F441659

General Info

Members Datasets Scaffolds Average Seq Length
428 236 856 130

Family's Representative Sequence

Representative Sequence 3300009101|Ga0105247_11238740|Ga0105247_112387402
Length 132
Sequence MIEKRRSTIQGWGVFATQPITKNTRIIEYTGEKINRKETKRRGDGHITYLFTLNDYWTLDGSVGGSGAEIINHSCAPNIRAWNFHEHILYMSKRVIERGEELTVDYRFSKDVERVPCLCGAKTCRGTINLLK

Samples

Sample ID Description Type Environment
1 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
133 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
136 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
137 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
138 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
139 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
140 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
141 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
142 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
143 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
144 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
145 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
146 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
147 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
148 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
149 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
150 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
151 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
152 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
153 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
154 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
155 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
156 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
157 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
158 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
159 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
160 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
161 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
162 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
163 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
164 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
165 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
166 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
167 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
168 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
169 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
170 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
171 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
172 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
173 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
174 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
175 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
176 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
177 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
178 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
179 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
180 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
181 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
182 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
183 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
184 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
185 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
186 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
187 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
188 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
189 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
190 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
191 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
192 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
193 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
194 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
195 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
196 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
197 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
198 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
199 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
200 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
201 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
202 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
203 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
204 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
205 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
206 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
207 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
208 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
209 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
210 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
