F441548

General Info

Members Datasets Scaffolds Average Seq Length
427 249 427 231

Family's Representative Sequence

Representative Sequence 3300049582|Ga0501048_0036375|Ga0501048_0036375_2510_3271
Length 253
Sequence LAKNSFRPKAIHPLGDCAAYVEFSEALDLEVNAAVQRLAAIVHGRRLPWIRDVVPALGGLALHFDPDHPDLRGESLQTAAGLVAECLQEVDLKEEDAPRTVEVPVCYEPEFAPDIEEVAKKTRLPAEEVARLHAAGDYRVLMIGFAPGHAYMGGLDRRLAVPRRATPRPVVAAGAVAIANDQTVVYPYAISGGWNVIGRTPVAVFDARREQPSLFAAGDRVRFRPISKDEFLEFRRNPPLASLATPLSGGPRQ

Samples

Sample ID Description Type Environment
1 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
129 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
132 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
133 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
134 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
135 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
136 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
137 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
138 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
139 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
140 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
141 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
142 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
143 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
144 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
145 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
146 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
147 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
148 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
149 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
150 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
151 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
152 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
153 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
154 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
155 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
156 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
157 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
158 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
159 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
160 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
161 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
162 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
163 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
164 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
165 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
166 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
167 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
168 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
169 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
170 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
171 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
172 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
173 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
174 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
175 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
176 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
177 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
178 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
179 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
180 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
181 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
182 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
183 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
184 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
185 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
186 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
187 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
188 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
189 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
190 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
191 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
192 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
193 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
194 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
195 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
196 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
197 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
198 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
199 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
200 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
201 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
202 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
218 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
219 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
220 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
221 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
222 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
223 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
224 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
225 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
226 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
227 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
228 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
229 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
230 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
231 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
232 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
233 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
235 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
236 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
237 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
238 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
239 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
240 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
241 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
242 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
243 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
244 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
245 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
246 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
247 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
248 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
249 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 100
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070676_10235355 3300005328 Bacteria 1216
2 Ga0070683_100216905 3300005329 Bacteria 1818
3 Ga0070690_100000653 3300005330 Bacteria 17691
4 Ga0070690_100175193 3300005330 Bacteria 1479
5 Ga0068869_100001162 3300005334 Bacteria 15404
6 Ga0068869_100033060 3300005334 Bacteria 3650
7 Ga0068869_100154533 3300005334 Bacteria 1782
8 Ga0070680_100000316 3300005336 Bacteria 32375
9 Ga0070680_100110601 3300005336 Bacteria 2287
10 Ga0070682_100007142 3300005337 Bacteria 6290
11 Ga0068868_100038847 3300005338 Bacteria 3695
12 Ga0070689_100000894 3300005340 Bacteria 18602
13 Ga0070691_10000398 3300005341 Bacteria 15821
14 Ga0070687_100000276 3300005343 Bacteria 17428
15 Ga0070687_100158976 3300005343 Bacteria 1334
16 Ga0070692_10209317 3300005345 Bacteria 1147
17 Ga0070668_100182092 3300005347 Bacteria 1717
18 Ga0070669_100028104 3300005353 Bacteria 4049
19 Ga0070669_100685048 3300005353 Bacteria 865
20 Ga0070675_100087689 3300005354 Bacteria 2602
21 Ga0070671_100134215 3300005355 Bacteria 2086
22 Ga0070674_100311188 3300005356 Bacteria 1259
23 Ga0070673_100039558 3300005364 Bacteria 3610
24 Ga0070673_100303408 3300005364 Bacteria 1406
25 Ga0070710_10060221 3300005437 Bacteria 2159
26 Ga0070701_10000423 3300005438 Bacteria 14365
27 Ga0070701_10251961 3300005438 Bacteria 1066
28 Ga0070711_100601798 3300005439 Unclassified 917
29 Ga0070705_100000386 3300005440 Bacteria 25740
30 Ga0070705_100008417 3300005440 Bacteria 5110
31 Ga0070705_100019940 3300005440 Bacteria 3537
32 Ga0070705_100030209 3300005440 Bacteria 2989
33 Ga0070700_100000506 3300005441 Bacteria 19415
34 Ga0070694_100001289 3300005444 Bacteria 14567
35 Ga0070694_100007869 3300005444 Bacteria 6506
36 Ga0070694_100253270 3300005444 Unclassified 1333
37 Ga0070708_100404042 3300005445 Bacteria 1288
38 Ga0070678_100302522 3300005456 Bacteria 1359
39 Ga0070681_10161219 3300005458 Bacteria 2167
40 Ga0068867_100001833 3300005459 Bacteria 14816
41 Ga0068867_100013888 3300005459 Bacteria 5700
42 Ga0068867_100698287 3300005459 Bacteria 895
43 Ga0070706_100185664 3300005467 Bacteria 1943
44 Ga0070707_100144459 3300005468 Bacteria 2316
45 Ga0070707_100941500 3300005468 Bacteria 829
46 Ga0070699_100027677 3300005518 Bacteria 4888
47 Ga0070699_100416455 3300005518 Bacteria 1216
48 Ga0070679_100006030 3300005530 Bacteria 11276
49 Ga0070679_100315144 3300005530 Bacteria 1514
50 Ga0070679_100848214 3300005530 Bacteria 857
51 Ga0070697_100019407 3300005536 Bacteria 5370
