F441548
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 427 | 249 | 427 | 231 |
Family's Representative Sequence
| Representative Sequence | 3300049582|Ga0501048_0036375|Ga0501048_0036375_2510_3271 |
| Length | 253 |
| Sequence | LAKNSFRPKAIHPLGDCAAYVEFSEALDLEVNAAVQRLAAIVHGRRLPWIRDVVPALGGLALHFDPDHPDLRGESLQTAAGLVAECLQEVDLKEEDAPRTVEVPVCYEPEFAPDIEEVAKKTRLPAEEVARLHAAGDYRVLMIGFAPGHAYMGGLDRRLAVPRRATPRPVVAAGAVAIANDQTVVYPYAISGGWNVIGRTPVAVFDARREQPSLFAAGDRVRFRPISKDEFLEFRRNPPLASLATPLSGGPRQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 3 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 4 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 5 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 6 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 10 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 28 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 34 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 41 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 42 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 44 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 45 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 46 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 47 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 48 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 49 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 50 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 51 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 52 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 53 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 56 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 57 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 58 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 59 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 60 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 61 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 62 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 63 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 65 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 66 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 129 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 132 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 133 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 134 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 135 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 136 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 137 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 138 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 139 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 140 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 141 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 142 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 143 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 144 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 145 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 146 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 147 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 148 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 149 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 150 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 151 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 152 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 153 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 154 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 155 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 156 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 157 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 158 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 159 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 160 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 161 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 162 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 163 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 164 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 165 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 166 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 167 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 168 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 169 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 170 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 171 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 203 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 204 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 205 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 206 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 207 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 208 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 209 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 210 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 211 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 212 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 213 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 214 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 215 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 216 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 217 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 218 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 219 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 220 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 221 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 222 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 223 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 224 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 225 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 226 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 227 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 228 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 230 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 231 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 232 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 233 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 234 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 235 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 236 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 237 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 238 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 239 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 240 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 241 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 242 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 243 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 244 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 246 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 247 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 248 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 100 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070676_10235355 | 3300005328 | Bacteria | 1216 |
| 2 | Ga0070683_100216905 | 3300005329 | Bacteria | 1818 |
| 3 | Ga0070690_100000653 | 3300005330 | Bacteria | 17691 |
| 4 | Ga0070690_100175193 | 3300005330 | Bacteria | 1479 |
| 5 | Ga0068869_100001162 | 3300005334 | Bacteria | 15404 |
| 6 | Ga0068869_100033060 | 3300005334 | Bacteria | 3650 |
| 7 | Ga0068869_100154533 | 3300005334 | Bacteria | 1782 |
| 8 | Ga0070680_100000316 | 3300005336 | Bacteria | 32375 |
| 9 | Ga0070680_100110601 | 3300005336 | Bacteria | 2287 |
| 10 | Ga0070682_100007142 | 3300005337 | Bacteria | 6290 |
| 11 | Ga0068868_100038847 | 3300005338 | Bacteria | 3695 |
| 12 | Ga0070689_100000894 | 3300005340 | Bacteria | 18602 |
| 13 | Ga0070691_10000398 | 3300005341 | Bacteria | 15821 |
| 14 | Ga0070687_100000276 | 3300005343 | Bacteria | 17428 |
| 15 | Ga0070687_100158976 | 3300005343 | Bacteria | 1334 |
| 16 | Ga0070692_10209317 | 3300005345 | Bacteria | 1147 |
| 17 | Ga0070668_100182092 | 3300005347 | Bacteria | 1717 |
| 18 | Ga0070669_100028104 | 3300005353 | Bacteria | 4049 |
| 19 | Ga0070669_100685048 | 3300005353 | Bacteria | 865 |