211 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
212 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
213 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
214 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
215 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
216 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
217 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
218 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
219 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
223 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
224 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
226 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
227 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
228 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
229 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
230 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
231 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
232 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
233 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
234 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
235 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
236 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.14
Rhizosphere 94.39
Stem 0
Stem Tuber 0
Unclassified 32.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105247_11238740 3300009101 Bacteria 596
2 SwRhRL2b_contig_1506194 2162886007 Bacteria 830
3 Ga0065704_10053767 3300005289 Bacteria 630
4 Ga0065712_10503742 3300005290 Unclassified 647
5 Ga0065712_10768579 3300005290 Unclassified 522
6 Ga0065707_11005543 3300005295 Unclassified 538
7 Ga0070658_10123961 3300005327 Bacteria 2149
8 Ga0070683_101212467 3300005329 Unclassified 725
9 Ga0070690_100098559 3300005330 Unclassified 1934
10 Ga0070670_100124357 3300005331 Unclassified 2226
11 Ga0070677_10662205 3300005333 Unclassified 584
12 Ga0070666_10049577 3300005335 Bacteria 2822
13 Ga0070666_10275219 3300005335 Bacteria 1196
14 Ga0070666_10970524 3300005335 Bacteria 630
15 Ga0070680_101480420 3300005336 Unclassified 588
16 Ga0068868_100106560 3300005338 Bacteria 2274
17 Ga0070660_100113189 3300005339 Unclassified 2160
18 Ga0070689_100506587 3300005340 Unclassified 1035
19 Ga0070689_101539819 3300005340 Unclassified 603
20 Ga0070687_100021073 3300005343 Bacteria 3057
21 Ga0070692_11349684 3300005345 Bacteria 513
22 Ga0070671_100675920 3300005355 Bacteria 895
23 Ga0070674_100023385 3300005356 Unclassified 3999
24 Ga0070674_100050538 3300005356 Bacteria 2862
25 Ga0070674_100181684 3300005356 Bacteria 1612
26 Ga0070674_100271243 3300005356 Bacteria 1341
27 Ga0070674_100920157 3300005356 Bacteria 763
28 Ga0070673_100255247 3300005364 Unclassified 1530
29 Ga0070673_100476511 3300005364 Bacteria 1126
30 Ga0070673_101949896 3300005364 Unclassified 557
31 Ga0070688_101162560 3300005365 Unclassified 619
32 Ga0070659_100056027 3300005366 Unclassified 3108
33 Ga0070659_100424446 3300005366 Bacteria 1125
34 Ga0070659_100776816 3300005366 Unclassified 832
35 Ga0070667_100841194 3300005367 Unclassified 853
36 Ga0070667_101460010 3300005367 Bacteria 642
37 Ga0070714_100014777 3300005435 Bacteria 6273
38 Ga0070713_100133464 3300005436 Bacteria 2191
39 Ga0070708_100888025 3300005445 Bacteria 837
40 Ga0070678_100251176 3300005456 Bacteria 1483
41 Ga0070662_100125531 3300005457 Unclassified 1972
42 Ga0070681_10702856 3300005458 Bacteria 927
43 Ga0068867_100021130 3300005459 Bacteria 4643
44 Ga0068867_100287264 3300005459 Unclassified 1351
45 Ga0068867_101411798 3300005459 Unclassified 646
46 Ga0070707_100119759 3300005468 Bacteria 2555
47 Ga0070698_100185669 3300005471 Bacteria 2017
48 Ga0070698_100266477 3300005471 Bacteria 1645
49 Ga0070699_100609254 3300005518 Bacteria 996
50 Ga0070679_100245939 3300005530 Unclassified 1745
51 Ga0070697_100090728 3300005536 Bacteria 2526
52 Ga0070697_101811437 3300005536 Unclassified 546
53 Ga0068853_100082887 3300005539 Unclassified 2809
54 Ga0068853_100759857 3300005539 Unclassified 927
55 Ga0068853_100940922 3300005539 Unclassified 831
56 Ga0070672_100204288 3300005543 Bacteria 1653
57 Ga0070672_100534805 3300005543 Unclassified 1016
58 Ga0070686_100010181 3300005544 Bacteria 5291
59 Ga0070686_100162569 3300005544 Bacteria 1573
60 Ga0070695_100125357 3300005545 Unclassified 1763
61 Ga0070693_100259658 3300005547 Unclassified 1155
62 Ga0070665_100013780 3300005548 Bacteria 8134
63 Ga0070665_101515475 3300005548 Unclassified 679
64 Ga0068855_100111238 3300005563 Unclassified 3144
65 Ga0070664_101135953 3300005564 Bacteria 736
66 Ga0070664_102213509 3300005564 Unclassified 522
67 Ga0068854_100024752 3300005578 Bacteria 4114
68 Ga0068854_100708292 3300005578 Unclassified 870
69 Ga0068856_100176476 3300005614 Unclassified 2149
70 Ga0070702_100280964 3300005615 Unclassified 1143
71 Ga0068859_100268530 3300005617 Bacteria 1798