52 Ga0068853_100061000 3300005539 Bacteria 3261
53 Ga0070672_100176130 3300005543 Bacteria 1781
54 Ga0070672_100235124 3300005543 Bacteria 1540
55 Ga0070686_100000744 3300005544 Bacteria 18870
56 Ga0070686_100179684 3300005544 Bacteria 1502
57 Ga0070695_100000250 3300005545 Bacteria 26956
58 Ga0070695_100014917 3300005545 Bacteria 4687
59 Ga0070695_100026767 3300005545 Bacteria 3570
60 Ga0070695_100097056 3300005545 Bacteria 1978
61 Ga0070696_100000358 3300005546 Bacteria 27825
62 Ga0070696_100028581 3300005546 Bacteria 3805
63 Ga0070696_100131923 3300005546 Bacteria 1818
64 Ga0070696_100196224 3300005546 Bacteria 1505
65 Ga0070696_100288460 3300005546 Bacteria 1253
66 Ga0070693_100000395 3300005547 Bacteria 19874
67 Ga0070704_100000203 3300005549 Bacteria 24666
68 Ga0070704_100002499 3300005549 Bacteria 10342
69 Ga0070704_100132876 3300005549 Bacteria 1931
70 Ga0070704_100185934 3300005549 Bacteria 1666
71 Ga0070704_100667923 3300005549 Bacteria 919
72 Ga0068855_100001461 3300005563 Bacteria 29501
73 Ga0068855_100233719 3300005563 Bacteria 2057
74 Ga0068856_100007042 3300005614 Bacteria 10984
75 Ga0070702_100000049 3300005615 Bacteria 33090
76 Ga0070702_100094192 3300005615 Bacteria 1823
77 Ga0068859_100012357 3300005617 Bacteria 8587
78 Ga0068859_100074658 3300005617 Bacteria 3430
79 Ga0068864_100614563 3300005618 Bacteria 1056
80 Ga0068866_10002274 3300005718 Bacteria 7958
81 Ga0068866_10106560 3300005718 Bacteria 1556
82 Ga0068861_100000724 3300005719 Bacteria 19764
83 Ga0068861_100276401 3300005719 Bacteria 1444
84 Ga0068861_100401252 3300005719 Bacteria 1217
85 Ga0068870_10040159 3300005840 Bacteria 2425
86 Ga0068863_100516645 3300005841 Bacteria 1177
87 Ga0068863_100731096 3300005841 Bacteria 985
88 Ga0068858_100001186 3300005842 Bacteria 26972
89 Ga0068858_100091462 3300005842 Bacteria 2832
90 Ga0068860_100008599 3300005843 Bacteria 10178
91 Ga0068862_100001819 3300005844 Bacteria 19319
92 Ga0068862_100052973 3300005844 Bacteria 3473
93 Ga0068862_100256034 3300005844 Bacteria 1596
94 Ga0081539_10009825 3300005985 Bacteria 7901
95 Ga0070716_100070269 3300006173 Bacteria 2055
96 Ga0097621_100000594 3300006237 Bacteria 25505
97 Ga0068871_100000636 3300006358 Bacteria 24113
98 Ga0075428_100042180 3300006844 Bacteria 5018
99 Ga0075428_100198718 3300006844 Bacteria 2168
100 Ga0075428_100510175 3300006844 Bacteria 1286
101 Ga0075428_100658006 3300006844 Bacteria 1117
102 Ga0075430_100000874 3300006846 Bacteria 23652
103 Ga0075431_100041055 3300006847 Bacteria 4770
104 Ga0075431_100244936 3300006847 Bacteria 1822
105 Ga0075434_100000233 3300006871 Bacteria 38350
106 Ga0075434_100004674 3300006871 Bacteria 12372
107 Ga0075434_100052805 3300006871 Bacteria 4039
108 Ga0075434_100083518 3300006871 Bacteria 3191
109 Ga0075429_100012563 3300006880 Bacteria 7346
110 Ga0075429_100143460 3300006880 Bacteria 2090
111 Ga0068865_100000086 3300006881 Bacteria 49762
112 Ga0068865_100028410 3300006881 Bacteria 3702
113 Ga0075436_100003384 3300006914 Bacteria 10925
114 Ga0075436_100006211 3300006914 Bacteria 8193
115 Ga0075436_100014377 3300006914 Bacteria 5418
116 Ga0075436_100201455 3300006914 Bacteria 1410
117 Ga0097620_100012357 3300006931 Bacteria 8587
118 Ga0097620_100074659 3300006931 Bacteria 3430
119 Ga0075435_100004201 3300007076 Bacteria 9880
120 Ga0075435_100008212 3300007076 Bacteria 7476
121 Ga0075435_100013896 3300007076 Bacteria 6005
122 Ga0075435_100423556 3300007076 Bacteria 1147
123 Ga0075435_100845030 3300007076 Bacteria 798
124 Ga0099794_10056532 3300007265 Bacteria 1898
125 Ga0111539_10132908 3300009094 Bacteria 2914
126 Ga0111539_10145499 3300009094 Bacteria 2775
127 Ga0111539_10196393 3300009094 Bacteria 2353
128 Ga0111539_10287674 3300009094 Bacteria 1913
129 Ga0111539_10369473 3300009094 Bacteria 1669
130 Ga0105245_10004564 3300009098 Bacteria 12224
131 Ga0114129_10004560 3300009147 Bacteria 19550
132 Ga0114129_10116947 3300009147 Bacteria 3674
133 Ga0114129_10935822 3300009147 Bacteria 1096
134 Ga0114129_11349571 3300009147 Bacteria 882
135 Ga0105243_10002776 3300009148 Bacteria 14554
136 Ga0105243_10103611 3300009148 Bacteria 2366
137 Ga0105241_10036122 3300009174 Bacteria 3718
138 Ga0105242_10004524 3300009176 Bacteria 10801
139 Ga0105249_10020144 3300009553 Bacteria 5959
140 Ga0105249_10064105 3300009553 Bacteria 3377
141 Ga0157378_10001361 3300013297 Bacteria 21960
142 Ga0157375_10573741 3300013308 Bacteria 1289
143 Ga0157375_11025424 3300013308 Bacteria 964
144 Ga0157380_10035322 3300014326 Bacteria 3861
145 Ga0157380_10206015 3300014326 Bacteria 1749
146 Ga0157377_10020255 3300014745 Bacteria 3482
147 Ga0157377_10118642 3300014745 Bacteria 1600
148 Ga0157379_10455443 3300014968 Bacteria 1182
149 Ga0157376_10229808 3300014969 Bacteria 1722
150 Ga0207642_10002238 3300025899 Bacteria 6009
151 Ga0207642_10114566 3300025899 Bacteria 1379
152 Ga0207688_10174561 3300025901 Bacteria 1279
153 Ga0207680_10638706 3300025903 Bacteria 762
154 Ga0207647_10155417 3300025904 Bacteria 1336
155 Ga0207645_10085420 3300025907 Bacteria 2026
156 Ga0207643_10039440 3300025908 Bacteria 2657
157 Ga0207684_10636693 3300025910 Bacteria 909
158 Ga0207654_10017542 3300025911 Bacteria 3745
159 Ga0207707_10007157 3300025912 Bacteria 9714
160 Ga0207695_10318065 3300025913 Bacteria 1446
161 Ga0207660_10003778 3300025917 Bacteria 9862
162 Ga0207660_10301771 3300025917 Bacteria 1275
163 Ga0207662_10006285 3300025918 Bacteria 6399
164 Ga0207652_10003435 3300025921 Bacteria 13073
165 Ga0207652_10097040 3300025921 Bacteria 2597
166 Ga0207646_10127766 3300025922 Bacteria 2286
167 Ga0207681_10036977 3300025923 Bacteria 3224
168 Ga0207681_10411562 3300025923 Bacteria 1094
169 Ga0207687_10006145 3300025927 Bacteria 7944
170 Ga0207686_10001108 3300025934 Bacteria 15680
171 Ga0207709_10000686 3300025935 Bacteria 27320
172 Ga0207709_10031001 3300025935 Bacteria 3117
173 Ga0207670_10000865 3300025936 Bacteria 15917
174 Ga0207670_10054996 3300025936 Bacteria 2688
175 Ga0207670_10187253 3300025936 Bacteria 1563
176 Ga0207669_10064683 3300025937 Bacteria 2265
177 Ga0207704_10025764 3300025938 Bacteria 3214
178 Ga0207704_10347202 3300025938 Bacteria 1154
179 Ga0207665_10079986 3300025939 Bacteria 2248
180 Ga0207665_10261679 3300025939 Bacteria 1282
181 Ga0207691_10051405 3300025940 Bacteria 3767
182 Ga0207711_10465684 3300025941 Bacteria 1177
183 Ga0207689_10000217 3300025942 Bacteria 51018
184 Ga0207689_10075315 3300025942 Bacteria 2774
185 Ga0207661_10228775 3300025944 Bacteria 1646
186 Ga0207667_10007910 3300025949 Bacteria 12695
187 Ga0207667_10288406 3300025949 Bacteria 1677
188 Ga0207651_10069971 3300025960 Bacteria 2480
189 Ga0207712_10001713 3300025961 Bacteria 14726
190 Ga0207712_10323801 3300025961 Bacteria 1273
191 Ga0207668_10198308 3300025972 Bacteria 1596
192 Ga0207640_10010437 3300025981 Bacteria 5233
193 Ga0207677_10000917 3300026023 Bacteria 16496
194 Ga0207703_10002068 3300026035 Bacteria 17657
195 Ga0207703_10243462 3300026035 Bacteria 1618
196 Ga0207639_10123157 3300026041 Bacteria 2134
197 Ga0207708_10003928 3300026075 Bacteria 10942
198 Ga0207708_10195133 3300026075 Bacteria 1613
199 Ga0207708_10633109 3300026075 Bacteria 909
200 Ga0207702_10072836 3300026078 Bacteria 2962
201 Ga0207641_10217491 3300026088 Bacteria 1770
202 Ga0207641_10666547 3300026088 Bacteria 1023
203 Ga0207648_10000217 3300026089 Bacteria 62158
204 Ga0207648_10000816 3300026089 Bacteria 35242
205 Ga0207648_10654080 3300026089 Bacteria 971
206 Ga0207676_10522223 3300026095 Bacteria 1130
207 Ga0207674_10228050 3300026116 Bacteria 1811
208 Ga0207675_100000310 3300026118 Bacteria 46701
209 Ga0207675_100205391 3300026118 Bacteria 1893
210 Ga0207675_100205782 3300026118 Bacteria 1891
211 Ga0207675_100507270 3300026118 Bacteria 1201
212 Ga0207698_10031394 3300026142 Bacteria 3833
213 Ga0209969_1003469 3300027360 Bacteria 2184
214 Ga0209967_1004401 3300027364 Bacteria 1872
215 Ga0209981_1006278 3300027378 Bacteria 1588
216 Ga0209981_1012872 3300027378 Bacteria 1161
217 Ga0210000_1002107 3300027462 Bacteria 2821
218 Ga0210000_1006522 3300027462 Bacteria 1699
219 Ga0209999_1000612 3300027543 Bacteria 5675
220 Ga0209999_1011004 3300027543 Bacteria 1636
221 Ga0209966_1028821 3300027695 Bacteria 1116
222 Ga0209974_10009686 3300027876 Bacteria 3268
223 Ga0207428_10011517 3300027907 Bacteria 7811
224 Ga0207428_10029446 3300027907 Bacteria 4551
225 Ga0207428_10171755 3300027907 Bacteria 1641
226 Ga0207428_10262383 3300027907 Bacteria 1286
227 Ga0268265_10039821 3300028380 Bacteria 3466
228 Ga0268265_10060184 3300028380 Bacteria 2909
229 Ga0268264_10002238 3300028381 Bacteria 17153
230 Ga0307408_100108868 3300031548 Bacteria 2125
231 Ga0316579_10002937 3300031691 Bacteria 6546
232 Ga0307409_100257649 3300031995 Bacteria 1599
233 Ga0307416_101230850 3300032002 Bacteria 854
234 Ga0307411_10042696 3300032005 Bacteria 2896
235 Ga0316583_10012156 3300032133 Bacteria 3106
236 Ga0316583_10035681 3300032133 Bacteria 1764
237 Ga0373930_0024891 3300034816 Bacteria 1199
238 Ga0373950_0002561 3300034818 Bacteria 2512
239 Ga0373950_0016185 3300034818 Bacteria 1273