| 20 | Ga0070675_100087689 | 3300005354 | Bacteria | 2602 |
| 21 | Ga0070671_100134215 | 3300005355 | Bacteria | 2086 |
| 22 | Ga0070674_100311188 | 3300005356 | Bacteria | 1259 |
| 23 | Ga0070673_100039558 | 3300005364 | Bacteria | 3610 |
| 24 | Ga0070673_100303408 | 3300005364 | Bacteria | 1406 |
| 25 | Ga0070710_10060221 | 3300005437 | Bacteria | 2159 |
| 26 | Ga0070701_10000423 | 3300005438 | Bacteria | 14365 |
| 27 | Ga0070701_10251961 | 3300005438 | Bacteria | 1066 |
| 28 | Ga0070711_100601798 | 3300005439 | Unclassified | 917 |
| 29 | Ga0070705_100000386 | 3300005440 | Bacteria | 25740 |
| 30 | Ga0070705_100008417 | 3300005440 | Bacteria | 5110 |
| 31 | Ga0070705_100019940 | 3300005440 | Bacteria | 3537 |
| 32 | Ga0070705_100030209 | 3300005440 | Bacteria | 2989 |
| 33 | Ga0070700_100000506 | 3300005441 | Bacteria | 19415 |
| 34 | Ga0070694_100001289 | 3300005444 | Bacteria | 14567 |
| 35 | Ga0070694_100007869 | 3300005444 | Bacteria | 6506 |
| 36 | Ga0070694_100253270 | 3300005444 | Unclassified | 1333 |
| 37 | Ga0070708_100404042 | 3300005445 | Bacteria | 1288 |
| 38 | Ga0070678_100302522 | 3300005456 | Bacteria | 1359 |
| 39 | Ga0070681_10161219 | 3300005458 | Bacteria | 2167 |
| 40 | Ga0068867_100001833 | 3300005459 | Bacteria | 14816 |
| 41 | Ga0068867_100013888 | 3300005459 | Bacteria | 5700 |
| 42 | Ga0068867_100698287 | 3300005459 | Bacteria | 895 |
| 43 | Ga0070706_100185664 | 3300005467 | Bacteria | 1943 |
| 44 | Ga0070707_100144459 | 3300005468 | Bacteria | 2316 |
| 45 | Ga0070707_100941500 | 3300005468 | Bacteria | 829 |
| 46 | Ga0070699_100027677 | 3300005518 | Bacteria | 4888 |
| 47 | Ga0070699_100416455 | 3300005518 | Bacteria | 1216 |
| 48 | Ga0070679_100006030 | 3300005530 | Bacteria | 11276 |
| 49 | Ga0070679_100315144 | 3300005530 | Bacteria | 1514 |
| 50 | Ga0070679_100848214 | 3300005530 | Bacteria | 857 |
| 51 | Ga0070697_100019407 | 3300005536 | Bacteria | 5370 |
| 52 | Ga0068853_100061000 | 3300005539 | Bacteria | 3261 |
| 53 | Ga0070672_100176130 | 3300005543 | Bacteria | 1781 |
| 54 | Ga0070672_100235124 | 3300005543 | Bacteria | 1540 |
| 55 | Ga0070686_100000744 | 3300005544 | Bacteria | 18870 |
| 56 | Ga0070686_100179684 | 3300005544 | Bacteria | 1502 |
| 57 | Ga0070695_100000250 | 3300005545 | Bacteria | 26956 |
| 58 | Ga0070695_100014917 | 3300005545 | Bacteria | 4687 |
| 59 | Ga0070695_100026767 | 3300005545 | Bacteria | 3570 |
| 60 | Ga0070695_100097056 | 3300005545 | Bacteria | 1978 |
| 61 | Ga0070696_100000358 | 3300005546 | Bacteria | 27825 |
| 62 | Ga0070696_100028581 | 3300005546 | Bacteria | 3805 |
| 63 | Ga0070696_100131923 | 3300005546 | Bacteria | 1818 |
| 64 | Ga0070696_100196224 | 3300005546 | Bacteria | 1505 |
| 65 | Ga0070696_100288460 | 3300005546 | Bacteria | 1253 |
| 66 | Ga0070693_100000395 | 3300005547 | Bacteria | 19874 |
| 67 | Ga0070704_100000203 | 3300005549 | Bacteria | 24666 |
| 68 | Ga0070704_100002499 | 3300005549 | Bacteria | 10342 |
| 69 | Ga0070704_100132876 | 3300005549 | Bacteria | 1931 |
| 70 | Ga0070704_100185934 | 3300005549 | Bacteria | 1666 |
| 71 | Ga0070704_100667923 | 3300005549 | Bacteria | 919 |
| 72 | Ga0068855_100001461 | 3300005563 | Bacteria | 29501 |
| 73 | Ga0068855_100233719 | 3300005563 | Bacteria | 2057 |
| 74 | Ga0068856_100007042 | 3300005614 | Bacteria | 10984 |
| 75 | Ga0070702_100000049 | 3300005615 | Bacteria | 33090 |
| 76 | Ga0070702_100094192 | 3300005615 | Bacteria | 1823 |
| 77 | Ga0068859_100012357 | 3300005617 | Bacteria | 8587 |
| 78 | Ga0068859_100074658 | 3300005617 | Bacteria | 3430 |
| 79 | Ga0068864_100614563 | 3300005618 | Bacteria | 1056 |
| 80 | Ga0068866_10002274 | 3300005718 | Bacteria | 7958 |
| 81 | Ga0068866_10106560 | 3300005718 | Bacteria | 1556 |
| 82 | Ga0068861_100000724 | 3300005719 | Bacteria | 19764 |
| 83 | Ga0068861_100276401 | 3300005719 | Bacteria | 1444 |
| 84 | Ga0068861_100401252 | 3300005719 | Bacteria | 1217 |
| 85 | Ga0068870_10040159 | 3300005840 | Bacteria | 2425 |
| 86 | Ga0068863_100516645 | 3300005841 | Bacteria | 1177 |
| 87 | Ga0068863_100731096 | 3300005841 | Bacteria | 985 |
| 88 | Ga0068858_100001186 | 3300005842 | Bacteria | 26972 |
| 89 | Ga0068858_100091462 | 3300005842 | Bacteria | 2832 |
| 90 | Ga0068860_100008599 | 3300005843 | Bacteria | 10178 |
| 91 | Ga0068862_100001819 | 3300005844 | Bacteria | 19319 |
| 92 | Ga0068862_100052973 | 3300005844 | Bacteria | 3473 |
| 93 | Ga0068862_100256034 | 3300005844 | Bacteria | 1596 |
| 94 | Ga0081539_10009825 | 3300005985 | Bacteria | 7901 |
| 95 | Ga0070716_100070269 | 3300006173 | Bacteria | 2055 |
| 96 | Ga0097621_100000594 | 3300006237 | Bacteria | 25505 |
| 97 | Ga0068871_100000636 | 3300006358 | Bacteria | 24113 |
| 98 | Ga0075428_100042180 | 3300006844 | Bacteria | 5018 |
| 99 | Ga0075428_100198718 | 3300006844 | Bacteria | 2168 |
| 100 | Ga0075428_100510175 | 3300006844 | Bacteria | 1286 |
| 101 | Ga0075428_100658006 | 3300006844 | Bacteria | 1117 |
| 102 | Ga0075430_100000874 | 3300006846 | Bacteria | 23652 |
| 103 | Ga0075431_100041055 | 3300006847 | Bacteria | 4770 |
| 104 | Ga0075431_100244936 | 3300006847 | Bacteria | 1822 |
| 105 | Ga0075434_100000233 | 3300006871 | Bacteria | 38350 |
| 106 | Ga0075434_100004674 | 3300006871 | Bacteria | 12372 |
| 107 | Ga0075434_100052805 | 3300006871 | Bacteria | 4039 |
| 108 | Ga0075434_100083518 | 3300006871 | Bacteria | 3191 |
| 109 | Ga0075429_100012563 | 3300006880 | Bacteria | 7346 |
| 110 | Ga0075429_100143460 | 3300006880 | Bacteria | 2090 |
| 111 | Ga0068865_100000086 | 3300006881 | Bacteria | 49762 |
| 112 | Ga0068865_100028410 | 3300006881 | Bacteria | 3702 |
| 113 | Ga0075436_100003384 | 3300006914 | Bacteria | 10925 |
| 114 | Ga0075436_100006211 | 3300006914 | Bacteria | 8193 |
| 115 | Ga0075436_100014377 | 3300006914 | Bacteria | 5418 |
| 116 | Ga0075436_100201455 | 3300006914 | Bacteria | 1410 |
| 117 | Ga0097620_100012357 | 3300006931 | Bacteria | 8587 |
| 118 | Ga0097620_100074659 | 3300006931 | Bacteria | 3430 |
| 119 | Ga0075435_100004201 | 3300007076 | Bacteria | 9880 |
| 120 | Ga0075435_100008212 | 3300007076 | Bacteria | 7476 |
| 121 | Ga0075435_100013896 | 3300007076 | Bacteria | 6005 |
| 122 | Ga0075435_100423556 | 3300007076 | Bacteria | 1147 |
| 123 | Ga0075435_100845030 | 3300007076 | Bacteria | 798 |
| 124 | Ga0099794_10056532 | 3300007265 | Bacteria | 1898 |
| 125 | Ga0111539_10132908 | 3300009094 | Bacteria | 2914 |
| 126 | Ga0111539_10145499 | 3300009094 | Bacteria | 2775 |
| 127 | Ga0111539_10196393 | 3300009094 | Bacteria | 2353 |
| 128 | Ga0111539_10287674 | 3300009094 | Bacteria | 1913 |
| 129 | Ga0111539_10369473 | 3300009094 | Bacteria | 1669 |
| 130 | Ga0105245_10004564 | 3300009098 | Bacteria | 12224 |
| 131 | Ga0114129_10004560 | 3300009147 | Bacteria | 19550 |
| 132 | Ga0114129_10116947 | 3300009147 | Bacteria | 3674 |
| 133 | Ga0114129_10935822 | 3300009147 | Bacteria | 1096 |
| 134 | Ga0114129_11349571 | 3300009147 | Bacteria | 882 |
| 135 | Ga0105243_10002776 | 3300009148 | Bacteria | 14554 |
| 136 | Ga0105243_10103611 | 3300009148 | Bacteria | 2366 |
| 137 | Ga0105241_10036122 | 3300009174 | Bacteria | 3718 |
| 138 | Ga0105242_10004524 | 3300009176 | Bacteria | 10801 |
| 139 | Ga0105249_10020144 | 3300009553 | Bacteria | 5959 |
| 140 | Ga0105249_10064105 | 3300009553 | Bacteria | 3377 |
| 141 | Ga0157378_10001361 | 3300013297 | Bacteria | 21960 |
| 142 | Ga0157375_10573741 | 3300013308 | Bacteria | 1289 |
| 143 | Ga0157375_11025424 | 3300013308 | Bacteria | 964 |
| 144 | Ga0157380_10035322 | 3300014326 | Bacteria | 3861 |
| 145 | Ga0157380_10206015 | 3300014326 | Bacteria | 1749 |
| 146 | Ga0157377_10020255 | 3300014745 | Bacteria | 3482 |
| 147 | Ga0157377_10118642 | 3300014745 | Bacteria | 1600 |
| 148 | Ga0157379_10455443 | 3300014968 | Bacteria | 1182 |
| 149 | Ga0157376_10229808 | 3300014969 | Bacteria | 1722 |
| 150 | Ga0207642_10002238 | 3300025899 | Bacteria | 6009 |
| 151 | Ga0207642_10114566 | 3300025899 | Bacteria | 1379 |
| 152 | Ga0207688_10174561 | 3300025901 | Bacteria | 1279 |
| 153 | Ga0207680_10638706 | 3300025903 | Bacteria | 762 |
| 154 | Ga0207647_10155417 | 3300025904 | Bacteria | 1336 |
| 155 | Ga0207645_10085420 | 3300025907 | Bacteria | 2026 |
| 156 | Ga0207643_10039440 | 3300025908 | Bacteria | 2657 |