72 Ga0068859_101361544 3300005617 Unclassified 782
73 Ga0068866_10089138 3300005718 Bacteria 1676
74 Ga0068861_100056230 3300005719 Bacteria 3003
75 Ga0068861_100191563 3300005719 Bacteria 1710
76 Ga0068861_100422679 3300005719 Archaea 1188
77 Ga0068861_100846903 3300005719 Unclassified 862
78 Ga0068863_100008809 3300005841 Bacteria 9853
79 Ga0068863_100469038 3300005841 Bacteria 1237
80 Ga0068863_101162747 3300005841 Bacteria 777
81 Ga0068863_101897691 3300005841 Bacteria 606
82 Ga0068858_100001257 3300005842 Bacteria 26230
83 Ga0068858_100027342 3300005842 Bacteria 5300
84 Ga0068858_100088338 3300005842 Bacteria 2884
85 Ga0068858_100668236 3300005842 Unclassified 1010
86 Ga0068860_100302540 3300005843 Bacteria 1567
87 Ga0068860_100808364 3300005843 Unclassified 951
88 Ga0068860_100931135 3300005843 Bacteria 886
89 Ga0070712_100416790 3300006175 Bacteria 1112
90 Ga0097621_100004830 3300006237 Bacteria 9441
91 Ga0097621_100010293 3300006237 Bacteria 6834
92 Ga0097621_100017796 3300006237 Bacteria 5409
93 Ga0097621_100187562 3300006237 Unclassified 1789
94 Ga0097621_100307414 3300006237 Bacteria 1402
95 Ga0097621_100432364 3300006237 Unclassified 1183
96 Ga0068871_100009469 3300006358 Bacteria 7061
97 Ga0068871_100080376 3300006358 Unclassified 2699
98 Ga0068871_100290110 3300006358 Bacteria 1433
99 Ga0068871_100345586 3300006358 Bacteria 1315
100 Ga0075428_100086918 3300006844 Bacteria 3410
101 Ga0075428_100230171 3300006844 Bacteria 2000
102 Ga0075431_100041860 3300006847 Bacteria 4724
103 Ga0075433_10088493 3300006852 Bacteria 2736
104 Ga0075433_10280774 3300006852 Unclassified 1475
105 Ga0075433_10500697 3300006852 Bacteria 1069
106 Ga0075434_100027418 3300006871 Bacteria 5592
107 Ga0075434_100074086 3300006871 Bacteria 3398
108 Ga0075434_100097165 3300006871 Unclassified 2950
109 Ga0075434_100100079 3300006871 Bacteria 2905
110 Ga0075434_100115087 3300006871 Bacteria 2702
111 Ga0075434_100239195 3300006871 Bacteria 1836
112 Ga0068865_100142509 3300006881 Unclassified 1808
113 Ga0068865_100184099 3300006881 Bacteria 1610
114 Ga0068865_100276743 3300006881 Bacteria 1335
115 Ga0075436_100000126 3300006914 Bacteria 45406
116 Ga0075436_100011328 3300006914 Bacteria 6118
117 Ga0075436_100603159 3300006914 Bacteria 809
118 Ga0097620_100268557 3300006931 Bacteria 1798
119 Ga0097620_101361494 3300006931 Unclassified 782
120 Ga0075435_100000002 3300007076 Bacteria 140391
121 Ga0075435_100003029 3300007076 Bacteria 11320
122 Ga0075435_100005429 3300007076 Bacteria 8898
123 Ga0075435_100030797 3300007076 Unclassified 4222
124 Ga0075435_100301796 3300007076 Bacteria 1370
125 Ga0105250_10345705 3300009092 Bacteria 651
126 Ga0105240_10569362 3300009093 Bacteria 1251
127 Ga0105240_10584978 3300009093 Archaea 1231
128 Ga0105240_11130718 3300009093 Bacteria 832
129 Ga0111539_10084464 3300009094 Unclassified 3732
130 Ga0105245_10010923 3300009098 Bacteria 7901
131 Ga0105245_10284331 3300009098 Bacteria 1618
132 Ga0105245_10628778 3300009098 Unclassified 1102
133 Ga0105245_11631527 3300009098 Unclassified 697
134 Ga0105245_11869573 3300009098 Unclassified 653
135 Ga0105247_10009674 3300009101 Bacteria 5846
136 Ga0105247_10541606 3300009101 Bacteria 854
137 Ga0114129_10000083 3300009147 Bacteria 87553
138 Ga0114129_10020348 3300009147 Bacteria 9440
139 Ga0114129_10201245 3300009147 Bacteria 2697
140 Ga0114129_11705973 3300009147 Bacteria 768
141 Ga0105243_10376785 3300009148 Unclassified 1311
142 Ga0105243_10507069 3300009148 Bacteria 1144
143 Ga0105243_12504068 3300009148 Viruses 555
144 Ga0105241_11378248 3300009174 Unclassified 674
145 Ga0105242_10196747 3300009176 Bacteria 1788
146 Ga0105242_10296222 3300009176 Bacteria 1475
147 Ga0105242_10482835 3300009176 Bacteria 1175
148 Ga0105242_10767018 3300009176 Archaea 951
149 Ga0105248_10021593 3300009177 Bacteria 7130
150 Ga0105248_10087191 3300009177 Bacteria 3512
151 Ga0105248_10277942 3300009177 Bacteria 1885
152 Ga0105248_10289463 3300009177 Bacteria 1844
153 Ga0105248_10359651 3300009177 Bacteria 1639
154 Ga0105248_10651249 3300009177 Bacteria 1189
155 Ga0105248_11874668 3300009177 Unclassified 680
156 Ga0105248_12151522 3300009177 Bacteria 635
157 Ga0105238_10172685 3300009551 Bacteria 2138
158 Ga0105238_11472752 3300009551 Bacteria 709
159 Ga0105249_10827069 3300009553 Bacteria 991
160 Ga0105246_10623132 3300011119 Bacteria 935
161 Ga0105246_10866468 3300011119 Bacteria 807
162 Ga0157370_10813565 3300013104 Unclassified 850
163 Ga0157374_10353629 3300013296 Bacteria 1460
164 Ga0157374_10447944 3300013296 Unclassified 1292
165 Ga0157378_11094790 3300013297 Unclassified 834
166 Ga0157378_11602521 3300013297 Bacteria 697
167 Ga0163162_10162514 3300013306 Bacteria 2355
168 Ga0157375_10068674 3300013308 Bacteria 3547
169 Ga0157375_10990102 3300013308 Unclassified 981
170 Ga0157375_11626770 3300013308 Bacteria 764
171 Ga0163163_10018881 3300014325 Bacteria 6467