240 Ga0373958_0002738 3300034819 Bacteria 2497
241 Ga0373938_0002959 3300034957 Bacteria 2749
242 Ga0373928_0003487 3300035084 Bacteria 2996
243 Ga0373934_0136797 3300035086 Bacteria 1001
244 Ga0373940_0000894 3300035088 Bacteria 5020
245 Ga0373944_0011798 3300035089 Bacteria 2399
246 Ga0373949_0005225 3300035090 Bacteria 2908
247 Ga0373952_0012536 3300035092 Bacteria 1670
248 Ga0373932_0000678 3300035112 Bacteria 10295
249 Ga0373936_0197074 3300035113 Bacteria 888
250 Ga0373939_0002206 3300035114 Bacteria 4610
251 Ga0373945_0003807 3300035116 Bacteria 4764
252 Ga0373954_0000008 3300035118 Bacteria 79963
253 Ga0373960_0009094 3300035121 Bacteria 2398
254 Ga0373946_0036179 3300035171 Bacteria 2000
255 Ga0373955_0321326 3300035172 Bacteria 935
256 Ga0373942_0064104 3300035207 Bacteria 1059
257 Ga0373961_0032716 3300035241 Bacteria 1460
258 Ga0373924_0138462 3300035410 Bacteria 1061
259 Ga0373931_0030653 3300035691 Bacteria 2770
260 Ga0373931_0153431 3300035691 Bacteria 1344
261 Ga0373931_0179369 3300035691 Bacteria 1253
262 Ga0373935_0107216 3300035692 Bacteria 1849
263 Ga0373947_0060900 3300035725 Bacteria 2292
264 Ga0316582_0049026 3300036647 Bacteria 2671
265 Ga0316581_0007174 3300037588 Bacteria 2981
266 Ga0439443_000599 3300042003 Bacteria 3367
267 Ga0439434_0000496 3300042435 Bacteria 11188
268 Ga0439435_0001072 3300042436 Bacteria 4849
269 Ga0439435_0004397 3300042436 Bacteria 3032
270 Ga0439444_0001255 3300042437 Bacteria 3231
271 Ga0439444_0012379 3300042437 Bacteria 1397
272 Ga0439460_0000144 3300042461 Bacteria 12838
273 Ga0466957_0077793 3300044842 Bacteria 2062
274 Ga0451576_0000360 3300045051 Bacteria 109145
275 Ga0451576_0028622 3300045051 Bacteria 5965
276 Ga0451576_0030529 3300045051 Bacteria 5758
277 Ga0451576_0106030 3300045051 Bacteria 2924
278 Ga0466967_0027892 3300045976 Bacteria 4705
279 Ga0495629_0166591 3300046459 Bacteria 1530
280 Ga0495580_0004091 3300046472 Bacteria 12296
281 Ga0495639_0015213 3300046475 Bacteria 3334
282 Ga0495639_0263510 3300046475 Bacteria 854
283 Ga0495662_0022756 3300046476 Bacteria 3025
284 Ga0495662_0035581 3300046476 Bacteria 2403
285 Ga0495584_0048837 3300046491 Bacteria 2133
286 Ga0495608_0062411 3300046511 Bacteria 2448
287 Ga0495628_0041974 3300046516 Bacteria 3650
288 Ga0495628_0139228 3300046516 Bacteria 1852
289 Ga0495630_0233942 3300046517 Bacteria 1404
290 Ga0495652_0132933 3300046529 Bacteria 1967
291 Ga0495652_0253764 3300046529 Bacteria 1302
292 Ga0495586_0045970 3300046535 Bacteria 2353
293 Ga0495587_0007969 3300046536 Bacteria 6844
294 Ga0495621_0051479 3300046539 Bacteria 1474
295 Ga0495645_0045056 3300046543 Bacteria 3218
296 Ga0495656_0076787 3300046615 Bacteria 1497
297 Ga0495634_0006671 3300046642 Bacteria 8750
298 Ga0495634_0157411 3300046642 Bacteria 1434
299 Ga0495635_0033744 3300046663 Bacteria 3550
300 Ga0495635_0082107 3300046663 Bacteria 2205
301 Ga0495659_0029605 3300046664 Bacteria 1902
302 Ga0495588_0194291 3300046674 Bacteria 1072
303 Ga0495647_0140781 3300046681 Bacteria 1028
304 Ga0495658_0079965 3300046683 Bacteria 1916
305 Ga0495669_0030124 3300046684 Bacteria 2382
306 Ga0495624_0061494 3300046690 Bacteria 2353
307 Ga0495670_0127338 3300046691 Bacteria 1326
308 Ga0495600_0006148 3300046809 Bacteria 7276
309 Ga0495581_0074453 3300047315 Bacteria 1965
310 Ga0495604_0039764 3300047317 Bacteria 3695
311 Ga0495674_0031444 3300047319 Bacteria 4822
312 Ga0495680_0482761 3300047322 Bacteria 844
313 Ga0495675_0135991 3300047444 Bacteria 1526
314 Ga0495684_0187720 3300047471 Bacteria 1530
315 Ga0495593_0179036 3300047673 Bacteria 1068
316 Ga0501031_0022344 3300049568 Bacteria 4123
317 Ga0501031_0196867 3300049568 Bacteria 1315
318 Ga0501032_0057616 3300049569 Bacteria 2610
319 Ga0501033_0011677 3300049570 Bacteria 6716
320 Ga0501034_0292022 3300049571 Bacteria 1568
321 Ga0501036_0002300 3300049572 Bacteria 14940
322 Ga0501036_0215253 3300049572 Bacteria 1614
323 Ga0501037_0018828 3300049573 Bacteria 5087
324 Ga0501038_0009701 3300049574 Bacteria 8827
325 Ga0501039_0009384 3300049575 Bacteria 7458
326 Ga0501039_0020770 3300049575 Bacteria 5033
327 Ga0501039_0058438 3300049575 Bacteria 2987
328 Ga0501039_0163287 3300049575 Bacteria 1751
329 Ga0501040_0009441 3300049576 Bacteria 6361
330 Ga0501040_0014204 3300049576 Bacteria 5243
331 Ga0501041_0001358 3300049577 Bacteria 13489
332 Ga0501041_0033063 3300049577 Bacteria 3127
333 Ga0501041_0148943 3300049577 Bacteria 1461
334 Ga0501041_0177263 3300049577 Bacteria 1334
335 Ga0501042_0001293 3300049578 Bacteria 14587
336 Ga0501042_0015975 3300049578 Bacteria 5150
337 Ga0501042_0172210 3300049578 Bacteria 1562
338 Ga0501042_0316311 3300049578 Unclassified 1128
339 Ga0501042_0679188 3300049578 Unclassified 749
340 Ga0501043_0013889 3300049579 Bacteria 6301
341 Ga0501046_0005727 3300049580 Bacteria 11088
342 Ga0501046_0095114 3300049580 Bacteria 2289
343 Ga0501047_0578497 3300049581 Bacteria 946
344 Ga0501048_0027533 3300049582 Bacteria 4130
345 Ga0501048_0028373 3300049582 Bacteria 4061
346 Ga0501048_0036375 3300049582 Bacteria 3539
347 Ga0501048_0128457 3300049582 Bacteria 1792
348 Ga0501068_0483704 3300049584 Bacteria 802
349 Ga0501070_0106334 3300049586 Bacteria 2319
350 Ga0501071_0028984 3300049587 Bacteria 3904
351 Ga0501071_0166364 3300049587 Bacteria 1650
352 Ga0501071_0415662 3300049587 Bacteria 1028
353 Ga0501072_0001780 3300049588 Bacteria 16027
354 Ga0501072_0003058 3300049588 Bacteria 12610
355 Ga0501072_0017876 3300049588 Bacteria 5453
356 Ga0501072_0178352 3300049588 Bacteria 1695
357 Ga0501072_0739681 3300049588 Unclassified 772
358 Ga0501073_0046768 3300049589 Bacteria 3042
359 Ga0501074_0027474 3300049590 Bacteria 4126
360 Ga0501074_0193210 3300049590 Bacteria 1451
361 Ga0501075_0004284 3300049591 Bacteria 9643
362 Ga0501075_0005102 3300049591 Bacteria 8972
363 Ga0501075_0061185 3300049591 Bacteria 2837
364 Ga0501075_0089214 3300049591 Bacteria 2338
365 Ga0501075_0297804 3300049591 Bacteria 1229
366 Ga0501076_0001146 3300049592 Bacteria 17555
367 Ga0501076_0012080 3300049592 Bacteria 6453
368 Ga0501077_0003582 3300049593 Bacteria 9330
369 Ga0501217_092890 3300049661 Bacteria 849
370 Ga0501233_052833 3300049668 Bacteria 989
371 Ga0501079_0002542 3300049741 Bacteria 13241
372 Ga0501079_0051044 3300049741 Bacteria 3192
373 Ga0501079_0115225 3300049741 Bacteria 2089
374 Ga0501080_0007707 3300049742 Bacteria 9731
375 Ga0501080_0549699 3300049742 Bacteria 1028
376 Ga0501081_0000579 3300049743 Bacteria 20804
377 Ga0501081_0033497 3300049743 Bacteria 3491
378 Ga0501083_0028440 3300049744 Bacteria 3852
379 Ga0501283_019906 3300049779 Bacteria 1065
380 Ga0501035_0083336 3300049822 Bacteria 2821
381 Ga0501035_0103238 3300049822 Bacteria 2501
382 Ga0501045_0019729 3300049824 Bacteria 4809
383 nmdc:mga05p37_1043143_c1 3300050507 Bacteria 863
384 nmdc:mga05p37_154965_c1 3300050507 Bacteria 2800
385 nmdc:mga05p37_609947_c1 3300050507 Bacteria 1230
386 nmdc:mga05p37_702084_c1 3300050507 Bacteria 1123
387 nmdc:mga09592_194108_c1 3300050508 Bacteria 1757
388 nmdc:mga09592_368978_c1 3300050508 Bacteria 1242
389 nmdc:mga09592_724026_c1 3300050508 Bacteria 846
390 nmdc:mga09592_9976_c1 3300050508 Bacteria 7726
391 nmdc:mga0qj67_167706_c1 3300050509 Bacteria 1783
392 nmdc:mga0qj67_2803_c1 3300050509 Bacteria 12499
393 nmdc:mga0qj67_495514_c1 3300050509 Bacteria 982
394 nmdc:mga0qj67_497637_c1 3300050509 Unclassified 980
395 nmdc:mga0qj67_52524_c1 3300050509 Bacteria 3226
396 nmdc:mga06r32_185013_c1 3300050510 Bacteria 2070
397 nmdc:mga06r32_19382_c1 3300050510 Bacteria 6241
398 nmdc:mga08y16_117320_c1 3300050511 Bacteria 2771
399 nmdc:mga08y16_20871_c1 3300050511 Bacteria 6917
400 nmdc:mga08y16_25161_c1 3300050511 Bacteria 6278
401 nmdc:mga08y16_647095_c1 3300050511 Bacteria 1062
402 nmdc:mga0n895_15776_c1 3300050512 Bacteria 6906
403 nmdc:mga0n895_179460_c1 3300050512 Bacteria 2149
404 nmdc:mga0n895_505309_c1 3300050512 Bacteria 1217
405 nmdc:mga0n895_88_c1 3300050512 Bacteria 53153
406 nmdc:mga0n895_92402_c1 3300050512 Bacteria 3029
407 nmdc:mga0rr50_1557_c1 3300050513 Bacteria 12644
408 nmdc:mga0rr50_3083_c1 3300050513 Bacteria 9540
409 nmdc:mga0rr50_3305_c1 3300050513 Bacteria 9258
410 nmdc:mga0rr50_404177_c1 3300050513 Unclassified 1154
411 nmdc:mga0rr50_812231_c1 3300050513 Bacteria 798
412 nmdc:mga08x19_1086_c1 3300050514 Bacteria 16965
413 nmdc:mga08x19_17002_c1 3300050514 Bacteria 4445
414 nmdc:mga08x19_24453_c1 3300050514 Bacteria 3754
415 nmdc:mga08x19_409844_c1 3300050514 Bacteria 951
416 nmdc:mga08x19_63171_c1 3300050514 Bacteria 2402
417 nmdc:mga08x19_83654_c1 3300050514 Bacteria 2098
418 nmdc:mga0a205_1767_c1 3300050515 Bacteria 18718
419 nmdc:mga0a205_67487_c1 3300050515 Bacteria 3455
420 Ga0495601_0031614 3300053077 Bacteria 3290
421 Ga0501084_0003157 3300054114 Bacteria 13329
422 Ga0501084_0055456 3300054114 Bacteria 3315
423 Ga0590075_033226 3300059424 Unclassified 1310
424 Ga0590077_003015 3300059426 Bacteria 3526
425 Ga0501082_0009700 3300060353 Bacteria 8289
426 Ga0501082_0349525 3300060353 Bacteria 1289
427 Ga0530510_0317605 3300061734 Bacteria 1167