| 157 | Ga0207684_10636693 | 3300025910 | Bacteria | 909 |
| 158 | Ga0207654_10017542 | 3300025911 | Bacteria | 3745 |
| 159 | Ga0207707_10007157 | 3300025912 | Bacteria | 9714 |
| 160 | Ga0207695_10318065 | 3300025913 | Bacteria | 1446 |
| 161 | Ga0207660_10003778 | 3300025917 | Bacteria | 9862 |
| 162 | Ga0207660_10301771 | 3300025917 | Bacteria | 1275 |
| 163 | Ga0207662_10006285 | 3300025918 | Bacteria | 6399 |
| 164 | Ga0207652_10003435 | 3300025921 | Bacteria | 13073 |
| 165 | Ga0207652_10097040 | 3300025921 | Bacteria | 2597 |
| 166 | Ga0207646_10127766 | 3300025922 | Bacteria | 2286 |
| 167 | Ga0207681_10036977 | 3300025923 | Bacteria | 3224 |
| 168 | Ga0207681_10411562 | 3300025923 | Bacteria | 1094 |
| 169 | Ga0207687_10006145 | 3300025927 | Bacteria | 7944 |
| 170 | Ga0207686_10001108 | 3300025934 | Bacteria | 15680 |
| 171 | Ga0207709_10000686 | 3300025935 | Bacteria | 27320 |
| 172 | Ga0207709_10031001 | 3300025935 | Bacteria | 3117 |
| 173 | Ga0207670_10000865 | 3300025936 | Bacteria | 15917 |
| 174 | Ga0207670_10054996 | 3300025936 | Bacteria | 2688 |
| 175 | Ga0207670_10187253 | 3300025936 | Bacteria | 1563 |
| 176 | Ga0207669_10064683 | 3300025937 | Bacteria | 2265 |
| 177 | Ga0207704_10025764 | 3300025938 | Bacteria | 3214 |
| 178 | Ga0207704_10347202 | 3300025938 | Bacteria | 1154 |
| 179 | Ga0207665_10079986 | 3300025939 | Bacteria | 2248 |
| 180 | Ga0207665_10261679 | 3300025939 | Bacteria | 1282 |
| 181 | Ga0207691_10051405 | 3300025940 | Bacteria | 3767 |
| 182 | Ga0207711_10465684 | 3300025941 | Bacteria | 1177 |
| 183 | Ga0207689_10000217 | 3300025942 | Bacteria | 51018 |
| 184 | Ga0207689_10075315 | 3300025942 | Bacteria | 2774 |
| 185 | Ga0207661_10228775 | 3300025944 | Bacteria | 1646 |
| 186 | Ga0207667_10007910 | 3300025949 | Bacteria | 12695 |
| 187 | Ga0207667_10288406 | 3300025949 | Bacteria | 1677 |
| 188 | Ga0207651_10069971 | 3300025960 | Bacteria | 2480 |
| 189 | Ga0207712_10001713 | 3300025961 | Bacteria | 14726 |
| 190 | Ga0207712_10323801 | 3300025961 | Bacteria | 1273 |
| 191 | Ga0207668_10198308 | 3300025972 | Bacteria | 1596 |
| 192 | Ga0207640_10010437 | 3300025981 | Bacteria | 5233 |
| 193 | Ga0207677_10000917 | 3300026023 | Bacteria | 16496 |
| 194 | Ga0207703_10002068 | 3300026035 | Bacteria | 17657 |
| 195 | Ga0207703_10243462 | 3300026035 | Bacteria | 1618 |
| 196 | Ga0207639_10123157 | 3300026041 | Bacteria | 2134 |
| 197 | Ga0207708_10003928 | 3300026075 | Bacteria | 10942 |
| 198 | Ga0207708_10195133 | 3300026075 | Bacteria | 1613 |
| 199 | Ga0207708_10633109 | 3300026075 | Bacteria | 909 |
| 200 | Ga0207702_10072836 | 3300026078 | Bacteria | 2962 |
| 201 | Ga0207641_10217491 | 3300026088 | Bacteria | 1770 |
| 202 | Ga0207641_10666547 | 3300026088 | Bacteria | 1023 |
| 203 | Ga0207648_10000217 | 3300026089 | Bacteria | 62158 |
| 204 | Ga0207648_10000816 | 3300026089 | Bacteria | 35242 |
| 205 | Ga0207648_10654080 | 3300026089 | Bacteria | 971 |
| 206 | Ga0207676_10522223 | 3300026095 | Bacteria | 1130 |
| 207 | Ga0207674_10228050 | 3300026116 | Bacteria | 1811 |
| 208 | Ga0207675_100000310 | 3300026118 | Bacteria | 46701 |
| 209 | Ga0207675_100205391 | 3300026118 | Bacteria | 1893 |
| 210 | Ga0207675_100205782 | 3300026118 | Bacteria | 1891 |
| 211 | Ga0207675_100507270 | 3300026118 | Bacteria | 1201 |
| 212 | Ga0207698_10031394 | 3300026142 | Bacteria | 3833 |
| 213 | Ga0209969_1003469 | 3300027360 | Bacteria | 2184 |
| 214 | Ga0209967_1004401 | 3300027364 | Bacteria | 1872 |
| 215 | Ga0209981_1006278 | 3300027378 | Bacteria | 1588 |
| 216 | Ga0209981_1012872 | 3300027378 | Bacteria | 1161 |
| 217 | Ga0210000_1002107 | 3300027462 | Bacteria | 2821 |
| 218 | Ga0210000_1006522 | 3300027462 | Bacteria | 1699 |
| 219 | Ga0209999_1000612 | 3300027543 | Bacteria | 5675 |
| 220 | Ga0209999_1011004 | 3300027543 | Bacteria | 1636 |
| 221 | Ga0209966_1028821 | 3300027695 | Bacteria | 1116 |
| 222 | Ga0209974_10009686 | 3300027876 | Bacteria | 3268 |
| 223 | Ga0207428_10011517 | 3300027907 | Bacteria | 7811 |
| 224 | Ga0207428_10029446 | 3300027907 | Bacteria | 4551 |
| 225 | Ga0207428_10171755 | 3300027907 | Bacteria | 1641 |
| 226 | Ga0207428_10262383 | 3300027907 | Bacteria | 1286 |
| 227 | Ga0268265_10039821 | 3300028380 | Bacteria | 3466 |
| 228 | Ga0268265_10060184 | 3300028380 | Bacteria | 2909 |
| 229 | Ga0268264_10002238 | 3300028381 | Bacteria | 17153 |
| 230 | Ga0307408_100108868 | 3300031548 | Bacteria | 2125 |
| 231 | Ga0316579_10002937 | 3300031691 | Bacteria | 6546 |
| 232 | Ga0307409_100257649 | 3300031995 | Bacteria | 1599 |
| 233 | Ga0307416_101230850 | 3300032002 | Bacteria | 854 |
| 234 | Ga0307411_10042696 | 3300032005 | Bacteria | 2896 |
| 235 | Ga0316583_10012156 | 3300032133 | Bacteria | 3106 |
| 236 | Ga0316583_10035681 | 3300032133 | Bacteria | 1764 |
| 237 | Ga0373930_0024891 | 3300034816 | Bacteria | 1199 |
| 238 | Ga0373950_0002561 | 3300034818 | Bacteria | 2512 |
| 239 | Ga0373950_0016185 | 3300034818 | Bacteria | 1273 |
| 240 | Ga0373958_0002738 | 3300034819 | Bacteria | 2497 |
| 241 | Ga0373938_0002959 | 3300034957 | Bacteria | 2749 |
| 242 | Ga0373928_0003487 | 3300035084 | Bacteria | 2996 |
| 243 | Ga0373934_0136797 | 3300035086 | Bacteria | 1001 |
| 244 | Ga0373940_0000894 | 3300035088 | Bacteria | 5020 |
| 245 | Ga0373944_0011798 | 3300035089 | Bacteria | 2399 |
| 246 | Ga0373949_0005225 | 3300035090 | Bacteria | 2908 |
| 247 | Ga0373952_0012536 | 3300035092 | Bacteria | 1670 |
| 248 | Ga0373932_0000678 | 3300035112 | Bacteria | 10295 |
| 249 | Ga0373936_0197074 | 3300035113 | Bacteria | 888 |
| 250 | Ga0373939_0002206 | 3300035114 | Bacteria | 4610 |
| 251 | Ga0373945_0003807 | 3300035116 | Bacteria | 4764 |
| 252 | Ga0373954_0000008 | 3300035118 | Bacteria | 79963 |
| 253 | Ga0373960_0009094 | 3300035121 | Bacteria | 2398 |
| 254 | Ga0373946_0036179 | 3300035171 | Bacteria | 2000 |
| 255 | Ga0373955_0321326 | 3300035172 | Bacteria | 935 |
| 256 | Ga0373942_0064104 | 3300035207 | Bacteria | 1059 |
| 257 | Ga0373961_0032716 | 3300035241 | Bacteria | 1460 |
| 258 | Ga0373924_0138462 | 3300035410 | Bacteria | 1061 |
| 259 | Ga0373931_0030653 | 3300035691 | Bacteria | 2770 |
| 260 | Ga0373931_0153431 | 3300035691 | Bacteria | 1344 |
| 261 | Ga0373931_0179369 | 3300035691 | Bacteria | 1253 |
| 262 | Ga0373935_0107216 | 3300035692 | Bacteria | 1849 |
| 263 | Ga0373947_0060900 | 3300035725 | Bacteria | 2292 |
| 264 | Ga0316582_0049026 | 3300036647 | Bacteria | 2671 |
| 265 | Ga0316581_0007174 | 3300037588 | Bacteria | 2981 |
| 266 | Ga0439443_000599 | 3300042003 | Bacteria | 3367 |
| 267 | Ga0439434_0000496 | 3300042435 | Bacteria | 11188 |
| 268 | Ga0439435_0001072 | 3300042436 | Bacteria | 4849 |
| 269 | Ga0439435_0004397 | 3300042436 | Bacteria | 3032 |
| 270 | Ga0439444_0001255 | 3300042437 | Bacteria | 3231 |
| 271 | Ga0439444_0012379 | 3300042437 | Bacteria | 1397 |
| 272 | Ga0439460_0000144 | 3300042461 | Bacteria | 12838 |
| 273 | Ga0466957_0077793 | 3300044842 | Bacteria | 2062 |
| 274 | Ga0451576_0000360 | 3300045051 | Bacteria | 109145 |
| 275 | Ga0451576_0028622 | 3300045051 | Bacteria | 5965 |
| 276 | Ga0451576_0030529 | 3300045051 | Bacteria | 5758 |
| 277 | Ga0451576_0106030 | 3300045051 | Bacteria | 2924 |
| 278 | Ga0466967_0027892 | 3300045976 | Bacteria | 4705 |
| 279 | Ga0495629_0166591 | 3300046459 | Bacteria | 1530 |
| 280 | Ga0495580_0004091 | 3300046472 | Bacteria | 12296 |
| 281 | Ga0495639_0015213 | 3300046475 | Bacteria | 3334 |
| 282 | Ga0495639_0263510 | 3300046475 | Bacteria | 854 |
| 283 | Ga0495662_0022756 | 3300046476 | Bacteria | 3025 |
| 284 | Ga0495662_0035581 | 3300046476 | Bacteria | 2403 |
| 285 | Ga0495584_0048837 | 3300046491 | Bacteria | 2133 |
| 286 | Ga0495608_0062411 | 3300046511 | Bacteria | 2448 |
| 287 | Ga0495628_0041974 | 3300046516 | Bacteria | 3650 |
| 288 | Ga0495628_0139228 | 3300046516 | Bacteria | 1852 |
| 289 | Ga0495630_0233942 | 3300046517 | Bacteria | 1404 |
| 290 | Ga0495652_0132933 | 3300046529 | Bacteria | 1967 |
| 291 | Ga0495652_0253764 | 3300046529 | Bacteria | 1302 |
| 292 | Ga0495586_0045970 | 3300046535 | Bacteria | 2353 |
| 293 | Ga0495587_0007969 | 3300046536 | Bacteria | 6844 |
| 294 | Ga0495621_0051479 | 3300046539 | Bacteria | 1474 |
| 295 | Ga0495645_0045056 | 3300046543 | Bacteria | 3218 |