172 Ga0163163_11335073 3300014325 Bacteria 779
173 Ga0163163_11707581 3300014325 Unclassified 690
174 Ga0163163_12392754 3300014325 Bacteria 587
175 Ga0157380_10530365 3300014326 Unclassified 1150
176 Ga0157380_11782186 3300014326 Unclassified 674
177 Ga0157380_12892772 3300014326 Bacteria 546
178 Ga0157379_10015835 3300014968 Bacteria 6626
179 Ga0157379_10237375 3300014968 Bacteria 1653
180 Ga0157376_10006374 3300014969 Bacteria 8334
181 Ga0157376_10106134 3300014969 Bacteria 2464
182 Ga0157376_10342345 3300014969 Bacteria 1428
183 Ga0157376_10637126 3300014969 Bacteria 1065
184 Ga0157376_10692298 3300014969 Bacteria 1023
185 Ga0182007_10087199 3300015262 Unclassified 1026
186 Ga0163161_10375852 3300017792 Bacteria 1135
187 Ga0207682_10163874 3300025893 Bacteria 1009
188 Ga0207682_10378817 3300025893 Unclassified 668
189 Ga0207642_10956870 3300025899 Bacteria 550
190 Ga0207680_10057872 3300025903 Unclassified 2347
191 Ga0207680_10089664 3300025903 Bacteria 1953
192 Ga0207680_10582548 3300025903 Bacteria 800
193 Ga0207680_10822155 3300025903 Unclassified 666
194 Ga0207685_10050149 3300025905 Bacteria 1607
195 Ga0207685_10177935 3300025905 Unclassified 984
196 Ga0207645_10021204 3300025907 Bacteria 4240
197 Ga0207645_10571981 3300025907 Bacteria 767
198 Ga0207705_10194296 3300025909 Bacteria 1536
199 Ga0207707_10316688 3300025912 Bacteria 1348
200 Ga0207695_11343044 3300025913 Bacteria 595
201 Ga0207663_10770424 3300025916 Bacteria 765
202 Ga0207660_10892460 3300025917 Unclassified 725
203 Ga0207657_10017694 3300025919 Bacteria 6825
204 Ga0207652_10101434 3300025921 Unclassified 2542
205 Ga0207646_10051376 3300025922 Unclassified 3689
206 Ga0207646_10174310 3300025922 Bacteria 1942
207 Ga0207694_10395889 3300025924 Unclassified 1148
208 Ga0207694_10995261 3300025924 Bacteria 709
209 Ga0207650_10676263 3300025925 Bacteria 871
210 Ga0207687_10530695 3300025927 Unclassified 985
211 Ga0207687_11010120 3300025927 Unclassified 713
212 Ga0207700_10131112 3300025928 Bacteria 2047
213 Ga0207664_10042500 3300025929 Unclassified 3548
214 Ga0207644_10382040 3300025931 Unclassified 1149
215 Ga0207644_10497982 3300025931 Bacteria 1005
216 Ga0207690_10677884 3300025932 Unclassified 846
217 Ga0207690_11761398 3300025932 Bacteria 517
218 Ga0207706_10426022 3300025933 Unclassified 1149
219 Ga0207706_10868126 3300025933 Unclassified 763
220 Ga0207686_10060655 3300025934 Bacteria 2395
221 Ga0207686_10573037 3300025934 Bacteria 885
222 Ga0207709_10068118 3300025935 Bacteria 2249
223 Ga0207709_10449736 3300025935 Unclassified 995
224 Ga0207709_11136915 3300025935 Unclassified 642
225 Ga0207670_10652847 3300025936 Bacteria 868
226 Ga0207669_10024017 3300025937 Bacteria 3269
227 Ga0207669_10199565 3300025937 Bacteria 1451
228 Ga0207669_11501403 3300025937 Unclassified 575
229 Ga0207704_10131899 3300025938 Bacteria 1732
230 Ga0207691_11252999 3300025940 Bacteria 614
231 Ga0207711_10060680 3300025941 Bacteria 3259
232 Ga0207711_10113822 3300025941 Bacteria 2409
233 Ga0207711_10533221 3300025941 Bacteria 1095
234 Ga0207711_11095260 3300025941 Bacteria 737
235 Ga0207689_10046693 3300025942 Bacteria 3578
236 Ga0207689_10267888 3300025942 Bacteria 1414
237 Ga0207679_10971484 3300025945 Bacteria 778
238 Ga0207651_10064753 3300025960 Bacteria 2560
239 Ga0207651_10176835 3300025960 Unclassified 1689
240 Ga0207651_10674393 3300025960 Unclassified 909
241 Ga0207640_10012592 3300025981 Bacteria 4823
242 Ga0207640_10473604 3300025981 Unclassified 1037
243 Ga0207658_10451780 3300025986 Bacteria 1138
244 Ga0207677_10102808 3300026023 Unclassified 2108
245 Ga0207703_10129263 3300026035 Bacteria 2179
246 Ga0207703_10193183 3300026035 Bacteria 1804
247 Ga0207703_10837977 3300026035 Bacteria 879
248 Ga0207639_10245187 3300026041 Bacteria 1560
249 Ga0207639_10777470 3300026041 Unclassified 891
250 Ga0207639_10786867 3300026041 Unclassified 886
251 Ga0207708_10976428 3300026075 Bacteria 735
252 Ga0207702_10418538 3300026078 Bacteria 1295
253 Ga0207641_10250288 3300026088 Bacteria 1654
254 Ga0207641_10433952 3300026088 Bacteria 1267
255 Ga0207641_10642337 3300026088 Bacteria 1042
256 Ga0207648_10096362 3300026089 Bacteria 2589
257 Ga0207648_10363794 3300026089 Unclassified 1306
258 Ga0207648_10422265 3300026089 Bacteria 1211
259 Ga0207648_10615238 3300026089 Unclassified 1002
260 Ga0207676_11488344 3300026095 Unclassified 674
261 Ga0207674_10984201 3300026116 Unclassified 812
262 Ga0207675_100038715 3300026118 Bacteria 4450
263 Ga0207675_101357485 3300026118 Unclassified 731
264 Ga0207683_10079311 3300026121 Bacteria 2911
265 Ga0207683_10088636 3300026121 Bacteria 2753
266 Ga0207683_12090714 3300026121 Bacteria 514
267 Ga0207698_11057155 3300026142 Bacteria 824
268 Ga0207428_10135638 3300027907 Unclassified 1881
269 Ga0268266_10554194 3300028379 Unclassified 1102
270 Ga0268266_10929640 3300028379 Unclassified 841
