F441439

General Info

Members Datasets Scaffolds Average Seq Length
427 186 854 195

Family's Representative Sequence

Representative Sequence 3300009177|Ga0105248_10131076|Ga0105248_101310763
Length 216
Sequence MRTVFFDIDTQMDFLYPAGALSVPGAEFVEDATARLNRYAAAHGIPVISTMDAHTENDPEFQQWPAHCVAGTLGQRKPTATLLEKRIVVPNTPGEVTLEGVEQFLLEKQTFSCFSNTRLEKLLEALKPDRVVVYGVVTEICVRFAAMGLLDLASFGTEQGDVRPSRDREVALTNSLEVELVTDAIKELNPTKQGEFFKEFQSRGGKRTTLAEIVSR

Samples

Sample ID Description Type Environment
1 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
80 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
81 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
82 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
120 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
121 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
122 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
123 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
124 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
125 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
126 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
127 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
128 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
129 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
130 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
131 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
132 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
133 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
134 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
135 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
136 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
137 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
138 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
139 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
140 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
141 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
142 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
143 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
144 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
145 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
146 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
147 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
148 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
149 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
150 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
151 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
152 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
153 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
154 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
155 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
156 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
157 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
158 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
159 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
160 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
161 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
162 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
163 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
164 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
165 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
166 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
167 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
168 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
169 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
170 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
171 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
172 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
173 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
174 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
175 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
176 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
177 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
178 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
179 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
180 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
181 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
182 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
183 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
184 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
185 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
186 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.7
Rhizosphere 96.02
Stem 0
Stem Tuber 0