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300007076 Ga0075435_100008212 Ga0075435_1000082122 189
2 3300050513 nmdc:mga0rr50_3305_c1 nmdc:mga0rr50_3305_c1_1157_1762 189
3 3300006844 Ga0075428_100198718 Ga0075428_1001987183 198
4 3300006847 Ga0075431_100041055 Ga0075431_1000410556 198
5 3300006880 Ga0075429_100143460 Ga0075429_1001434602 198
6 3300009147 Ga0114129_10116947 Ga0114129_101169472 198
7 3300050507 nmdc:mga05p37_154965_c1 nmdc:mga05p37_154965_c1_1602_2198 198
8 3300050510 nmdc:mga06r32_185013_c1 nmdc:mga06r32_185013_c1_128_724 198
9 3300025938 Ga0207704_10347202 Ga0207704_103472022 199
10 3300049587 Ga0501071_0415662 Ga0501071_0415662_172_771 199
11 3300009147 Ga0114129_11349571 Ga0114129_113495711 200
12 3300050507 nmdc:mga05p37_1043143_c1 nmdc:mga05p37_1043143_c1_219_845 200
13 3300027360 Ga0209969_1003469 Ga0209969_10034693 201
14 3300027364 Ga0209967_1004401 Ga0209967_10044013 201
15 3300027378 Ga0209981_1012872 Ga0209981_10128722 201
16 3300027462 Ga0210000_1006522 Ga0210000_10065222 201
17 3300027543 Ga0209999_1000612 Ga0209999_10006125 201
18 3300035207 Ga0373942_0064104 Ga0373942_0064104_21_629 202
19 3300009094 Ga0111539_10132908 Ga0111539_101329082 203
20 3300035113 Ga0373936_0197074 Ga0373936_0197074_255_866 203
21 3300042435 Ga0439434_0000496 Ga0439434_0000496_4441_5052 203
22 3300046459 Ga0495629_0166591 Ga0495629_0166591_389_1000 203
23 3300046476 Ga0495662_0022756 Ga0495662_0022756_574_1185 203
24 3300046516 Ga0495628_0041974 Ga0495628_0041974_1165_1776 203
25 3300046529 Ga0495652_0253764 Ga0495652_0253764_216_827 203
26 3300046642 Ga0495634_0157411 Ga0495634_0157411_576_1187 203
27 3300046663 Ga0495635_0033744 Ga0495635_0033744_2671_3282 203
28 3300046690 Ga0495624_0061494 Ga0495624_0061494_522_1133 203
29 3300047673 Ga0495593_0179036 Ga0495593_0179036_378_989 203
30 3300035691 Ga0373931_0153431 Ga0373931_0153431_120_740 206
31 3300049584 Ga0501068_0483704 Ga0501068_0483704_39_695 207
32 3300049588 Ga0501072_0003058 Ga0501072_0003058_1302_1958 207
33 3300049591 Ga0501075_0061185 Ga0501075_0061185_1153_1809 207
34 3300049741 Ga0501079_0115225 Ga0501079_0115225_1037_1693 207
35 3300060353 Ga0501082_0349525 Ga0501082_0349525_299_955 207
36 3300005440 Ga0070705_100030209 Ga0070705_1000302093 208
37 3300006871 Ga0075434_100083518 Ga0075434_1000835183 208
38 3300050512 nmdc:mga0n895_179460_c1 nmdc:mga0n895_179460_c1_1300_1926 208
39 3300047322 Ga0495680_0482761 Ga0495680_0482761_190_831 213
40 3300005330 Ga0070690_100175193 Ga0070690_1001751932 217
41 3300005468 Ga0070707_100941500 Ga0070707_1009415001 217
42 3300005544 Ga0070686_100179684 Ga0070686_1001796842 217
43 3300046475 Ga0495639_0263510 Ga0495639_0263510_89_742 217
44 3300046476 Ga0495662_0035581 Ga0495662_0035581_1406_2059 217
45 3300046511 Ga0495608_0062411 Ga0495608_0062411_1404_2057 217
46 3300046516 Ga0495628_0139228 Ga0495628_0139228_1054_1707 217
47 3300046529 Ga0495652_0132933 Ga0495652_0132933_1194_1847 217
48 3300046536 Ga0495587_0007969 Ga0495587_0007969_6090_6743 217
49 3300046543 Ga0495645_0045056 Ga0495645_0045056_1385_2038 217
50 3300046642 Ga0495634_0006671 Ga0495634_0006671_6192_6845 217
51 3300046663 Ga0495635_0082107 Ga0495635_0082107_1142_1795 217
52 3300046809 Ga0495600_0006148 Ga0495600_0006148_5571_6224 217
53 3300047317 Ga0495604_0039764 Ga0495604_0039764_1348_2001 217
54 3300047319 Ga0495674_0031444 Ga0495674_0031444_4086_4739 217
55 3300047444 Ga0495675_0135991 Ga0495675_0135991_385_1038 217
56 3300047471 Ga0495684_0187720 Ga0495684_0187720_601_1254 217
57 3300053077 Ga0495601_0031614 Ga0495601_0031614_1593_2246 217
58 3300049575 Ga0501039_0058438 Ga0501039_0058438_1186_1842 218
59 3300049577 Ga0501041_0033063 Ga0501041_0033063_1286_1942 218
60 3300049578 Ga0501042_0015975 Ga0501042_0015975_2411_3067 218
61 3300049580 Ga0501046_0095114 Ga0501046_0095114_622_1278 218
62 3300049582 Ga0501048_0027533 Ga0501048_0027533_2811_3467 218
63 3300049587 Ga0501071_0166364 Ga0501071_0166364_264_920 218
64 3300049591 Ga0501075_0004284 Ga0501075_0004284_2481_3137 218
65 3300049592 Ga0501076_0012080 Ga0501076_0012080_4349_5005 218
66 3300049741 Ga0501079_0051044 Ga0501079_0051044_1779_2435 218
67 3300049742 Ga0501080_0549699 Ga0501080_0549699_159_815 218
68 3300049743 Ga0501081_0033497 Ga0501081_0033497_19_675 218
69 3300049779 Ga0501283_019906 Ga0501283_019906_324_980 218
70 3300049822 Ga0501035_0103238 Ga0501035_0103238_605_1261 218
71 3300054114 Ga0501084_0003157 Ga0501084_0003157_8833_9489 218
72 3300005444 Ga0070694_100253270 Ga0070694_1002532701 220
73 3300005549 Ga0070704_100185934 Ga0070704_1001859342 221
74 3300005985 Ga0081539_10009825 Ga0081539_1000982510 222
75 3300035118 Ga0373954_0000008 Ga0373954_0000008_22334_23002 222
76 3300005545 Ga0070695_100097056 Ga0070695_1000970562 223
77 3300005546 Ga0070696_100196224 Ga0070696_1001962242 223
78 3300006871 Ga0075434_100000233 Ga0075434_1000002335 223
79 3300007076 Ga0075435_100013896 Ga0075435_1000138967 223
80 3300046539 Ga0495621_0051479 Ga0495621_0051479_392_1099 223
81 3300050512 nmdc:mga0n895_88_c1 nmdc:mga0n895_88_c1_24720_25427 223
82 3300050513 nmdc:mga0rr50_1557_c1 nmdc:mga0rr50_1557_c1_7297_8004 223
83 3300005334 Ga0068869_100154533 Ga0068869_1001545332 225
84 3300005530 Ga0070679_100315144 Ga0070679_1003151442 225
85 3300005546 Ga0070696_100288460 Ga0070696_1002884601 225
86 3300025912 Ga0207707_10007157 Ga0207707_100071573 225
87 3300025921 Ga0207652_10097040 Ga0207652_100970405 225
88 3300007265 Ga0099794_10056532 Ga0099794_100565322 226
89 3300046475 Ga0495639_0015213 Ga0495639_0015213_10_693 226
90 3300027876 Ga0209974_10009686 Ga0209974_100096865 227
91 3300035691 Ga0373931_0179369 Ga0373931_0179369_499_1209 227
92 3300042436 Ga0439435_0004397 Ga0439435_0004397_586_1269 227
93 3300042437 Ga0439444_0012379 Ga0439444_0012379_17_700 227
94 3300050507 nmdc:mga05p37_702084_c1 nmdc:mga05p37_702084_c1_203_886 227
95 3300050508 nmdc:mga09592_368978_c1 nmdc:mga09592_368978_c1_248_931 227
96 3300005549 Ga0070704_100132876 Ga0070704_1001328763 228
97 3300027543 Ga0209999_1011004 Ga0209999_10110042 228
98 3300050509 nmdc:mga0qj67_52524_c1 nmdc:mga0qj67_52524_c1_2485_3171 228
99 3300050511 nmdc:mga08y16_117320_c1 nmdc:mga08y16_117320_c1_1457_2143 228
100 3300050511 nmdc:mga08y16_20871_c1 nmdc:mga08y16_20871_c1_6212_6898 228
101 3300034957 Ga0373938_0002959 Ga0373938_0002959_978_1688 229
102 3300042003 Ga0439443_000599 Ga0439443_000599_1050_1742 230
103 3300042436 Ga0439435_0001072 Ga0439435_0001072_2814_3506 230
104 3300042437 Ga0439444_0001255 Ga0439444_0001255_1599_2291 230
105 3300042461 Ga0439460_0000144 Ga0439460_0000144_8218_8910 230