271 Ga0268264_10453591 3300028381 Unclassified 1243
272 Ga0268264_10764264 3300028381 Unclassified 963
273 Ga0268264_11389413 3300028381 Bacteria 713
274 Ga0265336_10020707 3300028666 Bacteria 2108
275 Ga0265332_10017859 3300031238 Bacteria 3128
276 Ga0307413_11245756 3300031824 Unclassified 649
277 Ga0307409_100372999 3300031995 Unclassified 1354
278 Ga0307416_100063147 3300032002 Bacteria 3032
279 Ga0307416_100094150 3300032002 Bacteria 2582
280 Ga0307415_100086399 3300032126 Bacteria 2257
281 Ga0373930_0010264 3300034816 Bacteria 1671
282 Ga0373950_0172541 3300034818 Unclassified 505
283 Ga0373958_0003226 3300034819 Bacteria 2339
284 Ga0373938_0013413 3300034957 Bacteria 1554
285 Ga0373928_0003267 3300035084 Bacteria 3104
286 Ga0373929_0004028 3300035085 Bacteria 2632
287 Ga0373940_0138094 3300035088 Bacteria 768
288 Ga0373932_0001144 3300035112 Bacteria 7621
289 Ga0373936_0348513 3300035113 Unclassified 674
290 Ga0373939_0002622 3300035114 Bacteria 4225
291 Ga0373941_0004767 3300035115 Bacteria 3155
292 Ga0373953_0508807 3300035117 Bacteria 534
293 Ga0373956_0027326 3300035119 Unclassified 2477
294 Ga0373956_0127749 3300035119 Unclassified 1189
295 Ga0373957_0276313 3300035120 Unclassified 710
296 Ga0373957_0457614 3300035120 Unclassified 553
297 Ga0373943_0484689 3300035170 Bacteria 721
298 Ga0373946_0488928 3300035171 Unclassified 630
299 Ga0373955_0382432 3300035172 Bacteria 854
300 Ga0373942_0002317 3300035207 Unclassified 4651
301 Ga0373961_0002608 3300035241 Bacteria 4641
302 Ga0373962_0014795 3300035242 Bacteria 1992
303 Ga0373924_0312670 3300035410 Unclassified 698
304 Ga0373931_0154689 3300035691 Bacteria 1339
305 Ga0373933_0285588 3300035724 Unclassified 1067
306 Ga0373947_0591713 3300035725 Bacteria 756
307 Ga0373937_0069562 3300036401 Bacteria 3246
308 Ga0373937_0668666 3300036401 Bacteria 984
309 Ga0373937_1448551 3300036401 Bacteria 634
310 Ga0373937_1658920 3300036401 Bacteria 586
311 Ga0373925_0094702 3300037068 Bacteria 2287
312 Ga0373925_0495416 3300037068 Bacteria 1003
313 Ga0451787_713121 3300041441 Bacteria 581
314 Ga0451807_1818040 3300041486 Unclassified 520
315 Ga0451807_1946763 3300041486 Bacteria 551
316 Ga0451839_1655775 3300041496 Bacteria 572
317 Ga0451849_0935556 3300041505 Bacteria 586
318 Ga0439435_0014828 3300042436 Bacteria 1931
319 Ga0466963_0042911 3300044694 Unclassified 2971
320 Ga0466971_0342287 3300044719 Bacteria 723
321 Ga0466957_0492124 3300044842 Unclassified 849
322 Ga0451576_0006978 3300045051 Bacteria 13669
323 Ga0466967_0377420 3300045976 Bacteria 1376
324 Ga0495629_0153580 3300046459 Unclassified 1600
325 Ga0495651_0351945 3300046462 Bacteria 973
326 Ga0495653_0565273 3300046463 Bacteria 702
327 Ga0495580_1083842 3300046472 Unclassified 507
328 Ga0495582_0300314 3300046473 Bacteria 923
329 Ga0495582_0373606 3300046473 Bacteria 821
330 Ga0495639_0495349 3300046475 Unclassified 623
331 Ga0495639_0706375 3300046475 Unclassified 521
332 Ga0495662_0083472 3300046476 Unclassified 1555
333 Ga0495662_0396546 3300046476 Bacteria 678
334 Ga0495596_0391631 3300046500 Bacteria 541
335 Ga0495608_0034367 3300046511 Bacteria 3423
336 Ga0495618_0073294 3300046514 Bacteria 2180
337 Ga0495618_0339305 3300046514 Bacteria 928
338 Ga0495628_0140358 3300046516 Unclassified 1844
339 Ga0495630_0035461 3300046517 Bacteria 3728
340 Ga0495630_0060880 3300046517 Bacteria 2835
341 Ga0495630_0957405 3300046517 Bacteria 651
342 Ga0495644_0135676 3300046523 Bacteria 939
343 Ga0495652_0588186 3300046529 Bacteria 761
344 Ga0495640_0232567 3300046533 Bacteria 1159
345 Ga0495640_0245517 3300046533 Bacteria 1123
346 Ga0495633_0394462 3300046558 Bacteria 626
347 Ga0495667_0101720 3300046559 Bacteria 1859
348 Ga0495634_0126087 3300046642 Unclassified 1636
349 Ga0495634_0263720 3300046642 Bacteria 1050
350 Ga0495634_0367033 3300046642 Bacteria 860
351 Ga0495634_0394344 3300046642 Unclassified 823
352 Ga0495635_0142097 3300046663 Bacteria 1635
353 Ga0495659_0125917 3300046664 Unclassified 1013
354 Ga0495659_0499275 3300046664 Bacteria 533
355 Ga0495599_0215855 3300046678 Bacteria 1175
356 Ga0495599_0283762 3300046678 Bacteria 1002
357 Ga0495599_0604038 3300046678 Bacteria 639
358 Ga0495658_0087569 3300046683 Unclassified 1839
359 Ga0495658_0164766 3300046683 Bacteria 1369
360 Ga0495658_0270297 3300046683 Bacteria 1071
361 Ga0495658_0912900 3300046683 Unclassified 561
362 Ga0495613_0000846 3300046689 Bacteria 23501
363 Ga0495624_0403742 3300046690 Bacteria 820
364 Ga0495600_0061385 3300046809 Bacteria 2455
365 Ga0495674_1156635 3300047319 Bacteria 587
366 Ga0495675_0064935 3300047444 Bacteria 2309
367 Ga0495684_0000768 3300047471 Bacteria 25926
368 Ga0495684_0403618 3300047471 Unclassified 959
369 Ga0495602_0317443 3300048088 Bacteria 1135
370 Ga0496100_0073575 3300048903 Bacteria 2287
371 Ga0496101_0002493 3300048904 Bacteria 11304
372 Ga0496102_0150758 3300048905 Unclassified 2185