Unclassified 26.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105248_10131076 3300009177 Bacteria 2829
2 Ga0070676_10014687 3300005328 Bacteria 4307
3 Ga0070683_100003418 3300005329 Bacteria 12880
4 Ga0070683_100032274 3300005329 Unclassified 4769
5 Ga0070683_100041126 3300005329 Bacteria 4251
6 Ga0070683_100164325 3300005329 Bacteria 2106
7 Ga0070683_100230356 3300005329 Unclassified 1761
8 Ga0070683_100509394 3300005329 Bacteria 1150
9 Ga0070683_100529347 3300005329 Bacteria 1126
10 Ga0070690_100581405 3300005330 Bacteria 848
11 Ga0070670_100349762 3300005331 Bacteria 1298
12 Ga0068869_100469711 3300005334 Bacteria 1046
13 Ga0068869_101158371 3300005334 Unclassified 678
14 Ga0070666_10029134 3300005335 Bacteria 3628
15 Ga0070680_100004677 3300005336 Bacteria 10294
16 Ga0070680_100042790 3300005336 Bacteria 3677
17 Ga0068868_100011541 3300005338 Bacteria 6436
18 Ga0068868_100131676 3300005338 Unclassified 2047
19 Ga0068868_100179232 3300005338 Bacteria 1757
20 Ga0068868_100337287 3300005338 Bacteria 1288
21 Ga0070660_100034538 3300005339 Bacteria 3822
22 Ga0070660_100312975 3300005339 Bacteria 1288
23 Ga0070689_100609396 3300005340 Unclassified 946
24 Ga0070691_10000187 3300005341 Bacteria 20677
25 Ga0070691_10467659 3300005341 Unclassified 723
26 Ga0070661_100748255 3300005344 Unclassified 799
27 Ga0070661_100837576 3300005344 Unclassified 756
28 Ga0070669_100227946 3300005353 Bacteria 1475
29 Ga0070669_100381657 3300005353 Bacteria 1149
30 Ga0070671_100019683 3300005355 Bacteria 5496
31 Ga0070671_100183844 3300005355 Unclassified 1770
32 Ga0070673_100240408 3300005364 Unclassified 1574
33 Ga0070673_101089486 3300005364 Unclassified 746
34 Ga0070659_100190113 3300005366 Bacteria 1687
35 Ga0070667_100022682 3300005367 Bacteria 5205
36 Ga0070667_100807860 3300005367 Bacteria 871
37 Ga0070709_10023369 3300005434 Unclassified 3628
38 Ga0070713_100012516 3300005436 Bacteria 6227
39 Ga0070713_100268137 3300005436 Bacteria 1562
40 Ga0070710_10298640 3300005437 Bacteria 1050
41 Ga0070711_100039951 3300005439 Unclassified 3162
42 Ga0070700_100263363 3300005441 Bacteria 1242
43 Ga0070663_100302204 3300005455 Bacteria 1281
44 Ga0070662_100020721 3300005457 Bacteria 4483
45 Ga0070681_10036958 3300005458 Bacteria 4901
46 Ga0070681_10038529 3300005458 Bacteria 4792
47 Ga0070681_10336085 3300005458 Bacteria 1420
48 Ga0070681_10829269 3300005458 Bacteria 842
49 Ga0068867_100046849 3300005459 Bacteria 3177
50 Ga0070679_100034418 3300005530 Bacteria 5020
51 Ga0070679_100087124 3300005530 Bacteria 3109
52 Ga0070679_100159778 3300005530 Unclassified 2228
53 Ga0070684_100000001 3300005535 Bacteria 300240
54 Ga0070684_100028197 3300005535 Bacteria 4748
55 Ga0070684_100046936 3300005535 Bacteria 3743
56 Ga0070684_100089115 3300005535 Unclassified 2742
57 Ga0070684_100514937 3300005535 Bacteria 1109
58 Ga0070684_100670301 3300005535 Bacteria 966
59 Ga0070697_100158083 3300005536 Bacteria 1914
60 Ga0068853_100014281 3300005539 Bacteria 6501
61 Ga0068853_100021034 3300005539 Bacteria 5431
62 Ga0068853_100111509 3300005539 Bacteria 2430
63 Ga0070672_100344885 3300005543 Bacteria 1269
64 Ga0070686_100092981 3300005544 Bacteria 2021
65 Ga0070695_100230583 3300005545 Bacteria 1338
66 Ga0070696_100285129 3300005546 Unclassified 1260
67 Ga0070693_100072053 3300005547 Bacteria 2037
68 Ga0070693_100226263 3300005547 Bacteria 1228
69 Ga0070665_100024082 3300005548 Bacteria 6130
70 Ga0070665_100051401 3300005548 Bacteria 4133
71 Ga0070665_100222264 3300005548 Bacteria 1889
72 Ga0070665_100662310 3300005548 Unclassified 1057
73 Ga0068855_100016865 3300005563 Bacteria 8783
74 Ga0068855_100223157 3300005563 Unclassified 2112
75 Ga0068855_100873518 3300005563 Bacteria 951
76 Ga0070664_100325568 3300005564 Bacteria 1393
77 Ga0068857_100000098 3300005577 Bacteria 50740
78 Ga0068857_100004047 3300005577 Bacteria 12341
79 Ga0068857_100009821 3300005577 Bacteria 8313
80 Ga0068857_100310336 3300005577 Bacteria 1455
81 Ga0068857_100828559 3300005577 Bacteria 884
82 Ga0068854_100073096 3300005578 Bacteria 2512
83 Ga0068854_100633549 3300005578 Bacteria 916
84 Ga0068856_100000431 3300005614 Bacteria 46002
85 Ga0068856_100006315 3300005614 Bacteria 11627
86 Ga0068856_100423540 3300005614 Unclassified 1351
87 Ga0068856_100655290 3300005614 Unclassified 1070
88 Ga0068852_100024937 3300005616 Bacteria 4839
89 Ga0068852_100071624 3300005616 Unclassified 3044
90 Ga0068859_100045580 3300005617 Bacteria 4405
91 Ga0068859_100433945 3300005617 Unclassified 1410
92 Ga0068859_100977554 3300005617 Unclassified 929
93 Ga0068864_100066050 3300005618 Bacteria 3139
94 Ga0068870_10041720 3300005840 Bacteria 2386