| 296 | Ga0495656_0076787 | 3300046615 | Bacteria | 1497 |
| 297 | Ga0495634_0006671 | 3300046642 | Bacteria | 8750 |
| 298 | Ga0495634_0157411 | 3300046642 | Bacteria | 1434 |
| 299 | Ga0495635_0033744 | 3300046663 | Bacteria | 3550 |
| 300 | Ga0495635_0082107 | 3300046663 | Bacteria | 2205 |
| 301 | Ga0495659_0029605 | 3300046664 | Bacteria | 1902 |
| 302 | Ga0495588_0194291 | 3300046674 | Bacteria | 1072 |
| 303 | Ga0495647_0140781 | 3300046681 | Bacteria | 1028 |
| 304 | Ga0495658_0079965 | 3300046683 | Bacteria | 1916 |
| 305 | Ga0495669_0030124 | 3300046684 | Bacteria | 2382 |
| 306 | Ga0495624_0061494 | 3300046690 | Bacteria | 2353 |
| 307 | Ga0495670_0127338 | 3300046691 | Bacteria | 1326 |
| 308 | Ga0495600_0006148 | 3300046809 | Bacteria | 7276 |
| 309 | Ga0495581_0074453 | 3300047315 | Bacteria | 1965 |
| 310 | Ga0495604_0039764 | 3300047317 | Bacteria | 3695 |
| 311 | Ga0495674_0031444 | 3300047319 | Bacteria | 4822 |
| 312 | Ga0495680_0482761 | 3300047322 | Bacteria | 844 |
| 313 | Ga0495675_0135991 | 3300047444 | Bacteria | 1526 |
| 314 | Ga0495684_0187720 | 3300047471 | Bacteria | 1530 |
| 315 | Ga0495593_0179036 | 3300047673 | Bacteria | 1068 |
| 316 | Ga0501031_0022344 | 3300049568 | Bacteria | 4123 |
| 317 | Ga0501031_0196867 | 3300049568 | Bacteria | 1315 |
| 318 | Ga0501032_0057616 | 3300049569 | Bacteria | 2610 |
| 319 | Ga0501033_0011677 | 3300049570 | Bacteria | 6716 |
| 320 | Ga0501034_0292022 | 3300049571 | Bacteria | 1568 |
| 321 | Ga0501036_0002300 | 3300049572 | Bacteria | 14940 |
| 322 | Ga0501036_0215253 | 3300049572 | Bacteria | 1614 |
| 323 | Ga0501037_0018828 | 3300049573 | Bacteria | 5087 |
| 324 | Ga0501038_0009701 | 3300049574 | Bacteria | 8827 |
| 325 | Ga0501039_0009384 | 3300049575 | Bacteria | 7458 |
| 326 | Ga0501039_0020770 | 3300049575 | Bacteria | 5033 |
| 327 | Ga0501039_0058438 | 3300049575 | Bacteria | 2987 |
| 328 | Ga0501039_0163287 | 3300049575 | Bacteria | 1751 |
| 329 | Ga0501040_0009441 | 3300049576 | Bacteria | 6361 |
| 330 | Ga0501040_0014204 | 3300049576 | Bacteria | 5243 |
| 331 | Ga0501041_0001358 | 3300049577 | Bacteria | 13489 |
| 332 | Ga0501041_0033063 | 3300049577 | Bacteria | 3127 |
| 333 | Ga0501041_0148943 | 3300049577 | Bacteria | 1461 |
| 334 | Ga0501041_0177263 | 3300049577 | Bacteria | 1334 |
| 335 | Ga0501042_0001293 | 3300049578 | Bacteria | 14587 |
| 336 | Ga0501042_0015975 | 3300049578 | Bacteria | 5150 |
| 337 | Ga0501042_0172210 | 3300049578 | Bacteria | 1562 |
| 338 | Ga0501042_0316311 | 3300049578 | Unclassified | 1128 |
| 339 | Ga0501042_0679188 | 3300049578 | Unclassified | 749 |
| 340 | Ga0501043_0013889 | 3300049579 | Bacteria | 6301 |
| 341 | Ga0501046_0005727 | 3300049580 | Bacteria | 11088 |
| 342 | Ga0501046_0095114 | 3300049580 | Bacteria | 2289 |
| 343 | Ga0501047_0578497 | 3300049581 | Bacteria | 946 |
| 344 | Ga0501048_0027533 | 3300049582 | Bacteria | 4130 |
| 345 | Ga0501048_0028373 | 3300049582 | Bacteria | 4061 |
| 346 | Ga0501048_0036375 | 3300049582 | Bacteria | 3539 |
| 347 | Ga0501048_0128457 | 3300049582 | Bacteria | 1792 |
| 348 | Ga0501068_0483704 | 3300049584 | Bacteria | 802 |
| 349 | Ga0501070_0106334 | 3300049586 | Bacteria | 2319 |
| 350 | Ga0501071_0028984 | 3300049587 | Bacteria | 3904 |
| 351 | Ga0501071_0166364 | 3300049587 | Bacteria | 1650 |
| 352 | Ga0501071_0415662 | 3300049587 | Bacteria | 1028 |
| 353 | Ga0501072_0001780 | 3300049588 | Bacteria | 16027 |
| 354 | Ga0501072_0003058 | 3300049588 | Bacteria | 12610 |
| 355 | Ga0501072_0017876 | 3300049588 | Bacteria | 5453 |
| 356 | Ga0501072_0178352 | 3300049588 | Bacteria | 1695 |
| 357 | Ga0501072_0739681 | 3300049588 | Unclassified | 772 |
| 358 | Ga0501073_0046768 | 3300049589 | Bacteria | 3042 |
| 359 | Ga0501074_0027474 | 3300049590 | Bacteria | 4126 |
| 360 | Ga0501074_0193210 | 3300049590 | Bacteria | 1451 |
| 361 | Ga0501075_0004284 | 3300049591 | Bacteria | 9643 |
| 362 | Ga0501075_0005102 | 3300049591 | Bacteria | 8972 |
| 363 | Ga0501075_0061185 | 3300049591 | Bacteria | 2837 |
| 364 | Ga0501075_0089214 | 3300049591 | Bacteria | 2338 |
| 365 | Ga0501075_0297804 | 3300049591 | Bacteria | 1229 |
| 366 | Ga0501076_0001146 | 3300049592 | Bacteria | 17555 |
| 367 | Ga0501076_0012080 | 3300049592 | Bacteria | 6453 |
| 368 | Ga0501077_0003582 | 3300049593 | Bacteria | 9330 |
| 369 | Ga0501217_092890 | 3300049661 | Bacteria | 849 |
| 370 | Ga0501233_052833 | 3300049668 | Bacteria | 989 |
| 371 | Ga0501079_0002542 | 3300049741 | Bacteria | 13241 |
| 372 | Ga0501079_0051044 | 3300049741 | Bacteria | 3192 |
| 373 | Ga0501079_0115225 | 3300049741 | Bacteria | 2089 |
| 374 | Ga0501080_0007707 | 3300049742 | Bacteria | 9731 |
| 375 | Ga0501080_0549699 | 3300049742 | Bacteria | 1028 |
| 376 | Ga0501081_0000579 | 3300049743 | Bacteria | 20804 |
| 377 | Ga0501081_0033497 | 3300049743 | Bacteria | 3491 |
| 378 | Ga0501083_0028440 | 3300049744 | Bacteria | 3852 |
| 379 | Ga0501283_019906 | 3300049779 | Bacteria | 1065 |
| 380 | Ga0501035_0083336 | 3300049822 | Bacteria | 2821 |
| 381 | Ga0501035_0103238 | 3300049822 | Bacteria | 2501 |
| 382 | Ga0501045_0019729 | 3300049824 | Bacteria | 4809 |
| 383 | nmdc:mga05p37_1043143_c1 | 3300050507 | Bacteria | 863 |
| 384 | nmdc:mga05p37_154965_c1 | 3300050507 | Bacteria | 2800 |
| 385 | nmdc:mga05p37_609947_c1 | 3300050507 | Bacteria | 1230 |
| 386 | nmdc:mga05p37_702084_c1 | 3300050507 | Bacteria | 1123 |
| 387 | nmdc:mga09592_194108_c1 | 3300050508 | Bacteria | 1757 |
| 388 | nmdc:mga09592_368978_c1 | 3300050508 | Bacteria | 1242 |
| 389 | nmdc:mga09592_724026_c1 | 3300050508 | Bacteria | 846 |
| 390 | nmdc:mga09592_9976_c1 | 3300050508 | Bacteria | 7726 |
| 391 | nmdc:mga0qj67_167706_c1 | 3300050509 | Bacteria | 1783 |
| 392 | nmdc:mga0qj67_2803_c1 | 3300050509 | Bacteria | 12499 |
| 393 | nmdc:mga0qj67_495514_c1 | 3300050509 | Bacteria | 982 |
| 394 | nmdc:mga0qj67_497637_c1 | 3300050509 | Unclassified | 980 |
| 395 | nmdc:mga0qj67_52524_c1 | 3300050509 | Bacteria | 3226 |
| 396 | nmdc:mga06r32_185013_c1 | 3300050510 | Bacteria | 2070 |
| 397 | nmdc:mga06r32_19382_c1 | 3300050510 | Bacteria | 6241 |
| 398 | nmdc:mga08y16_117320_c1 | 3300050511 | Bacteria | 2771 |
| 399 | nmdc:mga08y16_20871_c1 | 3300050511 | Bacteria | 6917 |
| 400 | nmdc:mga08y16_25161_c1 | 3300050511 | Bacteria | 6278 |
| 401 | nmdc:mga08y16_647095_c1 | 3300050511 | Bacteria | 1062 |
| 402 | nmdc:mga0n895_15776_c1 | 3300050512 | Bacteria | 6906 |
| 403 | nmdc:mga0n895_179460_c1 | 3300050512 | Bacteria | 2149 |
| 404 | nmdc:mga0n895_505309_c1 | 3300050512 | Bacteria | 1217 |
| 405 | nmdc:mga0n895_88_c1 | 3300050512 | Bacteria | 53153 |
| 406 | nmdc:mga0n895_92402_c1 | 3300050512 | Bacteria | 3029 |
| 407 | nmdc:mga0rr50_1557_c1 | 3300050513 | Bacteria | 12644 |
| 408 | nmdc:mga0rr50_3083_c1 | 3300050513 | Bacteria | 9540 |
| 409 | nmdc:mga0rr50_3305_c1 | 3300050513 | Bacteria | 9258 |
| 410 | nmdc:mga0rr50_404177_c1 | 3300050513 | Unclassified | 1154 |
| 411 | nmdc:mga0rr50_812231_c1 | 3300050513 | Bacteria | 798 |
| 412 | nmdc:mga08x19_1086_c1 | 3300050514 | Bacteria | 16965 |
| 413 | nmdc:mga08x19_17002_c1 | 3300050514 | Bacteria | 4445 |
| 414 | nmdc:mga08x19_24453_c1 | 3300050514 | Bacteria | 3754 |
| 415 | nmdc:mga08x19_409844_c1 | 3300050514 | Bacteria | 951 |
| 416 | nmdc:mga08x19_63171_c1 | 3300050514 | Bacteria | 2402 |
| 417 | nmdc:mga08x19_83654_c1 | 3300050514 | Bacteria | 2098 |
| 418 | nmdc:mga0a205_1767_c1 | 3300050515 | Bacteria | 18718 |
| 419 | nmdc:mga0a205_67487_c1 | 3300050515 | Bacteria | 3455 |
| 420 | Ga0495601_0031614 | 3300053077 | Bacteria | 3290 |
| 421 | Ga0501084_0003157 | 3300054114 | Bacteria | 13329 |
| 422 | Ga0501084_0055456 | 3300054114 | Bacteria | 3315 |
| 423 | Ga0590075_033226 | 3300059424 | Unclassified | 1310 |
| 424 | Ga0590077_003015 | 3300059426 | Bacteria | 3526 |
| 425 | Ga0501082_0009700 | 3300060353 | Bacteria | 8289 |
| 426 | Ga0501082_0349525 | 3300060353 | Bacteria | 1289 |
| 427 | Ga0530510_0317605 | 3300061734 | Bacteria | 1167 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300007076 | Ga0075435_100008212 | Ga0075435_1000082122 | 189 |
| 2 | 3300050513 | nmdc:mga0rr50_3305_c1 | nmdc:mga0rr50_3305_c1_1157_1762 | 189 |
| 3 | 3300006844 | Ga0075428_100198718 | Ga0075428_1001987183 | 198 |