106 3300005615 Ga0070702_100094192 Ga0070702_1000941923 231
107 3300005841 Ga0068863_100516645 Ga0068863_1005166452 231
108 3300013308 Ga0157375_11025424 Ga0157375_110254241 231
109 3300025941 Ga0207711_10465684 Ga0207711_104656842 231
110 3300045051 Ga0451576_0106030 Ga0451576_0106030_1968_2696 231
111 3300050511 nmdc:mga08y16_25161_c1 nmdc:mga08y16_25161_c1_1118_1846 231
112 3300005439 Ga0070711_100601798 Ga0070711_1006017981 232
113 3300005329 Ga0070683_100216905 Ga0070683_1002169052 233
114 3300005458 Ga0070681_10161219 Ga0070681_101612192 233
115 3300025944 Ga0207661_10228775 Ga0207661_102287752 233
116 3300044842 Ga0466957_0077793 Ga0466957_0077793_1102_1803 233
117 3300045976 Ga0466967_0027892 Ga0466967_0027892_21_722 233
118 3300005440 Ga0070705_100008417 Ga0070705_1000084177 234
119 3300005467 Ga0070706_100185664 Ga0070706_1001856642 234
120 3300005518 Ga0070699_100027677 Ga0070699_1000276772 234
121 3300005536 Ga0070697_100019407 Ga0070697_1000194077 234
122 3300005545 Ga0070695_100014917 Ga0070695_1000149172 234
123 3300005546 Ga0070696_100028581 Ga0070696_1000285812 234
124 3300005549 Ga0070704_100667923 Ga0070704_1006679231 234
125 3300006173 Ga0070716_100070269 Ga0070716_1000702692 234
126 3300006914 Ga0075436_100006211 Ga0075436_1000062113 234
127 3300006914 Ga0075436_100014377 Ga0075436_1000143771 234
128 3300006914 Ga0075436_100201455 Ga0075436_1002014551 234
129 3300007076 Ga0075435_100423556 Ga0075435_1004235562 234
130 3300007076 Ga0075435_100845030 Ga0075435_1008450302 234
131 3300025939 Ga0207665_10079986 Ga0207665_100799862 234
132 3300032002 Ga0307416_101230850 Ga0307416_1012308501 234
133 3300050512 nmdc:mga0n895_505309_c1 nmdc:mga0n895_505309_c1_474_1178 234
134 3300050513 nmdc:mga0rr50_404177_c1 nmdc:mga0rr50_404177_c1_63_767 234
135 3300050513 nmdc:mga0rr50_812231_c1 nmdc:mga0rr50_812231_c1_26_730 234
136 3300050514 nmdc:mga08x19_17002_c1 nmdc:mga08x19_17002_c1_2689_3393 234
137 3300050514 nmdc:mga08x19_24453_c1 nmdc:mga08x19_24453_c1_357_1061 234
138 3300050514 nmdc:mga08x19_63171_c1 nmdc:mga08x19_63171_c1_1284_1988 234
139 3300050514 nmdc:mga08x19_83654_c1 nmdc:mga08x19_83654_c1_131_835 234
140 3300005437 Ga0070710_10060221 Ga0070710_100602214 235
141 3300005459 Ga0068867_100698287 Ga0068867_1006982871 235
142 3300005468 Ga0070707_100144459 Ga0070707_1001444595 235
143 3300006871 Ga0075434_100052805 Ga0075434_1000528052 235
144 3300025910 Ga0207684_10636693 Ga0207684_106366932 235
145 3300025922 Ga0207646_10127766 Ga0207646_101277662 235
146 3300026089 Ga0207648_10654080 Ga0207648_106540802 235
147 3300031548 Ga0307408_100108868 Ga0307408_1001088682 235
148 3300032005 Ga0307411_10042696 Ga0307411_100426962 235
149 3300049578 Ga0501042_0316311 Ga0501042_0316311_26_733 235
150 3300050512 nmdc:mga0n895_92402_c1 nmdc:mga0n895_92402_c1_2222_2929 235
151 3300050514 nmdc:mga08x19_409844_c1 nmdc:mga08x19_409844_c1_193_900 235
152 3300050515 nmdc:mga0a205_67487_c1 nmdc:mga0a205_67487_c1_1220_1927 235
153 3300059424 Ga0590075_033226 Ga0590075_033226_546_1253 235
154 3300059426 Ga0590077_003015 Ga0590077_003015_2052_2759 235
155 3300005330 Ga0070690_100000653 Ga0070690_10000065317 236
156 3300005334 Ga0068869_100001162 Ga0068869_1000011628 236
157 3300005336 Ga0070680_100000316 Ga0070680_10000031621 236
158 3300005336 Ga0070680_100110601 Ga0070680_1001106013 236
159 3300005337 Ga0070682_100007142 Ga0070682_1000071429 236
160 3300005338 Ga0068868_100038847 Ga0068868_1000388472 236
161 3300005340 Ga0070689_100000894 Ga0070689_10000089410 236
162 3300005341 Ga0070691_10000398 Ga0070691_1000039817 236
163 3300005343 Ga0070687_100000276 Ga0070687_1000002768 236
164 3300005343 Ga0070687_100158976 Ga0070687_1001589761 236
165 3300005353 Ga0070669_100685048 Ga0070669_1006850481 236
166 3300005355 Ga0070671_100134215 Ga0070671_1001342154 236
167 3300005356 Ga0070674_100311188 Ga0070674_1003111882 236
168 3300005364 Ga0070673_100039558 Ga0070673_1000395583 236
169 3300005438 Ga0070701_10000423 Ga0070701_1000042313 236
170 3300005440 Ga0070705_100000386 Ga0070705_10000038621 236
171 3300005440 Ga0070705_100019940 Ga0070705_1000199403 236
172 3300005441 Ga0070700_100000506 Ga0070700_10000050618 236
173 3300005444 Ga0070694_100001289 Ga0070694_1000012899 236
174 3300005444 Ga0070694_100007869 Ga0070694_1000078692 236
175 3300005445 Ga0070708_100404042 Ga0070708_1004040422 236
176 3300005459 Ga0068867_100001833 Ga0068867_10000183317 236
177 3300005518 Ga0070699_100416455 Ga0070699_1004164552 236
178 3300005530 Ga0070679_100006030 Ga0070679_10000603010 236
179 3300005530 Ga0070679_100848214 Ga0070679_1008482141 236
180 3300005539 Ga0068853_100061000 Ga0068853_1000610002 236
181 3300005543 Ga0070672_100235124 Ga0070672_1002351242 236
182 3300005544 Ga0070686_100000744 Ga0070686_1000007449 236
183 3300005545 Ga0070695_100000250 Ga0070695_10000025014 236
184 3300005545 Ga0070695_100026767 Ga0070695_1000267673 236
185 3300005546 Ga0070696_100000358 Ga0070696_10000035816 236
186 3300005546 Ga0070696_100131923 Ga0070696_1001319232 236
187 3300005547 Ga0070693_100000395 Ga0070693_10000039511 236
188 3300005549 Ga0070704_100000203 Ga0070704_10000020320 236
189 3300005549 Ga0070704_100002499 Ga0070704_1000024995 236
190 3300005563 Ga0068855_100001461 Ga0068855_10000146119 236
191 3300005614 Ga0068856_100007042 Ga0068856_10000704211 236
192 3300005615 Ga0070702_100000049 Ga0070702_1000000499 236
193 3300005617 Ga0068859_100012357 Ga0068859_10001235711 236
194 3300005617 Ga0068859_100074658 Ga0068859_1000746586 236
195 3300005618 Ga0068864_100614563 Ga0068864_1006145631 236
196 3300005718 Ga0068866_10002274 Ga0068866_100022742 236
197 3300005719 Ga0068861_100000724 Ga0068861_10000072419 236
198 3300005719 Ga0068861_100276401 Ga0068861_1002764012 236
199 3300005719 Ga0068861_100401252 Ga0068861_1004012522 236
200 3300005840 Ga0068870_10040159 Ga0068870_100401592 236
201 3300005841 Ga0068863_100731096 Ga0068863_1007310962 236
202 3300005842 Ga0068858_100001186 Ga0068858_10000118617 236
203 3300005842 Ga0068858_100091462 Ga0068858_1000914624 236
204 3300005843 Ga0068860_100008599 Ga0068860_1000085997 236
205 3300005844 Ga0068862_100001819 Ga0068862_10000181918 236
206 3300005844 Ga0068862_100052973 Ga0068862_1000529732 236
207 3300006237 Ga0097621_100000594 Ga0097621_10000059419 236
208 3300006358 Ga0068871_100000636 Ga0068871_10000063620 236
209 3300006844 Ga0075428_100042180 Ga0075428_1000421802 236
210 3300006844 Ga0075428_100658006 Ga0075428_1006580062 236
211 3300006846 Ga0075430_100000874 Ga0075430_10000087418 236
212 3300006847 Ga0075431_100244936 Ga0075431_1002449362 236
213 3300006871 Ga0075434_100004674 Ga0075434_1000046743 236