95 Ga0068863_100251709 3300005841 Bacteria 1706
96 Ga0068858_100008085 3300005842 Bacteria 10127
97 Ga0068858_100076050 3300005842 Bacteria 3119
98 Ga0068858_100189050 3300005842 Unclassified 1946
99 Ga0068860_100293756 3300005843 Bacteria 1591
100 Ga0068862_100533946 3300005844 Unclassified 1118
101 Ga0070717_10184859 3300006028 Bacteria 1818
102 Ga0097621_100029981 3300006237 Bacteria 4302
103 Ga0097621_100069057 3300006237 Unclassified 2917
104 Ga0097621_100658998 3300006237 Bacteria 961
105 Ga0068871_100037438 3300006358 Bacteria 3869
106 Ga0068871_100071547 3300006358 Bacteria 2853
107 Ga0068871_100249140 3300006358 Bacteria 1547
108 Ga0068871_100532523 3300006358 Bacteria 1062
109 Ga0075431_100198953 3300006847 Bacteria 2051
110 Ga0068865_100023080 3300006881 Bacteria 4069
111 Ga0068865_100056297 3300006881 Bacteria 2739
112 Ga0068865_101056472 3300006881 Unclassified 713
113 Ga0097620_100045580 3300006931 Bacteria 4405
114 Ga0097620_100433931 3300006931 Unclassified 1410
115 Ga0097620_100977524 3300006931 Unclassified 929
116 Ga0105240_10008363 3300009093 Bacteria 14808
117 Ga0105240_10023752 3300009093 Bacteria 8098
118 Ga0105240_10048900 3300009093 Bacteria 5343
119 Ga0105240_10931905 3300009093 Bacteria 933
120 Ga0105240_11513821 3300009093 Unclassified 703
121 Ga0105245_10003251 3300009098 Bacteria 14570
122 Ga0105245_10005874 3300009098 Bacteria 10781
123 Ga0105245_10037265 3300009098 Bacteria 4323
124 Ga0105245_10116555 3300009098 Bacteria 2491
125 Ga0105245_10455281 3300009098 Unclassified 1289
126 Ga0105245_10635032 3300009098 Bacteria 1097
127 Ga0105245_10638416 3300009098 Bacteria 1094
128 Ga0114129_10897210 3300009147 Unclassified 1123
129 Ga0105243_10072875 3300009148 Unclassified 2781
130 Ga0105243_10193094 3300009148 Unclassified 1780
131 Ga0105243_10423301 3300009148 Bacteria 1243
132 Ga0105241_10008193 3300009174 Bacteria 7691
133 Ga0105241_10009793 3300009174 Bacteria 7043
134 Ga0105241_10322688 3300009174 Bacteria 1332
135 Ga0105242_10021412 3300009176 Bacteria 5076
136 Ga0105242_10030270 3300009176 Bacteria 4322
137 Ga0105242_10113407 3300009176 Bacteria 2315
138 Ga0105242_10158842 3300009176 Bacteria 1977
139 Ga0105242_10676760 3300009176 Unclassified 1006
140 Ga0105242_10787653 3300009176 Unclassified 940
141 Ga0105248_10007529 3300009177 Bacteria 11952
142 Ga0105248_10011780 3300009177 Bacteria 9647
143 Ga0105248_10015831 3300009177 Bacteria 8312
144 Ga0105248_10063548 3300009177 Unclassified 4144
145 Ga0105248_10591261 3300009177 Bacteria 1252
146 Ga0105248_10681571 3300009177 Bacteria 1160
147 Ga0105248_11061703 3300009177 Unclassified 915
148 Ga0105237_10005870 3300009545 Bacteria 13768
149 Ga0105237_10028781 3300009545 Bacteria 5654
150 Ga0105237_10275020 3300009545 Bacteria 1687
151 Ga0105237_10412093 3300009545 Bacteria 1356
152 Ga0105238_10002726 3300009551 Bacteria 17591
153 Ga0105238_10012072 3300009551 Bacteria 8705
154 Ga0105238_10022009 3300009551 Bacteria 6497
155 Ga0105238_10033662 3300009551 Bacteria 5214
156 Ga0105238_10094876 3300009551 Bacteria 2971
157 Ga0105238_10101961 3300009551 Bacteria 2852
158 Ga0105238_10517291 3300009551 Bacteria 1196
159 Ga0105238_10582626 3300009551 Bacteria 1125
160 Ga0105238_11214536 3300009551 Unclassified 778
161 Ga0105249_10009071 3300009553 Bacteria 8696
162 Ga0105239_10009062 3300010375 Bacteria 11260
163 Ga0105239_10017304 3300010375 Bacteria 7972
164 Ga0105239_10025792 3300010375 Bacteria 6473
165 Ga0105239_10125408 3300010375 Unclassified 2853
166 Ga0105239_10183260 3300010375 Bacteria 2343
167 Ga0105246_10090577 3300011119 Bacteria 2203
168 Ga0105246_10264605 3300011119 Bacteria 1371
169 Ga0157373_10344363 3300013100 Unclassified 1063
170 Ga0157370_10003831 3300013104 Bacteria 17540
171 Ga0157370_10004478 3300013104 Bacteria 16005
172 Ga0157370_10206971 3300013104 Bacteria 1819
173 Ga0157369_10001536 3300013105 Bacteria 28280
174 Ga0157369_10006628 3300013105 Bacteria 13393
175 Ga0157369_10017312 3300013105 Bacteria 8101
176 Ga0157369_10502306 3300013105 Bacteria 1255
177 Ga0157374_10095550 3300013296 Unclassified 2842
178 Ga0157374_10119135 3300013296 Unclassified 2546
179 Ga0157374_10167832 3300013296 Bacteria 2140
180 Ga0157374_10226666 3300013296 Bacteria 1835
181 Ga0157378_10009773 3300013297 Bacteria 8361
182 Ga0157378_10318956 3300013297 Unclassified 1509
183 Ga0157378_11234924 3300013297 Bacteria 787
184 Ga0163162_10004370 3300013306 Bacteria 13606
185 Ga0163162_10212760 3300013306 Unclassified 2063
186 Ga0163162_10383640 3300013306 Bacteria 1538
187 Ga0163162_10612552 3300013306 Bacteria 1214
188 Ga0163162_10761313 3300013306 Bacteria 1087
189 Ga0157372_10020713 3300013307 Bacteria 7098