| 4 | 3300006847 | Ga0075431_100041055 | Ga0075431_1000410556 | 198 |
| 5 | 3300006880 | Ga0075429_100143460 | Ga0075429_1001434602 | 198 |
| 6 | 3300009147 | Ga0114129_10116947 | Ga0114129_101169472 | 198 |
| 7 | 3300050507 | nmdc:mga05p37_154965_c1 | nmdc:mga05p37_154965_c1_1602_2198 | 198 |
| 8 | 3300050510 | nmdc:mga06r32_185013_c1 | nmdc:mga06r32_185013_c1_128_724 | 198 |
| 9 | 3300025938 | Ga0207704_10347202 | Ga0207704_103472022 | 199 |
| 10 | 3300049587 | Ga0501071_0415662 | Ga0501071_0415662_172_771 | 199 |
| 11 | 3300009147 | Ga0114129_11349571 | Ga0114129_113495711 | 200 |
| 12 | 3300050507 | nmdc:mga05p37_1043143_c1 | nmdc:mga05p37_1043143_c1_219_845 | 200 |
| 13 | 3300027360 | Ga0209969_1003469 | Ga0209969_10034693 | 201 |
| 14 | 3300027364 | Ga0209967_1004401 | Ga0209967_10044013 | 201 |
| 15 | 3300027378 | Ga0209981_1012872 | Ga0209981_10128722 | 201 |
| 16 | 3300027462 | Ga0210000_1006522 | Ga0210000_10065222 | 201 |
| 17 | 3300027543 | Ga0209999_1000612 | Ga0209999_10006125 | 201 |
| 18 | 3300035207 | Ga0373942_0064104 | Ga0373942_0064104_21_629 | 202 |
| 19 | 3300009094 | Ga0111539_10132908 | Ga0111539_101329082 | 203 |
| 20 | 3300035113 | Ga0373936_0197074 | Ga0373936_0197074_255_866 | 203 |
| 21 | 3300042435 | Ga0439434_0000496 | Ga0439434_0000496_4441_5052 | 203 |
| 22 | 3300046459 | Ga0495629_0166591 | Ga0495629_0166591_389_1000 | 203 |
| 23 | 3300046476 | Ga0495662_0022756 | Ga0495662_0022756_574_1185 | 203 |
| 24 | 3300046516 | Ga0495628_0041974 | Ga0495628_0041974_1165_1776 | 203 |
| 25 | 3300046529 | Ga0495652_0253764 | Ga0495652_0253764_216_827 | 203 |
| 26 | 3300046642 | Ga0495634_0157411 | Ga0495634_0157411_576_1187 | 203 |
| 27 | 3300046663 | Ga0495635_0033744 | Ga0495635_0033744_2671_3282 | 203 |
| 28 | 3300046690 | Ga0495624_0061494 | Ga0495624_0061494_522_1133 | 203 |
| 29 | 3300047673 | Ga0495593_0179036 | Ga0495593_0179036_378_989 | 203 |
| 30 | 3300035691 | Ga0373931_0153431 | Ga0373931_0153431_120_740 | 206 |
| 31 | 3300049584 | Ga0501068_0483704 | Ga0501068_0483704_39_695 | 207 |
| 32 | 3300049588 | Ga0501072_0003058 | Ga0501072_0003058_1302_1958 | 207 |
| 33 | 3300049591 | Ga0501075_0061185 | Ga0501075_0061185_1153_1809 | 207 |
| 34 | 3300049741 | Ga0501079_0115225 | Ga0501079_0115225_1037_1693 | 207 |
| 35 | 3300060353 | Ga0501082_0349525 | Ga0501082_0349525_299_955 | 207 |
| 36 | 3300005440 | Ga0070705_100030209 | Ga0070705_1000302093 | 208 |
| 37 | 3300006871 | Ga0075434_100083518 | Ga0075434_1000835183 | 208 |
| 38 | 3300050512 | nmdc:mga0n895_179460_c1 | nmdc:mga0n895_179460_c1_1300_1926 | 208 |
| 39 | 3300047322 | Ga0495680_0482761 | Ga0495680_0482761_190_831 | 213 |
| 40 | 3300005330 | Ga0070690_100175193 | Ga0070690_1001751932 | 217 |
| 41 | 3300005468 | Ga0070707_100941500 | Ga0070707_1009415001 | 217 |
| 42 | 3300005544 | Ga0070686_100179684 | Ga0070686_1001796842 | 217 |
| 43 | 3300046475 | Ga0495639_0263510 | Ga0495639_0263510_89_742 | 217 |
| 44 | 3300046476 | Ga0495662_0035581 | Ga0495662_0035581_1406_2059 | 217 |
| 45 | 3300046511 | Ga0495608_0062411 | Ga0495608_0062411_1404_2057 | 217 |
| 46 | 3300046516 | Ga0495628_0139228 | Ga0495628_0139228_1054_1707 | 217 |
| 47 | 3300046529 | Ga0495652_0132933 | Ga0495652_0132933_1194_1847 | 217 |
| 48 | 3300046536 | Ga0495587_0007969 | Ga0495587_0007969_6090_6743 | 217 |
| 49 | 3300046543 | Ga0495645_0045056 | Ga0495645_0045056_1385_2038 | 217 |
| 50 | 3300046642 | Ga0495634_0006671 | Ga0495634_0006671_6192_6845 | 217 |
| 51 | 3300046663 | Ga0495635_0082107 | Ga0495635_0082107_1142_1795 | 217 |
| 52 | 3300046809 | Ga0495600_0006148 | Ga0495600_0006148_5571_6224 | 217 |
| 53 | 3300047317 | Ga0495604_0039764 | Ga0495604_0039764_1348_2001 | 217 |
| 54 | 3300047319 | Ga0495674_0031444 | Ga0495674_0031444_4086_4739 | 217 |
| 55 | 3300047444 | Ga0495675_0135991 | Ga0495675_0135991_385_1038 | 217 |
| 56 | 3300047471 | Ga0495684_0187720 | Ga0495684_0187720_601_1254 | 217 |
| 57 | 3300053077 | Ga0495601_0031614 | Ga0495601_0031614_1593_2246 | 217 |
| 58 | 3300049575 | Ga0501039_0058438 | Ga0501039_0058438_1186_1842 | 218 |
| 59 | 3300049577 | Ga0501041_0033063 | Ga0501041_0033063_1286_1942 | 218 |
| 60 | 3300049578 | Ga0501042_0015975 | Ga0501042_0015975_2411_3067 | 218 |
| 61 | 3300049580 | Ga0501046_0095114 | Ga0501046_0095114_622_1278 | 218 |
| 62 | 3300049582 | Ga0501048_0027533 | Ga0501048_0027533_2811_3467 | 218 |
| 63 | 3300049587 | Ga0501071_0166364 | Ga0501071_0166364_264_920 | 218 |
| 64 | 3300049591 | Ga0501075_0004284 | Ga0501075_0004284_2481_3137 | 218 |
| 65 | 3300049592 | Ga0501076_0012080 | Ga0501076_0012080_4349_5005 | 218 |
| 66 | 3300049741 | Ga0501079_0051044 | Ga0501079_0051044_1779_2435 | 218 |
| 67 | 3300049742 | Ga0501080_0549699 | Ga0501080_0549699_159_815 | 218 |
| 68 | 3300049743 | Ga0501081_0033497 | Ga0501081_0033497_19_675 | 218 |
| 69 | 3300049779 | Ga0501283_019906 | Ga0501283_019906_324_980 | 218 |
| 70 | 3300049822 | Ga0501035_0103238 | Ga0501035_0103238_605_1261 | 218 |
| 71 | 3300054114 | Ga0501084_0003157 | Ga0501084_0003157_8833_9489 | 218 |
| 72 | 3300005444 | Ga0070694_100253270 | Ga0070694_1002532701 | 220 |
| 73 | 3300005549 | Ga0070704_100185934 | Ga0070704_1001859342 | 221 |
| 74 | 3300005985 | Ga0081539_10009825 | Ga0081539_1000982510 | 222 |
| 75 | 3300035118 | Ga0373954_0000008 | Ga0373954_0000008_22334_23002 | 222 |
| 76 | 3300005545 | Ga0070695_100097056 | Ga0070695_1000970562 | 223 |
| 77 | 3300005546 | Ga0070696_100196224 | Ga0070696_1001962242 | 223 |
| 78 | 3300006871 | Ga0075434_100000233 | Ga0075434_1000002335 | 223 |
| 79 | 3300007076 | Ga0075435_100013896 | Ga0075435_1000138967 | 223 |
| 80 | 3300046539 | Ga0495621_0051479 | Ga0495621_0051479_392_1099 | 223 |
| 81 | 3300050512 | nmdc:mga0n895_88_c1 | nmdc:mga0n895_88_c1_24720_25427 | 223 |
| 82 | 3300050513 | nmdc:mga0rr50_1557_c1 | nmdc:mga0rr50_1557_c1_7297_8004 | 223 |
| 83 | 3300005334 | Ga0068869_100154533 | Ga0068869_1001545332 | 225 |
| 84 | 3300005530 | Ga0070679_100315144 | Ga0070679_1003151442 | 225 |
| 85 | 3300005546 | Ga0070696_100288460 | Ga0070696_1002884601 | 225 |
| 86 | 3300025912 | Ga0207707_10007157 | Ga0207707_100071573 | 225 |
| 87 | 3300025921 | Ga0207652_10097040 | Ga0207652_100970405 | 225 |
| 88 | 3300007265 | Ga0099794_10056532 | Ga0099794_100565322 | 226 |
| 89 | 3300046475 | Ga0495639_0015213 | Ga0495639_0015213_10_693 | 226 |
| 90 | 3300027876 | Ga0209974_10009686 | Ga0209974_100096865 | 227 |
| 91 | 3300035691 | Ga0373931_0179369 | Ga0373931_0179369_499_1209 | 227 |
| 92 | 3300042436 | Ga0439435_0004397 | Ga0439435_0004397_586_1269 | 227 |
| 93 | 3300042437 | Ga0439444_0012379 | Ga0439444_0012379_17_700 | 227 |
| 94 | 3300050507 | nmdc:mga05p37_702084_c1 | nmdc:mga05p37_702084_c1_203_886 | 227 |
| 95 | 3300050508 | nmdc:mga09592_368978_c1 | nmdc:mga09592_368978_c1_248_931 | 227 |
| 96 | 3300005549 | Ga0070704_100132876 | Ga0070704_1001328763 | 228 |
| 97 | 3300027543 | Ga0209999_1011004 | Ga0209999_10110042 | 228 |
| 98 | 3300050509 | nmdc:mga0qj67_52524_c1 | nmdc:mga0qj67_52524_c1_2485_3171 | 228 |
| 99 | 3300050511 | nmdc:mga08y16_117320_c1 | nmdc:mga08y16_117320_c1_1457_2143 | 228 |
| 100 | 3300050511 | nmdc:mga08y16_20871_c1 | nmdc:mga08y16_20871_c1_6212_6898 | 228 |
| 101 | 3300034957 | Ga0373938_0002959 | Ga0373938_0002959_978_1688 | 229 |
| 102 | 3300042003 | Ga0439443_000599 | Ga0439443_000599_1050_1742 | 230 |
| 103 | 3300042436 | Ga0439435_0001072 | Ga0439435_0001072_2814_3506 | 230 |
| 104 | 3300042437 | Ga0439444_0001255 | Ga0439444_0001255_1599_2291 | 230 |
| 105 | 3300042461 | Ga0439460_0000144 | Ga0439460_0000144_8218_8910 | 230 |
| 106 | 3300005615 | Ga0070702_100094192 | Ga0070702_1000941923 | 231 |
| 107 | 3300005841 | Ga0068863_100516645 | Ga0068863_1005166452 | 231 |
| 108 | 3300013308 | Ga0157375_11025424 | Ga0157375_110254241 | 231 |
| 109 | 3300025941 | Ga0207711_10465684 | Ga0207711_104656842 | 231 |
| 110 | 3300045051 | Ga0451576_0106030 | Ga0451576_0106030_1968_2696 | 231 |
| 111 | 3300050511 | nmdc:mga08y16_25161_c1 | nmdc:mga08y16_25161_c1_1118_1846 | 231 |
| 112 | 3300005439 | Ga0070711_100601798 | Ga0070711_1006017981 | 232 |
| 113 | 3300005329 | Ga0070683_100216905 | Ga0070683_1002169052 | 233 |
| 114 | 3300005458 | Ga0070681_10161219 | Ga0070681_101612192 | 233 |