214 3300006880 Ga0075429_100012563 Ga0075429_1000125639 236
215 3300006881 Ga0068865_100000086 Ga0068865_10000008622 236
216 3300006914 Ga0075436_100003384 Ga0075436_10000338413 236
217 3300006931 Ga0097620_100012357 Ga0097620_1000123574 236
218 3300006931 Ga0097620_100074659 Ga0097620_1000746596 236
219 3300007076 Ga0075435_100004201 Ga0075435_1000042013 236
220 3300009094 Ga0111539_10145499 Ga0111539_101454992 236
221 3300009094 Ga0111539_10196393 Ga0111539_101963931 236
222 3300009094 Ga0111539_10369473 Ga0111539_103694732 236
223 3300009098 Ga0105245_10004564 Ga0105245_1000456411 236
224 3300009147 Ga0114129_10004560 Ga0114129_1000456023 236
225 3300009147 Ga0114129_10935822 Ga0114129_109358222 236
226 3300009148 Ga0105243_10002776 Ga0105243_1000277614 236
227 3300009174 Ga0105241_10036122 Ga0105241_100361222 236
228 3300009176 Ga0105242_10004524 Ga0105242_100045248 236
229 3300009553 Ga0105249_10020144 Ga0105249_100201449 236
230 3300013297 Ga0157378_10001361 Ga0157378_100013619 236
231 3300014326 Ga0157380_10035322 Ga0157380_100353227 236
232 3300014745 Ga0157377_10118642 Ga0157377_101186422 236
233 3300014968 Ga0157379_10455443 Ga0157379_104554432 236
234 3300014969 Ga0157376_10229808 Ga0157376_102298082 236
235 3300025899 Ga0207642_10002238 Ga0207642_100022388 236
236 3300025901 Ga0207688_10174561 Ga0207688_101745612 236
237 3300025903 Ga0207680_10638706 Ga0207680_106387061 236
238 3300025904 Ga0207647_10155417 Ga0207647_101554172 236
239 3300025911 Ga0207654_10017542 Ga0207654_100175422 236
240 3300025913 Ga0207695_10318065 Ga0207695_103180652 236
241 3300025917 Ga0207660_10003778 Ga0207660_100037785 236
242 3300025917 Ga0207660_10301771 Ga0207660_103017712 236
243 3300025918 Ga0207662_10006285 Ga0207662_100062858 236
244 3300025921 Ga0207652_10003435 Ga0207652_1000343512 236
245 3300025923 Ga0207681_10411562 Ga0207681_104115622 236
246 3300025927 Ga0207687_10006145 Ga0207687_100061458 236
247 3300025934 Ga0207686_10001108 Ga0207686_1000110812 236
248 3300025935 Ga0207709_10000686 Ga0207709_1000068620 236
249 3300025936 Ga0207670_10000865 Ga0207670_100008656 236
250 3300025936 Ga0207670_10054996 Ga0207670_100549963 236
251 3300025937 Ga0207669_10064683 Ga0207669_100646833 236
252 3300025938 Ga0207704_10025764 Ga0207704_100257644 236
253 3300025939 Ga0207665_10261679 Ga0207665_102616792 236
254 3300025942 Ga0207689_10000217 Ga0207689_1000021738 236
255 3300025942 Ga0207689_10075315 Ga0207689_100753153 236
256 3300025949 Ga0207667_10007910 Ga0207667_1000791012 236
257 3300025949 Ga0207667_10288406 Ga0207667_102884063 236
258 3300025960 Ga0207651_10069971 Ga0207651_100699711 236
259 3300025961 Ga0207712_10001713 Ga0207712_100017138 236
260 3300025981 Ga0207640_10010437 Ga0207640_100104372 236
261 3300026023 Ga0207677_10000917 Ga0207677_1000091720 236
262 3300026035 Ga0207703_10002068 Ga0207703_1000206818 236
263 3300026035 Ga0207703_10243462 Ga0207703_102434622 236
264 3300026041 Ga0207639_10123157 Ga0207639_101231572 236
265 3300026075 Ga0207708_10003928 Ga0207708_100039288 236
266 3300026078 Ga0207702_10072836 Ga0207702_100728366 236
267 3300026088 Ga0207641_10217491 Ga0207641_102174912 236
268 3300026089 Ga0207648_10000217 Ga0207648_1000021724 236
269 3300026095 Ga0207676_10522223 Ga0207676_105222232 236
270 3300026118 Ga0207675_100000310 Ga0207675_10000031031 236
271 3300026118 Ga0207675_100205782 Ga0207675_1002057822 236
272 3300026118 Ga0207675_100507270 Ga0207675_1005072702 236
273 3300026142 Ga0207698_10031394 Ga0207698_100313941 236
274 3300027378 Ga0209981_1006278 Ga0209981_10062782 236
275 3300027462 Ga0210000_1002107 Ga0210000_10021074 236
276 3300027695 Ga0209966_1028821 Ga0209966_10288212 236
277 3300027907 Ga0207428_10011517 Ga0207428_100115174 236
278 3300027907 Ga0207428_10171755 Ga0207428_101717553 236
279 3300027907 Ga0207428_10262383 Ga0207428_102623832 236
280 3300028380 Ga0268265_10039821 Ga0268265_100398215 236
281 3300028381 Ga0268264_10002238 Ga0268264_1000223816 236
282 3300031691 Ga0316579_10002937 Ga0316579_100029374 236
283 3300031995 Ga0307409_100257649 Ga0307409_1002576492 236
284 3300032133 Ga0316583_10012156 Ga0316583_100121564 236
285 3300032133 Ga0316583_10035681 Ga0316583_100356812 236
286 3300034816 Ga0373930_0024891 Ga0373930_0024891_315_1025 236
287 3300034818 Ga0373950_0002561 Ga0373950_0002561_805_1515 236
288 3300034818 Ga0373950_0016185 Ga0373950_0016185_211_921 236
289 3300034819 Ga0373958_0002738 Ga0373958_0002738_470_1180 236
290 3300035084 Ga0373928_0003487 Ga0373928_0003487_1811_2521 236
291 3300035086 Ga0373934_0136797 Ga0373934_0136797_171_884 236
292 3300035088 Ga0373940_0000894 Ga0373940_0000894_588_1298 236
293 3300035089 Ga0373944_0011798 Ga0373944_0011798_337_1050 236
294 3300035090 Ga0373949_0005225 Ga0373949_0005225_2019_2729 236
295 3300035092 Ga0373952_0012536 Ga0373952_0012536_737_1447 236
296 3300035112 Ga0373932_0000678 Ga0373932_0000678_2011_2721 236
297 3300035114 Ga0373939_0002206 Ga0373939_0002206_1687_2397 236
298 3300035116 Ga0373945_0003807 Ga0373945_0003807_2822_3535 236
299 3300035121 Ga0373960_0009094 Ga0373960_0009094_524_1234 236
300 3300035171 Ga0373946_0036179 Ga0373946_0036179_938_1651 236
301 3300035172 Ga0373955_0321326 Ga0373955_0321326_43_756 236
302 3300035241 Ga0373961_0032716 Ga0373961_0032716_42_752 236
303 3300035410 Ga0373924_0138462 Ga0373924_0138462_14_727 236
304 3300035691 Ga0373931_0030653 Ga0373931_0030653_847_1557 236
305 3300035692 Ga0373935_0107216 Ga0373935_0107216_665_1378 236
306 3300035725 Ga0373947_0060900 Ga0373947_0060900_1018_1731 236
307 3300036647 Ga0316582_0049026 Ga0316582_0049026_663_1373 236
308 3300037588 Ga0316581_0007174 Ga0316581_0007174_1657_2367 236
309 3300045051 Ga0451576_0000360 Ga0451576_0000360_8860_9570 236
310 3300045051 Ga0451576_0028622 Ga0451576_0028622_4561_5271 236
311 3300045051 Ga0451576_0030529 Ga0451576_0030529_1547_2257 236
312 3300046472 Ga0495580_0004091 Ga0495580_0004091_666_1379 236
313 3300046491 Ga0495584_0048837 Ga0495584_0048837_1369_2079 236
314 3300046517 Ga0495630_0233942 Ga0495630_0233942_672_1385 236
315 3300046535 Ga0495586_0045970 Ga0495586_0045970_1488_2201 236
316 3300046615 Ga0495656_0076787 Ga0495656_0076787_250_960 236
317 3300046664 Ga0495659_0029605 Ga0495659_0029605_40_750 236
318 3300046674 Ga0495588_0194291 Ga0495588_0194291_310_1023 236
319 3300046681 Ga0495647_0140781 Ga0495647_0140781_202_915 236
320 3300046683 Ga0495658_0079965 Ga0495658_0079965_810_1523 236
321 3300046684 Ga0495669_0030124 Ga0495669_0030124_277_987 236
322 3300046691 Ga0495670_0127338 Ga0495670_0127338_225_935 236
323 3300049568 Ga0501031_0022344 Ga0501031_0022344_3101_3811 236