190 Ga0157372_10342949 3300013307 Bacteria 1740
191 Ga0157372_10381920 3300013307 Unclassified 1641
192 Ga0157372_11007514 3300013307 Bacteria 965
193 Ga0157375_11144429 3300013308 Unclassified 912
194 Ga0163163_10013351 3300014325 Bacteria 7518
195 Ga0163163_10077413 3300014325 Bacteria 3321
196 Ga0163163_10088531 3300014325 Unclassified 3107
197 Ga0163163_10317490 3300014325 Bacteria 1611
198 Ga0163163_11025549 3300014325 Bacteria 888
199 Ga0157379_10190171 3300014968 Unclassified 1855
200 Ga0157379_10311695 3300014968 Bacteria 1435
201 Ga0157376_10002587 3300014969 Bacteria 12284
202 Ga0157376_10008128 3300014969 Bacteria 7542
203 Ga0157376_10038479 3300014969 Bacteria 3892
204 Ga0157376_10290549 3300014969 Bacteria 1543
205 Ga0157376_11012244 3300014969 Bacteria 854
206 Ga0157376_11347893 3300014969 Bacteria 744
207 Ga0213874_10009831 3300021377 Bacteria 2378
208 Ga0213876_10061829 3300021384 Bacteria 1976
209 Ga0213875_10000069 3300021388 Bacteria 121776
210 Ga0213875_10074234 3300021388 Bacteria 1587
211 Ga0207680_10010806 3300025903 Bacteria 4583
212 Ga0207680_10326236 3300025903 Bacteria 1074
213 Ga0207699_10008634 3300025906 Bacteria 5038
214 Ga0207645_10037509 3300025907 Bacteria 3109
215 Ga0207705_10752840 3300025909 Bacteria 757
216 Ga0207654_10017854 3300025911 Bacteria 3717
217 Ga0207654_10409258 3300025911 Unclassified 944
218 Ga0207707_10000509 3300025912 Bacteria 39960
219 Ga0207707_10053635 3300025912 Bacteria 3510
220 Ga0207707_10527167 3300025912 Bacteria 1005
221 Ga0207695_10000470 3300025913 Bacteria 87551
222 Ga0207695_10001269 3300025913 Bacteria 42929
223 Ga0207695_10004183 3300025913 Bacteria 19831
224 Ga0207695_10071370 3300025913 Unclassified 3547
225 Ga0207695_10718075 3300025913 Unclassified 880
226 Ga0207671_10013885 3300025914 Bacteria 6395
227 Ga0207671_10039256 3300025914 Bacteria 3506
228 Ga0207671_10449848 3300025914 Bacteria 1026
229 Ga0207660_10010364 3300025917 Bacteria 6048
230 Ga0207660_10311119 3300025917 Unclassified 1256
231 Ga0207657_10037582 3300025919 Bacteria 4321
232 Ga0207657_10053774 3300025919 Bacteria 3486
233 Ga0207652_10003746 3300025921 Bacteria 12472
234 Ga0207652_10747794 3300025921 Unclassified 870
235 Ga0207652_11090234 3300025921 Bacteria 699
236 Ga0207694_10010677 3300025924 Bacteria 6930
237 Ga0207694_10012773 3300025924 Bacteria 6327
238 Ga0207694_10036053 3300025924 Bacteria 3794
239 Ga0207694_10441831 3300025924 Bacteria 1085
240 Ga0207694_10493280 3300025924 Bacteria 1025
241 Ga0207694_10866959 3300025924 Bacteria 763
242 Ga0207687_10002706 3300025927 Bacteria 11994
243 Ga0207687_10014679 3300025927 Bacteria 5128
244 Ga0207687_10118107 3300025927 Unclassified 1979
245 Ga0207687_10216623 3300025927 Bacteria 1505
246 Ga0207700_10215913 3300025928 Bacteria 1624
247 Ga0207700_10522741 3300025928 Unclassified 1052
248 Ga0207700_10679037 3300025928 Bacteria 919
249 Ga0207644_10257256 3300025931 Unclassified 1395
250 Ga0207644_10306662 3300025931 Bacteria 1281
251 Ga0207706_10022998 3300025933 Bacteria 5597
252 Ga0207686_10007958 3300025934 Bacteria 5716
253 Ga0207686_10162856 3300025934 Unclassified 1565
254 Ga0207686_10335012 3300025934 Unclassified 1135
255 Ga0207709_10236064 3300025935 Unclassified 1327
256 Ga0207709_10259261 3300025935 Bacteria 1274
257 Ga0207709_10552320 3300025935 Unclassified 906
258 Ga0207704_10252381 3300025938 Bacteria 1325
259 Ga0207704_10312505 3300025938 Bacteria 1209
260 Ga0207691_10424511 3300025940 Bacteria 1133
261 Ga0207711_10002291 3300025941 Bacteria 17168
262 Ga0207711_10004850 3300025941 Bacteria 11434
263 Ga0207711_10119137 3300025941 Bacteria 2355
264 Ga0207711_10357879 3300025941 Unclassified 1352
265 Ga0207711_10434033 3300025941 Unclassified 1222
266 Ga0207661_10000016 3300025944 Bacteria 305159
267 Ga0207661_10015741 3300025944 Bacteria 5571
268 Ga0207661_10016473 3300025944 Bacteria 5453
269 Ga0207661_10026736 3300025944 Unclassified 4401
270 Ga0207661_10172197 3300025944 Unclassified 1885
271 Ga0207661_10178024 3300025944 Bacteria 1855
272 Ga0207661_10417596 3300025944 Bacteria 1218
273 Ga0207661_10946432 3300025944 Bacteria 793
274 Ga0207679_10069268 3300025945 Unclassified 2654
275 Ga0207667_10000145 3300025949 Bacteria 107389
276 Ga0207667_10001679 3300025949 Bacteria 27883
277 Ga0207667_10022438 3300025949 Bacteria 6974
278 Ga0207667_10621956 3300025949 Bacteria 1087
279 Ga0207651_10142331 3300025960 Unclassified 1854
280 Ga0207651_10320268 3300025960 Unclassified 1296
281 Ga0207712_10041532 3300025961 Bacteria 3162
282 Ga0207658_10023617 3300025986 Bacteria 4294
283 Ga0207658_10075083 3300025986 Bacteria 2571
284 Ga0207677_10010168 3300026023 Bacteria 5316
285 Ga0207703_10015212 3300026035 Bacteria 6003
286 Ga0207703_10064301 3300026035 Bacteria 3011
287 Ga0207703_10068870 3300026035 Bacteria 2916
288 Ga0207703_11121738 3300026035 Unclassified 756
289 Ga0207639_10923574 3300026041 Unclassified 816
290 Ga0207708_10281301 3300026075 Bacteria 1348
291 Ga0207702_10023773 3300026078 Bacteria 5083
292 Ga0207702_10033045 3300026078 Bacteria 4319
293 Ga0207702_10351478 3300026078 Unclassified 1411
294 Ga0207702_10994360 3300026078 Unclassified 832
295 Ga0207641_10089233 3300026088 Unclassified 2694
296 Ga0207641_10446834 3300026088 Bacteria 1249
297 Ga0207641_10809353 3300026088 Bacteria 927
298 Ga0207648_10050837 3300026089 Bacteria 3624
299 Ga0207648_11372994 3300026089 Unclassified 664
300 Ga0207676_10607493 3300026095 Bacteria 1051
301 Ga0207674_10000264 3300026116 Bacteria 65695
302 Ga0207674_10001887 3300026116 Bacteria 26662
303 Ga0207674_10017376 3300026116 Bacteria 7849
304 Ga0207674_10217630 3300026116 Bacteria 1858
305 Ga0207674_10770797 3300026116 Unclassified 928
306 Ga0268266_10014770 3300028379 Bacteria 6707
307 Ga0268266_10058823 3300028379 Bacteria 3310
308 Ga0268266_10885627 3300028379 Unclassified 863
309 Ga0265323_10001662 3300028653 Bacteria 10672
310 Ga0265324_10017309 3300029957 Bacteria 2622
311 Ga0265332_10051557 3300031238 Bacteria 1767
312 Ga0265320_10034876 3300031240 Bacteria 2554
313 Ga0265320_10155414 3300031240 Bacteria 1032
314 Ga0265329_10044020 3300031242 Bacteria 1428
315 Ga0265340_10006277 3300031247 Bacteria 6550
316 Ga0265331_10001122 3300031250 Bacteria 20520
317 Ga0265331_10032484 3300031250 Bacteria 2586
318 Ga0265331_10269541 3300031250 Bacteria 763
319 Ga0265316_10135340 3300031344 Bacteria 1854
320 Ga0265316_10144825 3300031344 Unclassified 1782
321 Ga0265316_10230226 3300031344 Bacteria 1365
322 Ga0265316_10567505 3300031344 Unclassified 806
323 Ga0265313_10000996 3300031595 Bacteria 27796
324 Ga0265314_10002334 3300031711 Bacteria 19605
325 Ga0265314_10003167 3300031711 Bacteria 16122
326 Ga0373926_0106681 3300035083 Unclassified 1050
327 Ga0373929_0078905 3300035085 Unclassified 799
328 Ga0373934_0026067 3300035086 Unclassified 2266
329 Ga0373944_0029608 3300035089 Bacteria 1638
330 Ga0373923_0177360 3300035111 Unclassified 978
331 Ga0373953_0044552 3300035117 Unclassified 1774
332 Ga0373953_0076803 3300035117 Bacteria 1384
333 Ga0373954_0024489 3300035118 Bacteria 2752
334 Ga0373956_0076667 3300035119 Bacteria 1530
335 Ga0373956_0120837 3300035119 Unclassified 1223
336 Ga0373943_0158755 3300035170 Unclassified 1230
337 Ga0373955_0004116 3300035172 Bacteria 6419
338 Ga0373955_0008499 3300035172 Bacteria 4771
339 Ga0373955_0327932 3300035172 Bacteria 925
340 Ga0373935_0160530 3300035692 Unclassified 1532
341 Ga0373927_0029449 3300035695 Unclassified 3579
342 Ga0373927_0081798 3300035695 Unclassified 2093
343 Ga0373933_0051874 3300035724 Unclassified 2453
344 Ga0373933_0199793 3300035724 Unclassified 1279
345 Ga0373947_0269136 3300035725 Unclassified 1131
346 Ga0373937_0021395 3300036401 Bacteria 5806
347 Ga0373937_0042315 3300036401 Bacteria 4155
348 Ga0373937_0062561 3300036401 Unclassified 3422
349 Ga0373937_0192593 3300036401 Bacteria 1916
350 Ga0373937_0199728 3300036401 Unclassified 1880
351 Ga0373925_0037953 3300037068 Unclassified 3559
352 Ga0373925_0582562 3300037068 Unclassified 921
353 Ga0436364_0053660 3300037853 Bacteria 5706
354 Ga0436364_0278774 3300037853 Bacteria 400541
355 Ga0436364_0351880 3300037853 Bacteria 1612
356 Ga0436364_0997537 3300037853 Bacteria 8515
357 Ga0436365_0399293 3300039437 Unclassified 2565
358 Ga0436365_1088351 3300039437 Unclassified 2287
359 Ga0436365_1399089 3300039437 Bacteria 8532
360 Ga0436365_1581627 3300039437 Bacteria 3330
361 Ga0436363_0772611 3300039450 Unclassified 4750
362 Ga0453684_0886892 3300044712 Bacteria 956
363 Ga0451576_0281119 3300045051 Unclassified 1740
364 Ga0495629_0442022 3300046459 Unclassified 881
365 Ga0495651_0022041 3300046462 Bacteria 4954
366 Ga0495580_0001281 3300046472 Bacteria 22162
367 Ga0495580_0010097 3300046472 Bacteria 7377
368 Ga0495580_0015606 3300046472 Bacteria 5724
369 Ga0495580_0281796 3300046472 Bacteria 1134
370 Ga0495582_0087335 3300046473 Bacteria 1736
371 Ga0495639_0020171 3300046475 Bacteria 2912
372 Ga0495664_0168686 3300046477 Bacteria 1328
373 Ga0495594_0204675 3300046499 Bacteria 1125
374 Ga0495630_0098754 3300046517 Bacteria 2209
375 Ga0495630_0139833 3300046517 Unclassified 1841
376 Ga0495630_0644357 3300046517 Bacteria 811
377 Ga0495630_0707790 3300046517 Unclassified 770
378 Ga0495666_0075598 3300046526 Unclassified 1597
379 Ga0495652_0031380 3300046529 Bacteria 4654
380 Ga0495665_0060964 3300046531 Bacteria 1992
381 Ga0495665_0323094 3300046531 Bacteria 788
382 Ga0495586_0011746 3300046535 Bacteria 4657
383 Ga0495587_0011234 3300046536 Bacteria 5676
384 Ga0495587_0052437 3300046536 Unclassified 2407
385 Ga0495645_0027471 3300046543 Bacteria 4136
386 Ga0495645_0384421 3300046543 Bacteria 897
387 Ga0495667_0013052 3300046559 Bacteria 5627
388 Ga0495667_0147457 3300046559 Bacteria 1515
389 Ga0495667_0194766 3300046559 Unclassified 1298
390 Ga0495667_0388246 3300046559 Bacteria 880
391 Ga0495635_0112758 3300046663 Bacteria 1857
392 Ga0495599_0137583 3300046678 Bacteria 1516
393 Ga0495623_0059040 3300046679 Bacteria 2411
394 Ga0495623_0076558 3300046679 Bacteria 2076
395 Ga0495623_0090595 3300046679 Bacteria 1878
396 Ga0495646_0077183 3300046680 Bacteria 1949
397 Ga0495658_0066034 3300046683 Bacteria 2089
398 Ga0495669_0200612 3300046684 Bacteria 953
399 Ga0495613_0091943 3300046689 Bacteria 2197
400 Ga0495613_0474698 3300046689 Unclassified 845
401 Ga0495613_0544804 3300046689 Bacteria 777
402 Ga0495600_0157452 3300046809 Bacteria 1469
403 Ga0495604_0108981 3300047317 Bacteria 2022
404 Ga0495604_0137305 3300047317 Bacteria 1751
405 Ga0495604_0149223 3300047317 Bacteria 1663
406 Ga0495674_0017662 3300047319 Bacteria 6643
407 Ga0495674_0018046 3300047319 Bacteria 6569
408 Ga0495674_0856013 3300047319 Bacteria 704
409 Ga0495680_0281006 3300047322 Bacteria 1173
410 Ga0495675_0011438 3300047444 Bacteria 5571
411 Ga0495684_0006797 3300047471 Bacteria 8881
412 Ga0495684_0022796 3300047471 Unclassified 4815
413 Ga0495684_0032708 3300047471 Bacteria 3994
414 Ga0495684_0277809 3300047471 Bacteria 1210
415 Ga0495684_0362533 3300047471 Bacteria 1026
416 Ga0495684_0549796 3300047471 Unclassified 786
417 Ga0495593_0286155 3300047673 Unclassified 824
418 Ga0495602_0006700 3300048088 Bacteria 12076
419 Ga0495602_0023142 3300048088 Bacteria 6062
420 Ga0496104_0017453 3300048907 Bacteria 6536
421 Ga0496104_0192000 3300048907 Unclassified 1954
422 Ga0496113_0665763 3300048916 Bacteria 832
423 Ga0496119_0378254 3300048922 Unclassified 680
424 Ga0501068_0262950 3300049584 Unclassified 1101
425 nmdc:mga06r32_102966_c1 3300050510 Bacteria 2803
426 nmdc:mga0rr50_488560_c1 3300050513 Bacteria 1046
427 Ga0495619_0202141 3300053085 Bacteria 1375
428 Ga0105248_10131076
429 Ga0070676_10014687
430 Ga0070683_100003418
431 Ga0070683_100032274
432 Ga0070683_100041126
433 Ga0070683_100164325
434 Ga0070683_100230356
435 Ga0070683_100509394
436 Ga0070683_100529347
437 Ga0070690_100581405
438 Ga0070670_100349762
439 Ga0068869_100469711
440 Ga0068869_101158371
441 Ga0070666_10029134
442 Ga0070680_100004677
443 Ga0070680_100042790
444 Ga0068868_100011541
445 Ga0068868_100131676
446 Ga0068868_100179232
447 Ga0068868_100337287
448 Ga0070660_100034538
449 Ga0070660_100312975
450 Ga0070689_100609396
451 Ga0070691_10000187
452 Ga0070691_10467659
453 Ga0070661_100748255
454 Ga0070661_100837576
455 Ga0070669_100227946
456 Ga0070669_100381657
457 Ga0070671_100019683
458 Ga0070671_100183844
459 Ga0070673_100240408
460 Ga0070673_101089486
461 Ga0070659_100190113
462 Ga0070667_100022682
463 Ga0070667_100807860
464 Ga0070709_10023369
465 Ga0070713_100012516
466 Ga0070713_100268137
467 Ga0070710_10298640
468 Ga0070711_100039951
469 Ga0070700_100263363
470 Ga0070663_100302204
471 Ga0070662_100020721
472 Ga0070681_10036958
473 Ga0070681_10038529
474 Ga0070681_10336085
475 Ga0070681_10829269
476 Ga0068867_100046849
477 Ga0070679_100034418
478 Ga0070679_100087124
479 Ga0070679_100159778
480 Ga0070684_100000001
481 Ga0070684_100028197
482 Ga0070684_100046936
483 Ga0070684_100089115
484 Ga0070684_100514937
485 Ga0070684_100670301
486 Ga0070697_100158083
487 Ga0068853_100014281
488 Ga0068853_100021034
489 Ga0068853_100111509
490 Ga0070672_100344885
491 Ga0070686_100092981
492 Ga0070695_100230583
493 Ga0070696_100285129
494 Ga0070693_100072053
495 Ga0070693_100226263
496 Ga0070665_100024082
497 Ga0070665_100051401
498 Ga0070665_100222264
499 Ga0070665_100662310
500 Ga0068855_100016865
501 Ga0068855_100223157
502 Ga0068855_100873518
503 Ga0070664_100325568
504 Ga0068857_100000098
505 Ga0068857_100004047
506 Ga0068857_100009821
507 Ga0068857_100310336
508 Ga0068857_100828559
509 Ga0068854_100073096
510 Ga0068854_100633549
511 Ga0068856_100000431
512 Ga0068856_100006315
513 Ga0068856_100423540
514 Ga0068856_100655290
515 Ga0068852_100024937
516 Ga0068852_100071624
517 Ga0068859_100045580
518 Ga0068859_100433945
519 Ga0068859_100977554
520 Ga0068864_100066050
521 Ga0068870_10041720
522 Ga0068863_100251709
523 Ga0068858_100008085
524 Ga0068858_100076050
525 Ga0068858_100189050
526 Ga0068860_100293756
527 Ga0068862_100533946
528 Ga0070717_10184859
529 Ga0097621_100029981
530 Ga0097621_100069057
531 Ga0097621_100658998
532 Ga0068871_100037438
533 Ga0068871_100071547
534 Ga0068871_100249140
535 Ga0068871_100532523
536 Ga0075431_100198953
537 Ga0068865_100023080
538 Ga0068865_100056297
539 Ga0068865_101056472
540 Ga0097620_100045580
541 Ga0097620_100433931
542 Ga0097620_100977524
543 Ga0105240_10008363
544 Ga0105240_10023752
545 Ga0105240_10048900
546 Ga0105240_10931905
547 Ga0105240_11513821
548 Ga0105245_10003251
549 Ga0105245_10005874
550 Ga0105245_10037265
551 Ga0105245_10116555
552 Ga0105245_10455281
553 Ga0105245_10635032
554 Ga0105245_10638416
555 Ga0114129_10897210
556 Ga0105243_10072875
557 Ga0105243_10193094
558 Ga0105243_10423301
559 Ga0105241_10008193
560 Ga0105241_10009793
561 Ga0105241_10322688
562 Ga0105242_10021412
563 Ga0105242_10030270
564 Ga0105242_10113407
565 Ga0105242_10158842
566 Ga0105242_10676760
567 Ga0105242_10787653
568 Ga0105248_10007529
569 Ga0105248_10011780
570 Ga0105248_10015831
571 Ga0105248_10063548
572 Ga0105248_10591261
573 Ga0105248_10681571
574 Ga0105248_11061703
575 Ga0105237_10005870
576 Ga0105237_10028781
577 Ga0105237_10275020
578 Ga0105237_10412093
579 Ga0105238_10002726
580 Ga0105238_10012072
581 Ga0105238_10022009
582 Ga0105238_10033662
583 Ga0105238_10094876
584 Ga0105238_10101961
585 Ga0105238_10517291
586 Ga0105238_10582626
587 Ga0105238_11214536
588 Ga0105249_10009071
589 Ga0105239_10009062
590 Ga0105239_10017304
591 Ga0105239_10025792
592 Ga0105239_10125408
593 Ga0105239_10183260
594 Ga0105246_10090577
595 Ga0105246_10264605
596 Ga0157373_10344363
597 Ga0157370_10003831
598 Ga0157370_10004478
599 Ga0157370_10206971
600 Ga0157369_10001536
601 Ga0157369_10006628
602 Ga0157369_10017312
603 Ga0157369_10502306
604 Ga0157374_10095550
605 Ga0157374_10119135
606 Ga0157374_10167832
607 Ga0157374_10226666
608 Ga0157378_10009773
609 Ga0157378_10318956
610 Ga0157378_11234924
611 Ga0163162_10004370
612 Ga0163162_10212760
613 Ga0163162_10383640
614 Ga0163162_10612552
615 Ga0163162_10761313
616 Ga0157372_10020713
617 Ga0157372_10342949
618 Ga0157372_10381920
619 Ga0157372_11007514
620 Ga0157375_11144429
621 Ga0163163_10013351
622 Ga0163163_10077413
623 Ga0163163_10088531
624 Ga0163163_10317490
625 Ga0163163_11025549
626 Ga0157379_10190171
627 Ga0157379_10311695
628 Ga0157376_10002587
629 Ga0157376_10008128
630 Ga0157376_10038479
631 Ga0157376_10290549
632 Ga0157376_11012244
633 Ga0157376_11347893
634 Ga0213874_10009831
635 Ga0213876_10061829
636 Ga0213875_10000069
637 Ga0213875_10074234
638 Ga0207680_10010806
639 Ga0207680_10326236
640 Ga0207699_10008634
641 Ga0207645_10037509
642 Ga0207705_10752840
643 Ga0207654_10017854
644 Ga0207654_10409258
645 Ga0207707_10000509
646 Ga0207707_10053635
647 Ga0207707_10527167
648 Ga0207695_10000470
649 Ga0207695_10001269
650 Ga0207695_10004183
651 Ga0207695_10071370
652 Ga0207695_10718075
653 Ga0207671_10013885
654 Ga0207671_10039256
655 Ga0207671_10449848
656 Ga0207660_10010364
657 Ga0207660_10311119
658 Ga0207657_10037582
659 Ga0207657_10053774
660 Ga0207652_10003746
661 Ga0207652_10747794
662 Ga0207652_11090234
663 Ga0207694_10010677
664 Ga0207694_10012773
665 Ga0207694_10036053
666 Ga0207694_10441831
667 Ga0207694_10493280
668 Ga0207694_10866959
669 Ga0207687_10002706
670 Ga0207687_10014679
671 Ga0207687_10118107
672 Ga0207687_10216623
673 Ga0207700_10215913
674 Ga0207700_10522741
675 Ga0207700_10679037
676 Ga0207644_10257256
677 Ga0207644_10306662
678 Ga0207706_10022998
679 Ga0207686_10007958
680 Ga0207686_10162856
681 Ga0207686_10335012
682 Ga0207709_10236064
683 Ga0207709_10259261
684 Ga0207709_10552320
685 Ga0207704_10252381
686 Ga0207704_10312505
687 Ga0207691_10424511
688 Ga0207711_10002291
689 Ga0207711_10004850
690 Ga0207711_10119137
691 Ga0207711_10357879
692 Ga0207711_10434033
693 Ga0207661_10000016
694 Ga0207661_10015741
695 Ga0207661_10016473
696 Ga0207661_10026736
697 Ga0207661_10172197
698 Ga0207661_10178024
699 Ga0207661_10417596
700 Ga0207661_10946432
701 Ga0207679_10069268
702 Ga0207667_10000145
703 Ga0207667_10001679
704 Ga0207667_10022438
705 Ga0207667_10621956
706 Ga0207651_10142331
707 Ga0207651_10320268
708 Ga0207712_10041532
709 Ga0207658_10023617
710 Ga0207658_10075083
711 Ga0207677_10010168
712 Ga0207703_10015212
713 Ga0207703_10064301
714 Ga0207703_10068870
715 Ga0207703_11121738
716 Ga0207639_10923574
717 Ga0207708_10281301
718 Ga0207702_10023773
719 Ga0207702_10033045
720 Ga0207702_10351478
721 Ga0207702_10994360
722 Ga0207641_10089233
723 Ga0207641_10446834
724 Ga0207641_10809353
725 Ga0207648_10050837
726 Ga0207648_11372994