| 115 | 3300025944 | Ga0207661_10228775 | Ga0207661_102287752 | 233 |
| 116 | 3300044842 | Ga0466957_0077793 | Ga0466957_0077793_1102_1803 | 233 |
| 117 | 3300045976 | Ga0466967_0027892 | Ga0466967_0027892_21_722 | 233 |
| 118 | 3300005440 | Ga0070705_100008417 | Ga0070705_1000084177 | 234 |
| 119 | 3300005467 | Ga0070706_100185664 | Ga0070706_1001856642 | 234 |
| 120 | 3300005518 | Ga0070699_100027677 | Ga0070699_1000276772 | 234 |
| 121 | 3300005536 | Ga0070697_100019407 | Ga0070697_1000194077 | 234 |
| 122 | 3300005545 | Ga0070695_100014917 | Ga0070695_1000149172 | 234 |
| 123 | 3300005546 | Ga0070696_100028581 | Ga0070696_1000285812 | 234 |
| 124 | 3300005549 | Ga0070704_100667923 | Ga0070704_1006679231 | 234 |
| 125 | 3300006173 | Ga0070716_100070269 | Ga0070716_1000702692 | 234 |
| 126 | 3300006914 | Ga0075436_100006211 | Ga0075436_1000062113 | 234 |
| 127 | 3300006914 | Ga0075436_100014377 | Ga0075436_1000143771 | 234 |
| 128 | 3300006914 | Ga0075436_100201455 | Ga0075436_1002014551 | 234 |
| 129 | 3300007076 | Ga0075435_100423556 | Ga0075435_1004235562 | 234 |
| 130 | 3300007076 | Ga0075435_100845030 | Ga0075435_1008450302 | 234 |
| 131 | 3300025939 | Ga0207665_10079986 | Ga0207665_100799862 | 234 |
| 132 | 3300032002 | Ga0307416_101230850 | Ga0307416_1012308501 | 234 |
| 133 | 3300050512 | nmdc:mga0n895_505309_c1 | nmdc:mga0n895_505309_c1_474_1178 | 234 |
| 134 | 3300050513 | nmdc:mga0rr50_404177_c1 | nmdc:mga0rr50_404177_c1_63_767 | 234 |
| 135 | 3300050513 | nmdc:mga0rr50_812231_c1 | nmdc:mga0rr50_812231_c1_26_730 | 234 |
| 136 | 3300050514 | nmdc:mga08x19_17002_c1 | nmdc:mga08x19_17002_c1_2689_3393 | 234 |
| 137 | 3300050514 | nmdc:mga08x19_24453_c1 | nmdc:mga08x19_24453_c1_357_1061 | 234 |
| 138 | 3300050514 | nmdc:mga08x19_63171_c1 | nmdc:mga08x19_63171_c1_1284_1988 | 234 |
| 139 | 3300050514 | nmdc:mga08x19_83654_c1 | nmdc:mga08x19_83654_c1_131_835 | 234 |
| 140 | 3300005437 | Ga0070710_10060221 | Ga0070710_100602214 | 235 |
| 141 | 3300005459 | Ga0068867_100698287 | Ga0068867_1006982871 | 235 |
| 142 | 3300005468 | Ga0070707_100144459 | Ga0070707_1001444595 | 235 |
| 143 | 3300006871 | Ga0075434_100052805 | Ga0075434_1000528052 | 235 |
| 144 | 3300025910 | Ga0207684_10636693 | Ga0207684_106366932 | 235 |
| 145 | 3300025922 | Ga0207646_10127766 | Ga0207646_101277662 | 235 |
| 146 | 3300026089 | Ga0207648_10654080 | Ga0207648_106540802 | 235 |
| 147 | 3300031548 | Ga0307408_100108868 | Ga0307408_1001088682 | 235 |
| 148 | 3300032005 | Ga0307411_10042696 | Ga0307411_100426962 | 235 |
| 149 | 3300049578 | Ga0501042_0316311 | Ga0501042_0316311_26_733 | 235 |
| 150 | 3300050512 | nmdc:mga0n895_92402_c1 | nmdc:mga0n895_92402_c1_2222_2929 | 235 |
| 151 | 3300050514 | nmdc:mga08x19_409844_c1 | nmdc:mga08x19_409844_c1_193_900 | 235 |
| 152 | 3300050515 | nmdc:mga0a205_67487_c1 | nmdc:mga0a205_67487_c1_1220_1927 | 235 |
| 153 | 3300059424 | Ga0590075_033226 | Ga0590075_033226_546_1253 | 235 |
| 154 | 3300059426 | Ga0590077_003015 | Ga0590077_003015_2052_2759 | 235 |
| 155 | 3300005330 | Ga0070690_100000653 | Ga0070690_10000065317 | 236 |
| 156 | 3300005334 | Ga0068869_100001162 | Ga0068869_1000011628 | 236 |
| 157 | 3300005336 | Ga0070680_100000316 | Ga0070680_10000031621 | 236 |
| 158 | 3300005336 | Ga0070680_100110601 | Ga0070680_1001106013 | 236 |
| 159 | 3300005337 | Ga0070682_100007142 | Ga0070682_1000071429 | 236 |
| 160 | 3300005338 | Ga0068868_100038847 | Ga0068868_1000388472 | 236 |
| 161 | 3300005340 | Ga0070689_100000894 | Ga0070689_10000089410 | 236 |
| 162 | 3300005341 | Ga0070691_10000398 | Ga0070691_1000039817 | 236 |
| 163 | 3300005343 | Ga0070687_100000276 | Ga0070687_1000002768 | 236 |
| 164 | 3300005343 | Ga0070687_100158976 | Ga0070687_1001589761 | 236 |
| 165 | 3300005353 | Ga0070669_100685048 | Ga0070669_1006850481 | 236 |
| 166 | 3300005355 | Ga0070671_100134215 | Ga0070671_1001342154 | 236 |
| 167 | 3300005356 | Ga0070674_100311188 | Ga0070674_1003111882 | 236 |
| 168 | 3300005364 | Ga0070673_100039558 | Ga0070673_1000395583 | 236 |
| 169 | 3300005438 | Ga0070701_10000423 | Ga0070701_1000042313 | 236 |
| 170 | 3300005440 | Ga0070705_100000386 | Ga0070705_10000038621 | 236 |
| 171 | 3300005440 | Ga0070705_100019940 | Ga0070705_1000199403 | 236 |
| 172 | 3300005441 | Ga0070700_100000506 | Ga0070700_10000050618 | 236 |
| 173 | 3300005444 | Ga0070694_100001289 | Ga0070694_1000012899 | 236 |
| 174 | 3300005444 | Ga0070694_100007869 | Ga0070694_1000078692 | 236 |
| 175 | 3300005445 | Ga0070708_100404042 | Ga0070708_1004040422 | 236 |
| 176 | 3300005459 | Ga0068867_100001833 | Ga0068867_10000183317 | 236 |
| 177 | 3300005518 | Ga0070699_100416455 | Ga0070699_1004164552 | 236 |
| 178 | 3300005530 | Ga0070679_100006030 | Ga0070679_10000603010 | 236 |
| 179 | 3300005530 | Ga0070679_100848214 | Ga0070679_1008482141 | 236 |
| 180 | 3300005539 | Ga0068853_100061000 | Ga0068853_1000610002 | 236 |
| 181 | 3300005543 | Ga0070672_100235124 | Ga0070672_1002351242 | 236 |
| 182 | 3300005544 | Ga0070686_100000744 | Ga0070686_1000007449 | 236 |
| 183 | 3300005545 | Ga0070695_100000250 | Ga0070695_10000025014 | 236 |
| 184 | 3300005545 | Ga0070695_100026767 | Ga0070695_1000267673 | 236 |
| 185 | 3300005546 | Ga0070696_100000358 | Ga0070696_10000035816 | 236 |
| 186 | 3300005546 | Ga0070696_100131923 | Ga0070696_1001319232 | 236 |
| 187 | 3300005547 | Ga0070693_100000395 | Ga0070693_10000039511 | 236 |
| 188 | 3300005549 | Ga0070704_100000203 | Ga0070704_10000020320 | 236 |
| 189 | 3300005549 | Ga0070704_100002499 | Ga0070704_1000024995 | 236 |
| 190 | 3300005563 | Ga0068855_100001461 | Ga0068855_10000146119 | 236 |
| 191 | 3300005614 | Ga0068856_100007042 | Ga0068856_10000704211 | 236 |
| 192 | 3300005615 | Ga0070702_100000049 | Ga0070702_1000000499 | 236 |
| 193 | 3300005617 | Ga0068859_100012357 | Ga0068859_10001235711 | 236 |
| 194 | 3300005617 | Ga0068859_100074658 | Ga0068859_1000746586 | 236 |
| 195 | 3300005618 | Ga0068864_100614563 | Ga0068864_1006145631 | 236 |
| 196 | 3300005718 | Ga0068866_10002274 | Ga0068866_100022742 | 236 |
| 197 | 3300005719 | Ga0068861_100000724 | Ga0068861_10000072419 | 236 |
| 198 | 3300005719 | Ga0068861_100276401 | Ga0068861_1002764012 | 236 |
| 199 | 3300005719 | Ga0068861_100401252 | Ga0068861_1004012522 | 236 |
| 200 | 3300005840 | Ga0068870_10040159 | Ga0068870_100401592 | 236 |
| 201 | 3300005841 | Ga0068863_100731096 | Ga0068863_1007310962 | 236 |
| 202 | 3300005842 | Ga0068858_100001186 | Ga0068858_10000118617 | 236 |
| 203 | 3300005842 | Ga0068858_100091462 | Ga0068858_1000914624 | 236 |
| 204 | 3300005843 | Ga0068860_100008599 | Ga0068860_1000085997 | 236 |
| 205 | 3300005844 | Ga0068862_100001819 | Ga0068862_10000181918 | 236 |
| 206 | 3300005844 | Ga0068862_100052973 | Ga0068862_1000529732 | 236 |
| 207 | 3300006237 | Ga0097621_100000594 | Ga0097621_10000059419 | 236 |
| 208 | 3300006358 | Ga0068871_100000636 | Ga0068871_10000063620 | 236 |
| 209 | 3300006844 | Ga0075428_100042180 | Ga0075428_1000421802 | 236 |
| 210 | 3300006844 | Ga0075428_100658006 | Ga0075428_1006580062 | 236 |
| 211 | 3300006846 | Ga0075430_100000874 | Ga0075430_10000087418 | 236 |
| 212 | 3300006847 | Ga0075431_100244936 | Ga0075431_1002449362 | 236 |
| 213 | 3300006871 | Ga0075434_100004674 | Ga0075434_1000046743 | 236 |
| 214 | 3300006880 | Ga0075429_100012563 | Ga0075429_1000125639 | 236 |
| 215 | 3300006881 | Ga0068865_100000086 | Ga0068865_10000008622 | 236 |
| 216 | 3300006914 | Ga0075436_100003384 | Ga0075436_10000338413 | 236 |
| 217 | 3300006931 | Ga0097620_100012357 | Ga0097620_1000123574 | 236 |
| 218 | 3300006931 | Ga0097620_100074659 | Ga0097620_1000746596 | 236 |
| 219 | 3300007076 | Ga0075435_100004201 | Ga0075435_1000042013 | 236 |
| 220 | 3300009094 | Ga0111539_10145499 | Ga0111539_101454992 | 236 |
| 221 | 3300009094 | Ga0111539_10196393 | Ga0111539_101963931 | 236 |
| 222 | 3300009094 | Ga0111539_10369473 | Ga0111539_103694732 | 236 |
| 223 | 3300009098 | Ga0105245_10004564 | Ga0105245_1000456411 | 236 |
| 224 | 3300009147 | Ga0114129_10004560 | Ga0114129_1000456023 | 236 |
| 225 | 3300009147 | Ga0114129_10935822 | Ga0114129_109358222 | 236 |
| 226 | 3300009148 | Ga0105243_10002776 | Ga0105243_1000277614 | 236 |
| 227 | 3300009174 | Ga0105241_10036122 | Ga0105241_100361222 | 236 |