324 3300049568 Ga0501031_0196867 Ga0501031_0196867_413_1123 236
325 3300049569 Ga0501032_0057616 Ga0501032_0057616_1294_2004 236
326 3300049570 Ga0501033_0011677 Ga0501033_0011677_5237_5947 236
327 3300049571 Ga0501034_0292022 Ga0501034_0292022_759_1469 236
328 3300049572 Ga0501036_0002300 Ga0501036_0002300_6518_7228 236
329 3300049572 Ga0501036_0215253 Ga0501036_0215253_37_747 236
330 3300049573 Ga0501037_0018828 Ga0501037_0018828_1269_1979 236
331 3300049574 Ga0501038_0009701 Ga0501038_0009701_1599_2309 236
332 3300049575 Ga0501039_0009384 Ga0501039_0009384_4302_5012 236
333 3300049575 Ga0501039_0020770 Ga0501039_0020770_1034_1744 236
334 3300049575 Ga0501039_0163287 Ga0501039_0163287_696_1406 236
335 3300049576 Ga0501040_0009441 Ga0501040_0009441_1565_2275 236
336 3300049576 Ga0501040_0014204 Ga0501040_0014204_2323_3033 236
337 3300049577 Ga0501041_0001358 Ga0501041_0001358_2442_3152 236
338 3300049577 Ga0501041_0148943 Ga0501041_0148943_372_1082 236
339 3300049577 Ga0501041_0177263 Ga0501041_0177263_510_1220 236
340 3300049578 Ga0501042_0001293 Ga0501042_0001293_5429_6139 236
341 3300049578 Ga0501042_0172210 Ga0501042_0172210_89_799 236
342 3300049578 Ga0501042_0679188 Ga0501042_0679188_18_728 236
343 3300049579 Ga0501043_0013889 Ga0501043_0013889_1465_2175 236
344 3300049580 Ga0501046_0005727 Ga0501046_0005727_7890_8600 236
345 3300049581 Ga0501047_0578497 Ga0501047_0578497_217_927 236
346 3300049582 Ga0501048_0028373 Ga0501048_0028373_1600_2310 236
347 3300049582 Ga0501048_0128457 Ga0501048_0128457_471_1181 236
348 3300049586 Ga0501070_0106334 Ga0501070_0106334_152_862 236
349 3300049587 Ga0501071_0028984 Ga0501071_0028984_1306_2016 236
350 3300049588 Ga0501072_0001780 Ga0501072_0001780_7672_8382 236
351 3300049588 Ga0501072_0017876 Ga0501072_0017876_1515_2225 236
352 3300049588 Ga0501072_0739681 Ga0501072_0739681_18_728 236
353 3300049589 Ga0501073_0046768 Ga0501073_0046768_501_1211 236
354 3300049590 Ga0501074_0027474 Ga0501074_0027474_1058_1768 236
355 3300049590 Ga0501074_0193210 Ga0501074_0193210_446_1156 236
356 3300049591 Ga0501075_0005102 Ga0501075_0005102_1745_2455 236
357 3300049591 Ga0501075_0089214 Ga0501075_0089214_624_1334 236
358 3300049592 Ga0501076_0001146 Ga0501076_0001146_8236_8946 236
359 3300049593 Ga0501077_0003582 Ga0501077_0003582_1438_2148 236
360 3300049741 Ga0501079_0002542 Ga0501079_0002542_6701_7411 236
361 3300049742 Ga0501080_0007707 Ga0501080_0007707_6149_6859 236
362 3300049743 Ga0501081_0000579 Ga0501081_0000579_14816_15526 236
363 3300049744 Ga0501083_0028440 Ga0501083_0028440_487_1197 236
364 3300049822 Ga0501035_0083336 Ga0501035_0083336_694_1404 236
365 3300049824 Ga0501045_0019729 Ga0501045_0019729_1388_2098 236
366 3300050507 nmdc:mga05p37_609947_c1 nmdc:mga05p37_609947_c1_109_819 236
367 3300050508 nmdc:mga09592_194108_c1 nmdc:mga09592_194108_c1_897_1607 236
368 3300050508 nmdc:mga09592_9976_c1 nmdc:mga09592_9976_c1_4370_5080 236
369 3300050509 nmdc:mga0qj67_2803_c1 nmdc:mga0qj67_2803_c1_261_971 236
370 3300050509 nmdc:mga0qj67_495514_c1 nmdc:mga0qj67_495514_c1_236_946 236
371 3300050509 nmdc:mga0qj67_497637_c1 nmdc:mga0qj67_497637_c1_77_787 236
372 3300050510 nmdc:mga06r32_19382_c1 nmdc:mga06r32_19382_c1_308_1018 236
373 3300050511 nmdc:mga08y16_647095_c1 nmdc:mga08y16_647095_c1_150_860 236
374 3300050512 nmdc:mga0n895_15776_c1 nmdc:mga0n895_15776_c1_5379_6089 236
375 3300050513 nmdc:mga0rr50_3083_c1 nmdc:mga0rr50_3083_c1_300_1010 236
376 3300050514 nmdc:mga08x19_1086_c1 nmdc:mga08x19_1086_c1_14362_15072 236
377 3300050515 nmdc:mga0a205_1767_c1 nmdc:mga0a205_1767_c1_17002_17712 236
378 3300054114 Ga0501084_0055456 Ga0501084_0055456_2447_3157 236
379 3300060353 Ga0501082_0009700 Ga0501082_0009700_1643_2353 236
380 3300061734 Ga0530510_0317605 Ga0530510_0317605_293_1003 236
381 3300005328 Ga0070676_10235355 Ga0070676_102353551 238
382 3300005334 Ga0068869_100033060 Ga0068869_1000330606 238
383 3300005345 Ga0070692_10209317 Ga0070692_102093171 238
384 3300005347 Ga0070668_100182092 Ga0070668_1001820922 238
385 3300005353 Ga0070669_100028104 Ga0070669_1000281044 238
386 3300005354 Ga0070675_100087689 Ga0070675_1000876894 238
387 3300005364 Ga0070673_100303408 Ga0070673_1003034082 238
388 3300005438 Ga0070701_10251961 Ga0070701_102519612 238
389 3300005456 Ga0070678_100302522 Ga0070678_1003025222 238
390 3300005459 Ga0068867_100013888 Ga0068867_1000138883 238
391 3300005543 Ga0070672_100176130 Ga0070672_1001761302 238
392 3300005563 Ga0068855_100233719 Ga0068855_1002337192 238
393 3300005718 Ga0068866_10106560 Ga0068866_101065602 238
394 3300005844 Ga0068862_100256034 Ga0068862_1002560342 238
395 3300006844 Ga0075428_100510175 Ga0075428_1005101752 238
396 3300006881 Ga0068865_100028410 Ga0068865_1000284104 238
397 3300009094 Ga0111539_10287674 Ga0111539_102876742 238
398 3300009148 Ga0105243_10103611 Ga0105243_101036112 238
399 3300009553 Ga0105249_10064105 Ga0105249_100641053 238
400 3300013308 Ga0157375_10573741 Ga0157375_105737412 238
401 3300014326 Ga0157380_10206015 Ga0157380_102060152 238
402 3300014745 Ga0157377_10020255 Ga0157377_100202553 238
403 3300025899 Ga0207642_10114566 Ga0207642_101145661 238
404 3300025907 Ga0207645_10085420 Ga0207645_100854202 238
405 3300025908 Ga0207643_10039440 Ga0207643_100394403 238
406 3300025923 Ga0207681_10036977 Ga0207681_100369773 238
407 3300025935 Ga0207709_10031001 Ga0207709_100310013 238
408 3300025936 Ga0207670_10187253 Ga0207670_101872532 238
409 3300025940 Ga0207691_10051405 Ga0207691_100514054 238
410 3300025961 Ga0207712_10323801 Ga0207712_103238011 238
411 3300025972 Ga0207668_10198308 Ga0207668_101983082 238
412 3300026075 Ga0207708_10195133 Ga0207708_101951332 238
413 3300026075 Ga0207708_10633109 Ga0207708_106331091 238
414 3300026088 Ga0207641_10666547 Ga0207641_106665472 238
415 3300026089 Ga0207648_10000816 Ga0207648_100008165 238
416 3300026116 Ga0207674_10228050 Ga0207674_102280502 238
417 3300026118 Ga0207675_100205391 Ga0207675_1002053912 238
418 3300027907 Ga0207428_10029446 Ga0207428_100294463 238
419 3300028380 Ga0268265_10060184 Ga0268265_100601844 238
420 3300047315 Ga0495581_0074453 Ga0495581_0074453_1204_1923 238
421 3300049582 Ga0501048_0036375 Ga0501048_0036375_2510_3271 238
422 3300049588 Ga0501072_0178352 Ga0501072_0178352_170_931 238
423 3300049591 Ga0501075_0297804 Ga0501075_0297804_258_1019 238
424 3300049661 Ga0501217_092890 Ga0501217_092890_34_750 238
425 3300049668 Ga0501233_052833 Ga0501233_052833_238_954 238
426 3300050508 nmdc:mga09592_724026_c1 nmdc:mga09592_724026_c1_11_727 238
427 3300050509 nmdc:mga0qj67_167706_c1 nmdc:mga0qj67_167706_c1_698_1414 238

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02682

CT_C_D

Carboxyltransferase domain, subdomain C and D

9

215

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2zp2-assembly2.cif.gz_B c-terminal domain of kipi from bacillus subtilis 0.9536 100 229
2zp2-assembly1.cif.gz_A c-terminal domain of kipi from bacillus subtilis 0.9435 100 229
2zp2-assembly2.cif.gz_B c-terminal domain of kipi from bacillus subtilis 0.9312 100 229
2zp2-assembly1.cif.gz_A c-terminal domain of kipi from bacillus subtilis 0.9209 100 229
3oep-assembly1.cif.gz_A crystal structure of ttha0988 in space group p43212 0.9163 16 226
ID Description Score Start End Superfamily
3oreA02 Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like 0.9651 100 226 2.40.100.10
af_Q2G095_94_231_2.40.100.10 Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like 0.9499 101 230 2.40.100.10
2zp2A00 Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like 0.9435 100 229 2.40.100.10
3mmlD02 Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like 0.928 93 226 2.40.100.10
2zp2A00 Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like 0.9209 100 229 2.40.100.10
ID Description Score Start End GO Terms
AF-A0A537R1W4-F1-model_v4 5-oxoprolinase subunit PxpB (EC 3.5.2.9) 0.9946 101 237 GO:0005524
GO:0017168
AF-A0A2V6H9H9-F1-model_v4 Kinase inhibitor 0.99 101 235 GO:0005524
GO:0016787
AF-A0A2V5VZF5-F1-model_v4 Carboxyltransferase domain-containing protein 0.9883 124 235 GO:0005524
GO:0016787
AF-A4NXI0-F1-model_v4 Carboxyltransferase domain-containing protein 0.9848 133 224 GO:0005524
GO:0016787
AF-A0A379D3W4-F1-model_v4 deleted 0.9842 119 215

Feature Viewer

pLDDT pTM Quality
90.26 0.74 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map