727 Ga0207676_10607493
728 Ga0207674_10000264
729 Ga0207674_10001887
730 Ga0207674_10017376
731 Ga0207674_10217630
732 Ga0207674_10770797
733 Ga0268266_10014770
734 Ga0268266_10058823
735 Ga0268266_10885627
736 Ga0265323_10001662
737 Ga0265324_10017309
738 Ga0265332_10051557
739 Ga0265320_10034876
740 Ga0265320_10155414
741 Ga0265329_10044020
742 Ga0265340_10006277
743 Ga0265331_10001122
744 Ga0265331_10032484
745 Ga0265331_10269541
746 Ga0265316_10135340
747 Ga0265316_10144825
748 Ga0265316_10230226
749 Ga0265316_10567505
750 Ga0265313_10000996
751 Ga0265314_10002334
752 Ga0265314_10003167
753 Ga0373926_0106681
754 Ga0373929_0078905
755 Ga0373934_0026067
756 Ga0373944_0029608
757 Ga0373923_0177360
758 Ga0373953_0044552
759 Ga0373953_0076803
760 Ga0373954_0024489
761 Ga0373956_0076667
762 Ga0373956_0120837
763 Ga0373943_0158755
764 Ga0373955_0004116
765 Ga0373955_0008499
766 Ga0373955_0327932
767 Ga0373935_0160530
768 Ga0373927_0029449
769 Ga0373927_0081798
770 Ga0373933_0051874
771 Ga0373933_0199793
772 Ga0373947_0269136
773 Ga0373937_0021395
774 Ga0373937_0042315
775 Ga0373937_0062561
776 Ga0373937_0192593
777 Ga0373937_0199728
778 Ga0373925_0037953
779 Ga0373925_0582562
780 Ga0436364_0053660
781 Ga0436364_0278774
782 Ga0436364_0351880
783 Ga0436364_0997537
784 Ga0436365_0399293
785 Ga0436365_1088351
786 Ga0436365_1399089
787 Ga0436365_1581627
788 Ga0436363_0772611
789 Ga0453684_0886892
790 Ga0451576_0281119
791 Ga0495629_0442022
792 Ga0495651_0022041
793 Ga0495580_0001281
794 Ga0495580_0010097
795 Ga0495580_0015606
796 Ga0495580_0281796
797 Ga0495582_0087335
798 Ga0495639_0020171
799 Ga0495664_0168686
800 Ga0495594_0204675
801 Ga0495630_0098754
802 Ga0495630_0139833
803 Ga0495630_0644357
804 Ga0495630_0707790
805 Ga0495666_0075598
806 Ga0495652_0031380
807 Ga0495665_0060964
808 Ga0495665_0323094
809 Ga0495586_0011746
810 Ga0495587_0011234
811 Ga0495587_0052437
812 Ga0495645_0027471
813 Ga0495645_0384421
814 Ga0495667_0013052
815 Ga0495667_0147457
816 Ga0495667_0194766
817 Ga0495667_0388246
818 Ga0495635_0112758
819 Ga0495599_0137583
820 Ga0495623_0059040
821 Ga0495623_0076558
822 Ga0495623_0090595
823 Ga0495646_0077183
824 Ga0495658_0066034
825 Ga0495669_0200612
826 Ga0495613_0091943
827 Ga0495613_0474698
828 Ga0495613_0544804
829 Ga0495600_0157452
830 Ga0495604_0108981
831 Ga0495604_0137305
832 Ga0495604_0149223
833 Ga0495674_0017662
834 Ga0495674_0018046
835 Ga0495674_0856013
836 Ga0495680_0281006
837 Ga0495675_0011438
838 Ga0495684_0006797
839 Ga0495684_0022796
840 Ga0495684_0032708
841 Ga0495684_0277809
842 Ga0495684_0362533
843 Ga0495684_0549796
844 Ga0495593_0286155
845 Ga0495602_0006700
846 Ga0495602_0023142
847 Ga0496104_0017453
848 Ga0496104_0192000
849 Ga0496113_0665763
850 Ga0496119_0378254
851 Ga0501068_0262950
852 nmdc:mga06r32_102966_c1
853 nmdc:mga0rr50_488560_c1
854 Ga0495619_0202141

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00857

Isochorismatase

Isochorismatase family

3

212

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hb7-assembly4.cif.gz_H the crystal structure of an isochorismatase-like hydrolase from alkaliphilus metalliredigens to 2.3a 0.9211 1 192
3eef-assembly1.cif.gz_A crystal structure of n-carbamoylsarcosine amidase from thermoplasma acidophilum 0.9068 1 188
3hb7-assembly4.cif.gz_G the crystal structure of an isochorismatase-like hydrolase from alkaliphilus metalliredigens to 2.3a 0.905 1 191
3hb7-assembly2.cif.gz_C the crystal structure of an isochorismatase-like hydrolase from alkaliphilus metalliredigens to 2.3a 0.9021 1 191
1im5-assembly1.cif.gz_A crystal structure of pyrazinamidase of pyrococcus horikoshii in complex with zinc 0.9004 1 187
ID Description Score Start End Superfamily
3hb7H00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.9206 1 192 3.40.50.850
3eefB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.907 2 188 3.40.50.850
1im5A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.9004 1 187 3.40.50.850
3hb7H00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.8948 1 192 3.40.50.850
1im5A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.8907 1 187 3.40.50.850
ID Description Score Start End GO Terms
AF-A0A7S7NJU0-F1-model_v4 Cysteine hydrolase 0.9955 1 193 GO:0016810
AF-Q01XY4-F1-model_v4 nicotinamidase (EC 3.5.1.19) (Nicotinamide deamidase) 0.9913 1 191 GO:0016810
AF-A0A7S7NJU0-F1-model_v4 Cysteine hydrolase 0.9899 1 193 GO:0016810
AF-A0A7C3HW43-F1-model_v4 nicotinamidase (EC 3.5.1.19) (Nicotinamide deamidase) 0.985 1 193 GO:0016787
GO:0019363
GO:0046872
AF-A0A0F9G336-F1-model_v4 nicotinamidase (EC 3.5.1.19) (Nicotinamide deamidase) 0.9842 7 192 GO:0016787
GO:0019363
GO:0046872

Map