| 228 | 3300009176 | Ga0105242_10004524 | Ga0105242_100045248 | 236 |
| 229 | 3300009553 | Ga0105249_10020144 | Ga0105249_100201449 | 236 |
| 230 | 3300013297 | Ga0157378_10001361 | Ga0157378_100013619 | 236 |
| 231 | 3300014326 | Ga0157380_10035322 | Ga0157380_100353227 | 236 |
| 232 | 3300014745 | Ga0157377_10118642 | Ga0157377_101186422 | 236 |
| 233 | 3300014968 | Ga0157379_10455443 | Ga0157379_104554432 | 236 |
| 234 | 3300014969 | Ga0157376_10229808 | Ga0157376_102298082 | 236 |
| 235 | 3300025899 | Ga0207642_10002238 | Ga0207642_100022388 | 236 |
| 236 | 3300025901 | Ga0207688_10174561 | Ga0207688_101745612 | 236 |
| 237 | 3300025903 | Ga0207680_10638706 | Ga0207680_106387061 | 236 |
| 238 | 3300025904 | Ga0207647_10155417 | Ga0207647_101554172 | 236 |
| 239 | 3300025911 | Ga0207654_10017542 | Ga0207654_100175422 | 236 |
| 240 | 3300025913 | Ga0207695_10318065 | Ga0207695_103180652 | 236 |
| 241 | 3300025917 | Ga0207660_10003778 | Ga0207660_100037785 | 236 |
| 242 | 3300025917 | Ga0207660_10301771 | Ga0207660_103017712 | 236 |
| 243 | 3300025918 | Ga0207662_10006285 | Ga0207662_100062858 | 236 |
| 244 | 3300025921 | Ga0207652_10003435 | Ga0207652_1000343512 | 236 |
| 245 | 3300025923 | Ga0207681_10411562 | Ga0207681_104115622 | 236 |
| 246 | 3300025927 | Ga0207687_10006145 | Ga0207687_100061458 | 236 |
| 247 | 3300025934 | Ga0207686_10001108 | Ga0207686_1000110812 | 236 |
| 248 | 3300025935 | Ga0207709_10000686 | Ga0207709_1000068620 | 236 |
| 249 | 3300025936 | Ga0207670_10000865 | Ga0207670_100008656 | 236 |
| 250 | 3300025936 | Ga0207670_10054996 | Ga0207670_100549963 | 236 |
| 251 | 3300025937 | Ga0207669_10064683 | Ga0207669_100646833 | 236 |
| 252 | 3300025938 | Ga0207704_10025764 | Ga0207704_100257644 | 236 |
| 253 | 3300025939 | Ga0207665_10261679 | Ga0207665_102616792 | 236 |
| 254 | 3300025942 | Ga0207689_10000217 | Ga0207689_1000021738 | 236 |
| 255 | 3300025942 | Ga0207689_10075315 | Ga0207689_100753153 | 236 |
| 256 | 3300025949 | Ga0207667_10007910 | Ga0207667_1000791012 | 236 |
| 257 | 3300025949 | Ga0207667_10288406 | Ga0207667_102884063 | 236 |
| 258 | 3300025960 | Ga0207651_10069971 | Ga0207651_100699711 | 236 |
| 259 | 3300025961 | Ga0207712_10001713 | Ga0207712_100017138 | 236 |
| 260 | 3300025981 | Ga0207640_10010437 | Ga0207640_100104372 | 236 |
| 261 | 3300026023 | Ga0207677_10000917 | Ga0207677_1000091720 | 236 |
| 262 | 3300026035 | Ga0207703_10002068 | Ga0207703_1000206818 | 236 |
| 263 | 3300026035 | Ga0207703_10243462 | Ga0207703_102434622 | 236 |
| 264 | 3300026041 | Ga0207639_10123157 | Ga0207639_101231572 | 236 |
| 265 | 3300026075 | Ga0207708_10003928 | Ga0207708_100039288 | 236 |
| 266 | 3300026078 | Ga0207702_10072836 | Ga0207702_100728366 | 236 |
| 267 | 3300026088 | Ga0207641_10217491 | Ga0207641_102174912 | 236 |
| 268 | 3300026089 | Ga0207648_10000217 | Ga0207648_1000021724 | 236 |
| 269 | 3300026095 | Ga0207676_10522223 | Ga0207676_105222232 | 236 |
| 270 | 3300026118 | Ga0207675_100000310 | Ga0207675_10000031031 | 236 |
| 271 | 3300026118 | Ga0207675_100205782 | Ga0207675_1002057822 | 236 |
| 272 | 3300026118 | Ga0207675_100507270 | Ga0207675_1005072702 | 236 |
| 273 | 3300026142 | Ga0207698_10031394 | Ga0207698_100313941 | 236 |
| 274 | 3300027378 | Ga0209981_1006278 | Ga0209981_10062782 | 236 |
| 275 | 3300027462 | Ga0210000_1002107 | Ga0210000_10021074 | 236 |
| 276 | 3300027695 | Ga0209966_1028821 | Ga0209966_10288212 | 236 |
| 277 | 3300027907 | Ga0207428_10011517 | Ga0207428_100115174 | 236 |
| 278 | 3300027907 | Ga0207428_10171755 | Ga0207428_101717553 | 236 |
| 279 | 3300027907 | Ga0207428_10262383 | Ga0207428_102623832 | 236 |
| 280 | 3300028380 | Ga0268265_10039821 | Ga0268265_100398215 | 236 |
| 281 | 3300028381 | Ga0268264_10002238 | Ga0268264_1000223816 | 236 |
| 282 | 3300031691 | Ga0316579_10002937 | Ga0316579_100029374 | 236 |
| 283 | 3300031995 | Ga0307409_100257649 | Ga0307409_1002576492 | 236 |
| 284 | 3300032133 | Ga0316583_10012156 | Ga0316583_100121564 | 236 |
| 285 | 3300032133 | Ga0316583_10035681 | Ga0316583_100356812 | 236 |
| 286 | 3300034816 | Ga0373930_0024891 | Ga0373930_0024891_315_1025 | 236 |
| 287 | 3300034818 | Ga0373950_0002561 | Ga0373950_0002561_805_1515 | 236 |
| 288 | 3300034818 | Ga0373950_0016185 | Ga0373950_0016185_211_921 | 236 |
| 289 | 3300034819 | Ga0373958_0002738 | Ga0373958_0002738_470_1180 | 236 |
| 290 | 3300035084 | Ga0373928_0003487 | Ga0373928_0003487_1811_2521 | 236 |
| 291 | 3300035086 | Ga0373934_0136797 | Ga0373934_0136797_171_884 | 236 |
| 292 | 3300035088 | Ga0373940_0000894 | Ga0373940_0000894_588_1298 | 236 |
| 293 | 3300035089 | Ga0373944_0011798 | Ga0373944_0011798_337_1050 | 236 |
| 294 | 3300035090 | Ga0373949_0005225 | Ga0373949_0005225_2019_2729 | 236 |
| 295 | 3300035092 | Ga0373952_0012536 | Ga0373952_0012536_737_1447 | 236 |
| 296 | 3300035112 | Ga0373932_0000678 | Ga0373932_0000678_2011_2721 | 236 |
| 297 | 3300035114 | Ga0373939_0002206 | Ga0373939_0002206_1687_2397 | 236 |
| 298 | 3300035116 | Ga0373945_0003807 | Ga0373945_0003807_2822_3535 | 236 |
| 299 | 3300035121 | Ga0373960_0009094 | Ga0373960_0009094_524_1234 | 236 |
| 300 | 3300035171 | Ga0373946_0036179 | Ga0373946_0036179_938_1651 | 236 |
| 301 | 3300035172 | Ga0373955_0321326 | Ga0373955_0321326_43_756 | 236 |
| 302 | 3300035241 | Ga0373961_0032716 | Ga0373961_0032716_42_752 | 236 |
| 303 | 3300035410 | Ga0373924_0138462 | Ga0373924_0138462_14_727 | 236 |
| 304 | 3300035691 | Ga0373931_0030653 | Ga0373931_0030653_847_1557 | 236 |
| 305 | 3300035692 | Ga0373935_0107216 | Ga0373935_0107216_665_1378 | 236 |
| 306 | 3300035725 | Ga0373947_0060900 | Ga0373947_0060900_1018_1731 | 236 |
| 307 | 3300036647 | Ga0316582_0049026 | Ga0316582_0049026_663_1373 | 236 |
| 308 | 3300037588 | Ga0316581_0007174 | Ga0316581_0007174_1657_2367 | 236 |
| 309 | 3300045051 | Ga0451576_0000360 | Ga0451576_0000360_8860_9570 | 236 |
| 310 | 3300045051 | Ga0451576_0028622 | Ga0451576_0028622_4561_5271 | 236 |
| 311 | 3300045051 | Ga0451576_0030529 | Ga0451576_0030529_1547_2257 | 236 |
| 312 | 3300046472 | Ga0495580_0004091 | Ga0495580_0004091_666_1379 | 236 |
| 313 | 3300046491 | Ga0495584_0048837 | Ga0495584_0048837_1369_2079 | 236 |
| 314 | 3300046517 | Ga0495630_0233942 | Ga0495630_0233942_672_1385 | 236 |
| 315 | 3300046535 | Ga0495586_0045970 | Ga0495586_0045970_1488_2201 | 236 |
| 316 | 3300046615 | Ga0495656_0076787 | Ga0495656_0076787_250_960 | 236 |
| 317 | 3300046664 | Ga0495659_0029605 | Ga0495659_0029605_40_750 | 236 |
| 318 | 3300046674 | Ga0495588_0194291 | Ga0495588_0194291_310_1023 | 236 |
| 319 | 3300046681 | Ga0495647_0140781 | Ga0495647_0140781_202_915 | 236 |
| 320 | 3300046683 | Ga0495658_0079965 | Ga0495658_0079965_810_1523 | 236 |
| 321 | 3300046684 | Ga0495669_0030124 | Ga0495669_0030124_277_987 | 236 |
| 322 | 3300046691 | Ga0495670_0127338 | Ga0495670_0127338_225_935 | 236 |
| 323 | 3300049568 | Ga0501031_0022344 | Ga0501031_0022344_3101_3811 | 236 |
| 324 | 3300049568 | Ga0501031_0196867 | Ga0501031_0196867_413_1123 | 236 |
| 325 | 3300049569 | Ga0501032_0057616 | Ga0501032_0057616_1294_2004 | 236 |
| 326 | 3300049570 | Ga0501033_0011677 | Ga0501033_0011677_5237_5947 | 236 |
| 327 | 3300049571 | Ga0501034_0292022 | Ga0501034_0292022_759_1469 | 236 |
| 328 | 3300049572 | Ga0501036_0002300 | Ga0501036_0002300_6518_7228 | 236 |
| 329 | 3300049572 | Ga0501036_0215253 | Ga0501036_0215253_37_747 | 236 |
| 330 | 3300049573 | Ga0501037_0018828 | Ga0501037_0018828_1269_1979 | 236 |
| 331 | 3300049574 | Ga0501038_0009701 | Ga0501038_0009701_1599_2309 | 236 |
| 332 | 3300049575 | Ga0501039_0009384 | Ga0501039_0009384_4302_5012 | 236 |
| 333 | 3300049575 | Ga0501039_0020770 | Ga0501039_0020770_1034_1744 | 236 |
| 334 | 3300049575 | Ga0501039_0163287 | Ga0501039_0163287_696_1406 | 236 |
| 335 | 3300049576 | Ga0501040_0009441 | Ga0501040_0009441_1565_2275 | 236 |
| 336 | 3300049576 | Ga0501040_0014204 | Ga0501040_0014204_2323_3033 | 236 |
| 337 | 3300049577 | Ga0501041_0001358 | Ga0501041_0001358_2442_3152 | 236 |
| 338 | 3300049577 | Ga0501041_0148943 | Ga0501041_0148943_372_1082 | 236 |
| 339 | 3300049577 | Ga0501041_0177263 | Ga0501041_0177263_510_1220 | 236 |
| 340 | 3300049578 | Ga0501042_0001293 | Ga0501042_0001293_5429_6139 | 236 |
