
770 Ga0265322_10012066
771 Ga0265336_10014792
772 Ga0265338_10000914
773 Ga0265338_10001350
774 Ga0265338_10192180
775 Ga0265338_10252318
776 Ga0265330_10000704
777 Ga0265330_10062680
778 Ga0265328_10009411
779 Ga0265325_10001139
780 Ga0265340_10021026
781 Ga0265340_10128078
782 Ga0265339_10000029
783 Ga0265339_10020090
784 Ga0265339_10099260
785 Ga0265339_10193124
786 Ga0265327_10000403
787 Ga0265316_10027265
788 Ga0265316_10045421
789 Ga0265342_10000688
790 Ga0265342_10002940
791 Ga0265342_10145779
792 Ga0265342_10149079
793 Ga0373937_0008149
794 Ga0373937_0377282
795 Ga0395898_0192593
796 Ga0395898_0282883
797 Ga0436364_0702450
798 Ga0436365_0115427
799 Ga0436360_0204520
800 Ga0436361_0324465
801 Ga0436361_0786173
802 Ga0436363_1302326
803 Ga0466963_0095568
804 Ga0466957_0294654
805 Ga0466959_0100473
806 Ga0466967_0004773
807 Ga0495592_0124686
808 Ga0495629_0018004
809 Ga0495629_0084362
810 Ga0495651_0085397
811 Ga0495628_0334483
812 Ga0495652_0107633
813 Ga0495652_0255556
814 Ga0495640_0204652
815 Ga0495640_0329281
816 Ga0495587_0012106
817 Ga0495645_0005957
818 Ga0495645_0018465
819 Ga0495623_0091755
820 Ga0495613_0266470
821 Ga0495600_0158840
822 Ga0495604_0198772
823 Ga0495684_0071085
824 Ga0495684_0094138
825 Ga0495684_0152820
826 Ga0495686_0000610
827 Ga0495602_0101907
828 Ga0495602_0143043
829 Ga0495602_0158623
830 Ga0496100_0066429
831 Ga0496101_0111467
832 Ga0496102_0004972
833 Ga0496102_0427544
834 Ga0496104_0012480
835 Ga0496104_0026389
836 Ga0496104_0413963
837 Ga0496105_0173109
838 Ga0496105_0193784
839 Ga0496106_0042032
840 Ga0496107_0133287
841 Ga0496114_0123912
842 Ga0496115_0131822
843 Ga0496115_0177892
844 Ga0496126_0000183
845 Ga0496126_0001522
846 Ga0496126_0130477
847 Ga0501032_0109678
848 Ga0501033_0143368
849 Ga0501033_0164104
850 Ga0501037_0420356
851 Ga0501043_0426187
852 Ga0501035_0029801
853 Ga0501044_0041812
854 Ga0495601_0036629
855 Ga0495619_0050891
856 Ga0500644_0010918

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03808

Glyco_tran_WecG

Glycosyl transferase WecG/TagA/CpsF family

92

263

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
5wfg-assembly2.cif.gz_E crystal structure of the tara wall teichoic acid glycosyltransferase bound to udp 0.7574 7 197
5wfg-assembly2.cif.gz_D crystal structure of the tara wall teichoic acid glycosyltransferase bound to udp 0.7539 9 197
5wfg-assembly1.cif.gz_C crystal structure of the tara wall teichoic acid glycosyltransferase bound to udp 0.7529 9 197
7n41-assembly2.cif.gz_B crystal structure of taga with udp-mannac 0.751 7 201
5wfg-assembly2.cif.gz_E crystal structure of the tara wall teichoic acid glycosyltransferase bound to udp 0.7439 7 197
ID Description Score Start End Superfamily
2i7vA01 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8281 145 186 3.60.15.10
af_Q2G2L3_69_233_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.769 61 223 3.40.50.2300
af_Q2G2L3_69_233_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.7324 61 223 3.40.50.2300
af_P27836_65_232_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.726 57 228 3.40.50.2300
af_P27836_65_232_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.719 57 228 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A4R7S2E2-F1-model_v4 UDP-N-acetyl-D-mannosaminuronic acid transferase (WecB/TagA/CpsF family) 0.9755 7 247 GO:0009058
GO:0016758
AF-A0A7Y5RD58-F1-model_v4 WecB/TagA/CpsF family glycosyltransferase 0.9712 7 256 GO:0009058
GO:0016758
AF-A0A354RBI8-F1-model_v4 Glycosyltransferase 0.963 8 248 GO:0009058
GO:0016758
AF-A0A521XSS1-F1-model_v4 Glycosyltransferase 0.961 7 239 GO:0009058
GO:0016758
AF-A0A2V6L6W3-F1-model_v4 Glycosyltransferase 0.9599 7 251 GO:0009058
GO:0016758

Map