373 Ga0496104_0033899 3300048907 Bacteria 4759
374 Ga0496104_0190663 3300048907 Bacteria 1961
375 Ga0496104_0903061 3300048907 Bacteria 788
376 Ga0496105_0220379 3300048908 Bacteria 1544
377 Ga0496105_0367622 3300048908 Bacteria 1146
378 Ga0496105_0431480 3300048908 Bacteria 1042
379 Ga0496106_0029272 3300048909 Bacteria 4104
380 Ga0496106_0332266 3300048909 Unclassified 1220
381 Ga0496106_0380408 3300048909 Bacteria 1134
382 Ga0496107_0686495 3300048910 Unclassified 754
383 Ga0496108_0782715 3300048911 Unclassified 824
384 Ga0496109_0488791 3300048912 Bacteria 1162
385 Ga0496112_1722139 3300048915 Unclassified 539
386 Ga0496114_0980193 3300048917 Unclassified 728
387 Ga0496114_1230986 3300048917 Bacteria 635
388 Ga0496115_0150242 3300048918 Bacteria 1923
389 Ga0501299_127985 3300049522 Unclassified 619
390 Ga0501033_0492283 3300049570 Bacteria 849
391 Ga0501034_0252432 3300049571 Bacteria 1708
392 Ga0501047_0116885 3300049581 Bacteria 2548
393 Ga0501206_081513 3300049653 Bacteria 562
394 Ga0501080_0692766 3300049742 Bacteria 899
395 Ga0501035_0675764 3300049822 Bacteria 835
396 Ga0501044_0003028 3300049823 Bacteria 19022
397 nmdc:mga05p37_1117000_c1 3300050507 Unclassified 824
398 nmdc:mga05p37_12267_c1 3300050507 Bacteria 7579
399 nmdc:mga05p37_13664_c1 3300050507 Bacteria 9730
400 nmdc:mga05p37_222927_c1 3300050507 Bacteria 2275
401 nmdc:mga05p37_528091_c1 3300050507 Unclassified 1348
402 nmdc:mga06r32_1095212_c1 3300050510 Unclassified 746
403 nmdc:mga08y16_45586_c1 3300050511 Unclassified 4594
404 nmdc:mga0n895_112764_c1 3300050512 Bacteria 2736
405 nmdc:mga0n895_235847_c1 3300050512 Bacteria 1857
406 nmdc:mga0n895_60_c1 3300050512 Bacteria 63557
407 nmdc:mga0n895_64634_c1 3300050512 Bacteria 3619
408 nmdc:mga0n895_70672_c1 3300050512 Unclassified 3460
409 nmdc:mga0n895_710842_c1 3300050512 Bacteria 1000
410 nmdc:mga0n895_816008_c1 3300050512 Unclassified 922
411 nmdc:mga0rr50_1121822_c1 3300050513 Bacteria 669
412 nmdc:mga0rr50_2178_c1 3300050513 Bacteria 10973
413 nmdc:mga0rr50_27_c1 3300050513 Bacteria 109881
414 nmdc:mga0rr50_52722_c1 3300050513 Bacteria 3024
415 nmdc:mga0rr50_774920_c1 3300050513 Bacteria 819
416 nmdc:mga08x19_383_c1 3300050514 Bacteria 31056
417 nmdc:mga08x19_488969_c1 3300050514 Bacteria 868
418 nmdc:mga0a205_291250_c1 3300050515 Bacteria 1109
419 nmdc:mga0a205_29687_c1 3300050515 Bacteria 5233
420 nmdc:mga0a205_50345_c1 3300050515 Bacteria 4021
421 nmdc:mga0a205_927457_c1 3300050515 Bacteria 718
422 Ga0495601_0005525 3300053077 Bacteria 7375
423 Ga0495601_0096582 3300053077 Unclassified 1906
424 Ga0495601_0215407 3300053077 Bacteria 1254
425 Ga0495595_0293155 3300053084 Bacteria 818
426 Ga0495619_0002535 3300053085 Bacteria 11952
427 Ga0495619_0071027 3300053085 Bacteria 2329
428 Ga0501082_0092059 3300060353 Bacteria 2619
429 Ga0105247_11238740
430 SwRhRL2b_contig_1506194
431 Ga0065704_10053767
432 Ga0065712_10503742
433 Ga0065712_10768579
434 Ga0065707_11005543
435 Ga0070658_10123961
436 Ga0070683_101212467
437 Ga0070690_100098559
438 Ga0070670_100124357
439 Ga0070677_10662205
440 Ga0070666_10049577
441 Ga0070666_10275219
442 Ga0070666_10970524
443 Ga0070680_101480420
444 Ga0068868_100106560
445 Ga0070660_100113189
446 Ga0070689_100506587
447 Ga0070689_101539819
448 Ga0070687_100021073
449 Ga0070692_11349684
450 Ga0070671_100675920
451 Ga0070674_100023385
452 Ga0070674_100050538
453 Ga0070674_100181684
454 Ga0070674_100271243
455 Ga0070674_100920157
456 Ga0070673_100255247
457 Ga0070673_100476511
458 Ga0070673_101949896
459 Ga0070688_101162560
460 Ga0070659_100056027
461 Ga0070659_100424446
462 Ga0070659_100776816
463 Ga0070667_100841194
464 Ga0070667_101460010
465 Ga0070714_100014777
466 Ga0070713_100133464
467 Ga0070708_100888025
468 Ga0070678_100251176
469 Ga0070662_100125531
470 Ga0070681_10702856
471 Ga0068867_100021130
472 Ga0068867_100287264
473 Ga0068867_101411798
474 Ga0070707_100119759
475 Ga0070698_100185669
476 Ga0070698_100266477
477 Ga0070699_100609254
478 Ga0070679_100245939
479 Ga0070697_100090728
480 Ga0070697_101811437
481 Ga0068853_100082887
482 Ga0068853_100759857
483 Ga0068853_100940922
484 Ga0070672_100204288
485 Ga0070672_100534805
486 Ga0070686_100010181
487 Ga0070686_100162569
488 Ga0070695_100125357
489 Ga0070693_100259658
490 Ga0070665_100013780
491 Ga0070665_101515475
492 Ga0068855_100111238
493 Ga0070664_101135953
494 Ga0070664_102213509
495 Ga0068854_100024752
496 Ga0068854_100708292
497 Ga0068856_100176476
498 Ga0070702_100280964
499 Ga0068859_100268530
500 Ga0068859_101361544
501 Ga0068866_10089138
502 Ga0068861_100056230
503 Ga0068861_100191563
504 Ga0068861_100422679
505 Ga0068861_100846903
506 Ga0068863_100008809
507 Ga0068863_100469038
508 Ga0068863_101162747
509 Ga0068863_101897691
510 Ga0068858_100001257
511 Ga0068858_100027342
512 Ga0068858_100088338
513 Ga0068858_100668236
514 Ga0068860_100302540
515 Ga0068860_100808364
516 Ga0068860_100931135
517 Ga0070712_100416790
518 Ga0097621_100004830
519 Ga0097621_100010293
520 Ga0097621_100017796
521 Ga0097621_100187562
522 Ga0097621_100307414
523 Ga0097621_100432364
524 Ga0068871_100009469
525 Ga0068871_100080376
526 Ga0068871_100290110
527 Ga0068871_100345586
528 Ga0075428_100086918
529 Ga0075428_100230171
530 Ga0075431_100041860
531 Ga0075433_10088493
532 Ga0075433_10280774
533 Ga0075433_10500697
534 Ga0075434_100027418
535 Ga0075434_100074086
536 Ga0075434_100097165
537 Ga0075434_100100079
538 Ga0075434_100115087
539 Ga0075434_100239195
540 Ga0068865_100142509
541 Ga0068865_100184099
542 Ga0068865_100276743
543 Ga0075436_100000126
544 Ga0075436_100011328
545 Ga0075436_100603159
546 Ga0097620_100268557
547 Ga0097620_101361494
548 Ga0075435_100000002
549 Ga0075435_100003029
550 Ga0075435_100005429
551 Ga0075435_100030797
552 Ga0075435_100301796
553 Ga0105250_10345705
554 Ga0105240_10569362
555 Ga0105240_10584978
556 Ga0105240_11130718
557 Ga0111539_10084464
558 Ga0105245_10010923
559 Ga0105245_10284331
560 Ga0105245_10628778
561 Ga0105245_11631527
562 Ga0105245_11869573
563 Ga0105247_10009674
564 Ga0105247_10541606
565 Ga0114129_10000083
566 Ga0114129_10020348
567 Ga0114129_10201245
568 Ga0114129_11705973
569 Ga0105243_10376785
570 Ga0105243_10507069
571 Ga0105243_12504068
572 Ga0105241_11378248
573 Ga0105242_10196747
574 Ga0105242_10296222
575 Ga0105242_10482835
576 Ga0105242_10767018
577 Ga0105248_10021593
578 Ga0105248_10087191
579 Ga0105248_10277942
580 Ga0105248_10289463
581 Ga0105248_10359651
582 Ga0105248_10651249
583 Ga0105248_11874668
584 Ga0105248_12151522
585 Ga0105238_10172685
586 Ga0105238_11472752
587 Ga0105249_10827069
588 Ga0105246_10623132
589 Ga0105246_10866468
590 Ga0157370_10813565
591 Ga0157374_10353629
592 Ga0157374_10447944
593 Ga0157378_11094790
594 Ga0157378_11602521
595 Ga0163162_10162514
596 Ga0157375_10068674
597 Ga0157375_10990102
598 Ga0157375_11626770
599 Ga0163163_10018881
600 Ga0163163_11335073
601 Ga0163163_11707581
602 Ga0163163_12392754
603 Ga0157380_10530365
604 Ga0157380_11782186
605 Ga0157380_12892772
606 Ga0157379_10015835
607 Ga0157379_10237375
608 Ga0157376_10006374
609 Ga0157376_10106134
610 Ga0157376_10342345
611 Ga0157376_10637126
612 Ga0157376_10692298
613 Ga0182007_10087199
614 Ga0163161_10375852
615 Ga0207682_10163874
616 Ga0207682_10378817
617 Ga0207642_10956870
618 Ga0207680_10057872
619 Ga0207680_10089664
620 Ga0207680_10582548
621 Ga0207680_10822155
622 Ga0207685_10050149
623 Ga0207685_10177935
624 Ga0207645_10021204
625 Ga0207645_10571981
626 Ga0207705_10194296
627 Ga0207707_10316688
628 Ga0207695_11343044
629 Ga0207663_10770424
630 Ga0207660_10892460
631 Ga0207657_10017694
632 Ga0207652_10101434
633 Ga0207646_10051376
634 Ga0207646_10174310
635 Ga0207694_10395889
636 Ga0207694_10995261
637 Ga0207650_10676263
638 Ga0207687_10530695
639 Ga0207687_11010120
640 Ga0207700_10131112
641 Ga0207664_10042500
642 Ga0207644_10382040
643 Ga0207644_10497982
644 Ga0207690_10677884
645 Ga0207690_11761398
646 Ga0207706_10426022
647 Ga0207706_10868126
648 Ga0207686_10060655
649 Ga0207686_10573037
650 Ga0207709_10068118
651 Ga0207709_10449736
652 Ga0207709_11136915
653 Ga0207670_10652847
654 Ga0207669_10024017
655 Ga0207669_10199565
656 Ga0207669_11501403
657 Ga0207704_10131899
658 Ga0207691_11252999
659 Ga0207711_10060680
660 Ga0207711_10113822
661 Ga0207711_10533221
662 Ga0207711_11095260
663 Ga0207689_10046693
664 Ga0207689_10267888
665 Ga0207679_10971484
666 Ga0207651_10064753
667 Ga0207651_10176835
668 Ga0207651_10674393
669 Ga0207640_10012592
670 Ga0207640_10473604
671 Ga0207658_10451780
672 Ga0207677_10102808
673 Ga0207703_10129263
674 Ga0207703_10193183
675 Ga0207703_10837977
676 Ga0207639_10245187
677 Ga0207639_10777470
678 Ga0207639_10786867
679 Ga0207708_10976428
680 Ga0207702_10418538
681 Ga0207641_10250288
682 Ga0207641_10433952
683 Ga0207641_10642337
684 Ga0207648_10096362
685 Ga0207648_10363794
686 Ga0207648_10422265
687 Ga0207648_10615238
688 Ga0207676_11488344
689 Ga0207674_10984201
690 Ga0207675_100038715
691 Ga0207675_101357485
692 Ga0207683_10079311
693 Ga0207683_10088636
694 Ga0207683_12090714
695 Ga0207698_11057155
696 Ga0207428_10135638
697 Ga0268266_10554194
698 Ga0268266_10929640
699 Ga0268264_10453591
700 Ga0268264_10764264
701 Ga0268264_11389413
702 Ga0265336_10020707
703 Ga0265332_10017859
704 Ga0307413_11245756
705 Ga0307409_100372999
706 Ga0307416_100063147
707 Ga0307416_100094150
708 Ga0307415_100086399
709 Ga0373930_0010264
710 Ga0373950_0172541
711 Ga0373958_0003226
712 Ga0373938_0013413
713 Ga0373928_0003267
714 Ga0373929_0004028
715 Ga0373940_0138094
716 Ga0373932_0001144
717 Ga0373936_0348513
718 Ga0373939_0002622
719 Ga0373941_0004767
720 Ga0373953_0508807
721 Ga0373956_0027326
722 Ga0373956_0127749
723 Ga0373957_0276313
724 Ga0373957_0457614
725 Ga0373943_0484689
726 Ga0373946_0488928
727 Ga0373955_0382432
728 Ga0373942_0002317
729 Ga0373961_0002608
730 Ga0373962_0014795
731 Ga0373924_0312670
732 Ga0373931_0154689
733 Ga0373933_0285588
734 Ga0373947_0591713
735 Ga0373937_0069562
736 Ga0373937_0668666
737 Ga0373937_1448551
738 Ga0373937_1658920
739 Ga0373925_0094702
740 Ga0373925_0495416
741 Ga0451787_713121
742 Ga0451807_1818040
743 Ga0451807_1946763
744 Ga0451839_1655775
745 Ga0451849_0935556
746 Ga0439435_0014828
747 Ga0466963_0042911
748 Ga0466971_0342287
749 Ga0466957_0492124
750 Ga0451576_0006978
751 Ga0466967_0377420
752 Ga0495629_0153580
753 Ga0495651_0351945
754 Ga0495653_0565273
755 Ga0495580_1083842
756 Ga0495582_0300314
757 Ga0495582_0373606
758 Ga0495639_0495349
759 Ga0495639_0706375
760 Ga0495662_0083472
761 Ga0495662_0396546
762 Ga0495596_0391631
763 Ga0495608_0034367
764 Ga0495618_0073294
765 Ga0495618_0339305
766 Ga0495628_0140358
767 Ga0495630_0035461
768 Ga0495630_0060880
769 Ga0495630_0957405
770 Ga0495644_0135676
771 Ga0495652_0588186
772 Ga0495640_0232567
773 Ga0495640_0245517
774 Ga0495633_0394462
775 Ga0495667_0101720
776 Ga0495634_0126087
777 Ga0495634_0263720
778 Ga0495634_0367033
779 Ga0495634_0394344
780 Ga0495635_0142097
781 Ga0495659_0125917
782 Ga0495659_0499275
783 Ga0495599_0215855
784 Ga0495599_0283762
785 Ga0495599_0604038
786 Ga0495658_0087569
787 Ga0495658_0164766
788 Ga0495658_0270297
789 Ga0495658_0912900
790 Ga0495613_0000846
791 Ga0495624_0403742
792 Ga0495600_0061385
793 Ga0495674_1156635
794 Ga0495675_0064935
795 Ga0495684_0000768
796 Ga0495684_0403618
797 Ga0495602_0317443
798 Ga0496100_0073575
799 Ga0496101_0002493
800 Ga0496102_0150758
801 Ga0496104_0033899
802 Ga0496104_0190663
803 Ga0496104_0903061
804 Ga0496105_0220379
805 Ga0496105_0367622
806 Ga0496105_0431480
807 Ga0496106_0029272
808 Ga0496106_0332266
809 Ga0496106_0380408
810 Ga0496107_0686495
811 Ga0496108_0782715
812 Ga0496109_0488791
813 Ga0496112_1722139
814 Ga0496114_0980193
815 Ga0496114_1230986
816 Ga0496115_0150242
817 Ga0501299_127985
818 Ga0501033_0492283
819 Ga0501034_0252432
820 Ga0501047_0116885
821 Ga0501206_081513
822 Ga0501080_0692766
823 Ga0501035_0675764
824 Ga0501044_0003028
825 nmdc:mga05p37_1117000_c1
826 nmdc:mga05p37_12267_c1
827 nmdc:mga05p37_13664_c1
828 nmdc:mga05p37_222927_c1
829 nmdc:mga05p37_528091_c1
830 nmdc:mga06r32_1095212_c1
831 nmdc:mga08y16_45586_c1
832 nmdc:mga0n895_112764_c1
833 nmdc:mga0n895_235847_c1
834 nmdc:mga0n895_60_c1
835 nmdc:mga0n895_64634_c1
836 nmdc:mga0n895_70672_c1
837 nmdc:mga0n895_710842_c1
838 nmdc:mga0n895_816008_c1
839 nmdc:mga0rr50_1121822_c1
840 nmdc:mga0rr50_2178_c1
841 nmdc:mga0rr50_27_c1
842 nmdc:mga0rr50_52722_c1
843 nmdc:mga0rr50_774920_c1
844 nmdc:mga08x19_383_c1
845 nmdc:mga08x19_488969_c1
846 nmdc:mga0a205_291250_c1
847 nmdc:mga0a205_29687_c1
848 nmdc:mga0a205_50345_c1
849 nmdc:mga0a205_927457_c1
850 Ga0495601_0005525
851 Ga0495601_0096582
852 Ga0495601_0215407
853 Ga0495595_0293155
854 Ga0495619_0002535
855 Ga0495619_0071027
856 Ga0501082_0092059

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00856

SET

SET domain

11

107

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6c24-assembly1.cif.gz_K cryo-em structure of prc2 bound to cofactors aebp2 and jarid2 in the extended active state 0.9117 2 112
8fyh-assembly1.cif.gz_G g4 rna-mediated prc2 dimer 0.905 1 110
5hyn-assembly6.cif.gz_F structure of human polycomb repressive complex 2 (prc2) with oncogenic histone h3k27m peptide 0.902 1 114
7ktp-assembly1.cif.gz_A prc2:ezh1_b from a dimeric prc2 bound to a nucleosome 0.9015 1 110
5ij7-assembly2.cif.gz_B structure of hs/acprc2 in complex with a pyridone inhibitor 0.9008 1 110
ID Description Score Start End Superfamily
af_A0A1D6Q4P2_267_472_2.170.270.10 Mainly Beta;Beta Complex;Beta-clip-like;SET domain 0.8912 1 111 2.170.270.10
af_Q9ZSM8_608_824_2.170.270.10 Mainly Beta;Beta Complex;Beta-clip-like;SET domain 0.8872 1 113 2.170.270.10
af_P38827_840_1080_2.170.270.10 Mainly Beta;Beta Complex;Beta-clip-like;SET domain 0.8853 1 129 2.170.270.10
af_A0A0R0EQU1_818_986_2.170.270.10 Mainly Beta;Beta Complex;Beta-clip-like;SET domain 0.8776 2 129 2.170.270.10
af_G5EGI1_2305_2475_2.170.270.10 Mainly Beta;Beta Complex;Beta-clip-like;SET domain 0.8771 2 129 2.170.270.10
ID Description Score Start End GO Terms
AF-A0A843RY99-F1-model_v4 SET domain-containing protein-lysine N-methyltransferase 0.9718 1 130 GO:0008168
GO:0032259
AF-A0A2E9VCC4-F1-model_v4 SET domain-containing protein-lysine N-methyltransferase 0.9667 1 130 GO:0008168
GO:0032259
AF-A0A7Z9T8Z8-F1-model_v4 SET domain-containing protein 0.9646 1 130 GO:0003682
GO:0031507
GO:0046976
AF-A0A843RY99-F1-model_v4 SET domain-containing protein-lysine N-methyltransferase 0.9646 1 130 GO:0008168
GO:0032259
AF-A0A2V8DS73-F1-model_v4 SET domain-containing protein-lysine N-methyltransferase 0.9633 1 130 GO:0008168
GO:0032259

Map