| 341 | 3300049578 | Ga0501042_0172210 | Ga0501042_0172210_89_799 | 236 |
| 342 | 3300049578 | Ga0501042_0679188 | Ga0501042_0679188_18_728 | 236 |
| 343 | 3300049579 | Ga0501043_0013889 | Ga0501043_0013889_1465_2175 | 236 |
| 344 | 3300049580 | Ga0501046_0005727 | Ga0501046_0005727_7890_8600 | 236 |
| 345 | 3300049581 | Ga0501047_0578497 | Ga0501047_0578497_217_927 | 236 |
| 346 | 3300049582 | Ga0501048_0028373 | Ga0501048_0028373_1600_2310 | 236 |
| 347 | 3300049582 | Ga0501048_0128457 | Ga0501048_0128457_471_1181 | 236 |
| 348 | 3300049586 | Ga0501070_0106334 | Ga0501070_0106334_152_862 | 236 |
| 349 | 3300049587 | Ga0501071_0028984 | Ga0501071_0028984_1306_2016 | 236 |
| 350 | 3300049588 | Ga0501072_0001780 | Ga0501072_0001780_7672_8382 | 236 |
| 351 | 3300049588 | Ga0501072_0017876 | Ga0501072_0017876_1515_2225 | 236 |
| 352 | 3300049588 | Ga0501072_0739681 | Ga0501072_0739681_18_728 | 236 |
| 353 | 3300049589 | Ga0501073_0046768 | Ga0501073_0046768_501_1211 | 236 |
| 354 | 3300049590 | Ga0501074_0027474 | Ga0501074_0027474_1058_1768 | 236 |
| 355 | 3300049590 | Ga0501074_0193210 | Ga0501074_0193210_446_1156 | 236 |
| 356 | 3300049591 | Ga0501075_0005102 | Ga0501075_0005102_1745_2455 | 236 |
| 357 | 3300049591 | Ga0501075_0089214 | Ga0501075_0089214_624_1334 | 236 |
| 358 | 3300049592 | Ga0501076_0001146 | Ga0501076_0001146_8236_8946 | 236 |
| 359 | 3300049593 | Ga0501077_0003582 | Ga0501077_0003582_1438_2148 | 236 |
| 360 | 3300049741 | Ga0501079_0002542 | Ga0501079_0002542_6701_7411 | 236 |
| 361 | 3300049742 | Ga0501080_0007707 | Ga0501080_0007707_6149_6859 | 236 |
| 362 | 3300049743 | Ga0501081_0000579 | Ga0501081_0000579_14816_15526 | 236 |
| 363 | 3300049744 | Ga0501083_0028440 | Ga0501083_0028440_487_1197 | 236 |
| 364 | 3300049822 | Ga0501035_0083336 | Ga0501035_0083336_694_1404 | 236 |
| 365 | 3300049824 | Ga0501045_0019729 | Ga0501045_0019729_1388_2098 | 236 |
| 366 | 3300050507 | nmdc:mga05p37_609947_c1 | nmdc:mga05p37_609947_c1_109_819 | 236 |
| 367 | 3300050508 | nmdc:mga09592_194108_c1 | nmdc:mga09592_194108_c1_897_1607 | 236 |
| 368 | 3300050508 | nmdc:mga09592_9976_c1 | nmdc:mga09592_9976_c1_4370_5080 | 236 |
| 369 | 3300050509 | nmdc:mga0qj67_2803_c1 | nmdc:mga0qj67_2803_c1_261_971 | 236 |
| 370 | 3300050509 | nmdc:mga0qj67_495514_c1 | nmdc:mga0qj67_495514_c1_236_946 | 236 |
| 371 | 3300050509 | nmdc:mga0qj67_497637_c1 | nmdc:mga0qj67_497637_c1_77_787 | 236 |
| 372 | 3300050510 | nmdc:mga06r32_19382_c1 | nmdc:mga06r32_19382_c1_308_1018 | 236 |
| 373 | 3300050511 | nmdc:mga08y16_647095_c1 | nmdc:mga08y16_647095_c1_150_860 | 236 |
| 374 | 3300050512 | nmdc:mga0n895_15776_c1 | nmdc:mga0n895_15776_c1_5379_6089 | 236 |
| 375 | 3300050513 | nmdc:mga0rr50_3083_c1 | nmdc:mga0rr50_3083_c1_300_1010 | 236 |
| 376 | 3300050514 | nmdc:mga08x19_1086_c1 | nmdc:mga08x19_1086_c1_14362_15072 | 236 |
| 377 | 3300050515 | nmdc:mga0a205_1767_c1 | nmdc:mga0a205_1767_c1_17002_17712 | 236 |
| 378 | 3300054114 | Ga0501084_0055456 | Ga0501084_0055456_2447_3157 | 236 |
| 379 | 3300060353 | Ga0501082_0009700 | Ga0501082_0009700_1643_2353 | 236 |
| 380 | 3300061734 | Ga0530510_0317605 | Ga0530510_0317605_293_1003 | 236 |
| 381 | 3300005328 | Ga0070676_10235355 | Ga0070676_102353551 | 238 |
| 382 | 3300005334 | Ga0068869_100033060 | Ga0068869_1000330606 | 238 |
| 383 | 3300005345 | Ga0070692_10209317 | Ga0070692_102093171 | 238 |
| 384 | 3300005347 | Ga0070668_100182092 | Ga0070668_1001820922 | 238 |
| 385 | 3300005353 | Ga0070669_100028104 | Ga0070669_1000281044 | 238 |
| 386 | 3300005354 | Ga0070675_100087689 | Ga0070675_1000876894 | 238 |
| 387 | 3300005364 | Ga0070673_100303408 | Ga0070673_1003034082 | 238 |
| 388 | 3300005438 | Ga0070701_10251961 | Ga0070701_102519612 | 238 |
| 389 | 3300005456 | Ga0070678_100302522 | Ga0070678_1003025222 | 238 |
| 390 | 3300005459 | Ga0068867_100013888 | Ga0068867_1000138883 | 238 |
| 391 | 3300005543 | Ga0070672_100176130 | Ga0070672_1001761302 | 238 |
| 392 | 3300005563 | Ga0068855_100233719 | Ga0068855_1002337192 | 238 |
| 393 | 3300005718 | Ga0068866_10106560 | Ga0068866_101065602 | 238 |
| 394 | 3300005844 | Ga0068862_100256034 | Ga0068862_1002560342 | 238 |
| 395 | 3300006844 | Ga0075428_100510175 | Ga0075428_1005101752 | 238 |
| 396 | 3300006881 | Ga0068865_100028410 | Ga0068865_1000284104 | 238 |
| 397 | 3300009094 | Ga0111539_10287674 | Ga0111539_102876742 | 238 |
| 398 | 3300009148 | Ga0105243_10103611 | Ga0105243_101036112 | 238 |
| 399 | 3300009553 | Ga0105249_10064105 | Ga0105249_100641053 | 238 |
| 400 | 3300013308 | Ga0157375_10573741 | Ga0157375_105737412 | 238 |
| 401 | 3300014326 | Ga0157380_10206015 | Ga0157380_102060152 | 238 |
| 402 | 3300014745 | Ga0157377_10020255 | Ga0157377_100202553 | 238 |
| 403 | 3300025899 | Ga0207642_10114566 | Ga0207642_101145661 | 238 |
| 404 | 3300025907 | Ga0207645_10085420 | Ga0207645_100854202 | 238 |
| 405 | 3300025908 | Ga0207643_10039440 | Ga0207643_100394403 | 238 |
| 406 | 3300025923 | Ga0207681_10036977 | Ga0207681_100369773 | 238 |
| 407 | 3300025935 | Ga0207709_10031001 | Ga0207709_100310013 | 238 |
| 408 | 3300025936 | Ga0207670_10187253 | Ga0207670_101872532 | 238 |
| 409 | 3300025940 | Ga0207691_10051405 | Ga0207691_100514054 | 238 |
| 410 | 3300025961 | Ga0207712_10323801 | Ga0207712_103238011 | 238 |
| 411 | 3300025972 | Ga0207668_10198308 | Ga0207668_101983082 | 238 |
| 412 | 3300026075 | Ga0207708_10195133 | Ga0207708_101951332 | 238 |
| 413 | 3300026075 | Ga0207708_10633109 | Ga0207708_106331091 | 238 |
| 414 | 3300026088 | Ga0207641_10666547 | Ga0207641_106665472 | 238 |
| 415 | 3300026089 | Ga0207648_10000816 | Ga0207648_100008165 | 238 |
| 416 | 3300026116 | Ga0207674_10228050 | Ga0207674_102280502 | 238 |
| 417 | 3300026118 | Ga0207675_100205391 | Ga0207675_1002053912 | 238 |
| 418 | 3300027907 | Ga0207428_10029446 | Ga0207428_100294463 | 238 |
| 419 | 3300028380 | Ga0268265_10060184 | Ga0268265_100601844 | 238 |
| 420 | 3300047315 | Ga0495581_0074453 | Ga0495581_0074453_1204_1923 | 238 |
| 421 | 3300049582 | Ga0501048_0036375 | Ga0501048_0036375_2510_3271 | 238 |
| 422 | 3300049588 | Ga0501072_0178352 | Ga0501072_0178352_170_931 | 238 |
| 423 | 3300049591 | Ga0501075_0297804 | Ga0501075_0297804_258_1019 | 238 |
| 424 | 3300049661 | Ga0501217_092890 | Ga0501217_092890_34_750 | 238 |
| 425 | 3300049668 | Ga0501233_052833 | Ga0501233_052833_238_954 | 238 |
| 426 | 3300050508 | nmdc:mga09592_724026_c1 | nmdc:mga09592_724026_c1_11_727 | 238 |
| 427 | 3300050509 | nmdc:mga0qj67_167706_c1 | nmdc:mga0qj67_167706_c1_698_1414 | 238 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2zp2-assembly2.cif.gz_B | c-terminal domain of kipi from bacillus subtilis | 0.9536 | 100 | 229 |
| 2zp2-assembly1.cif.gz_A | c-terminal domain of kipi from bacillus subtilis | 0.9435 | 100 | 229 |
| 2zp2-assembly2.cif.gz_B | c-terminal domain of kipi from bacillus subtilis | 0.9312 | 100 | 229 |
| 2zp2-assembly1.cif.gz_A | c-terminal domain of kipi from bacillus subtilis | 0.9209 | 100 | 229 |
| 3oep-assembly1.cif.gz_A | crystal structure of ttha0988 in space group p43212 | 0.9163 | 16 | 226 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3oreA02 | Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like | 0.9651 | 100 | 226 | 2.40.100.10 |
| af_Q2G095_94_231_2.40.100.10 | Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like | 0.9499 | 101 | 230 | 2.40.100.10 |
| 2zp2A00 | Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like | 0.9435 | 100 | 229 | 2.40.100.10 |
| 3mmlD02 | Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like | 0.928 | 93 | 226 | 2.40.100.10 |
| 2zp2A00 | Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like | 0.9209 | 100 | 229 | 2.40.100.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537R1W4-F1-model_v4 | 5-oxoprolinase subunit PxpB (EC 3.5.2.9) | 0.9946 | 101 | 237 |
GO:0005524
GO:0017168 |
| AF-A0A2V6H9H9-F1-model_v4 | Kinase inhibitor | 0.99 | 101 | 235 |
GO:0005524
GO:0016787 |
| AF-A0A2V5VZF5-F1-model_v4 | Carboxyltransferase domain-containing protein | 0.9883 | 124 | 235 |
GO:0005524
GO:0016787 |
| AF-A4NXI0-F1-model_v4 | Carboxyltransferase domain-containing protein | 0.9848 | 133 | 224 |
GO:0005524
GO:0016787 |
| AF-A0A379D3W4-F1-model_v4 | deleted | 0.9842 | 119 | 215 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar