F441276

General Info

Members Datasets Scaffolds Average Seq Length
426 218 852 121

Family's Representative Sequence

Representative Sequence 3300046533|Ga0495640_0434202|Ga0495640_0434202_295_693
Length 132
Sequence MGADAPSRYSGGFMSVLDVVGSYYDAWMAGKGDFSAVPLAPDFSFTGPVASFDTAEGFREMAAQAGPMVTRFRIRRQLVDGDTVCSIIDWEMALPIAAMTSAEVLTVRDGQIVRGELIYDAQELRAAMAAGA

Samples

Sample ID Description Type Environment
1 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
33 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
34 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
37 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
38 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
44 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
59 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
60 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
88 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
90 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
91 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
92 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
93 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
94 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
95 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
96 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
97 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
98 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
99 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
100 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
101 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
102 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
103 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
104 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
105 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
106 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
107 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
108 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
109 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
110 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
111 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
112 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
113 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
114 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
115 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
116 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
117 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
118 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
119 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
120 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
121 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
122 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
123 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
124 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
125 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
126 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
127 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
128 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
129 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
130 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
131 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
132 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
133 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
134 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
135 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
136 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
137 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
138 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
139 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
140 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
141 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
142 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
143 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
144 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
145 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
146 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
147 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
148 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
149 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
150 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
151 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
152 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
153 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
154 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
155 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
156 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
157 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
158 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
159 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
160 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
161 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
162 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
163 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
164 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
165 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
166 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
167 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
168 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
169 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
170 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
171 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
172 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
173 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
174 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
175 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
176 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
177 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
178 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
179 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
180 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
181 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
195 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
196 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
197 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
198 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
199 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
200 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
201 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
202 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
203 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
204 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
206 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
207 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
208 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
209 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
210 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
211 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
212 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
213 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
214 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
215 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
216 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
217 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
218 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.3
Metatranscriptomes 0.7
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.98
Rhizosphere 91.55
Stem 0
Stem Tuber 0
Unclassified 11.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495640_0434202 3300046533 Unclassified 803
2 Ga0070683_100006250 3300005329 Bacteria 9991
3 Ga0070683_100207959 3300005329 Bacteria 1859
4 Ga0070683_100958065 3300005329 Unclassified 821
5 Ga0070680_100797490 3300005336 Bacteria 814
6 Ga0070682_100694653 3300005337 Bacteria 815
7 Ga0070682_100816286 3300005337 Bacteria 759
8 Ga0068868_100596657 3300005338 Bacteria 978
9 Ga0070660_101196690 3300005339 Bacteria 644
10 Ga0070661_101858851 3300005344 Unclassified 512
11 Ga0070671_101288270 3300005355 Bacteria 644
12 Ga0070659_102114875 3300005366 Bacteria 506
13 Ga0070709_10019709 3300005434 Bacteria 3903
14 Ga0070709_10038895 3300005434 Bacteria 2916
15 Ga0070714_100011749 3300005435 Bacteria 6957
16 Ga0070714_100037528 3300005435 Bacteria 4071
17 Ga0070714_100162068 3300005435 Bacteria 2024
18 Ga0070714_100216745 3300005435 Bacteria 1757
19 Ga0070714_100493364 3300005435 Bacteria 1167
20 Ga0070714_100579064 3300005435 Bacteria 1077
21 Ga0070714_101289433 3300005435 Bacteria 713
22 Ga0070713_100011171 3300005436 Bacteria 6528
23 Ga0070713_100043326 3300005436 Bacteria 3679
24 Ga0070713_100156694 3300005436 Bacteria 2030
25 Ga0070713_100479769 3300005436 Bacteria 1171
26 Ga0070713_100615351 3300005436 Bacteria 1033
27 Ga0070710_10006968 3300005437 Bacteria 5452
28 Ga0070710_10027416 3300005437 Bacteria 3037
29 Ga0070710_10548661 3300005437 Bacteria 798
30 Ga0070711_100007473 3300005439 Bacteria 6648
31 Ga0070711_100031166 3300005439 Bacteria 3537
32 Ga0070711_101358168 3300005439 Unclassified 618
33 Ga0070705_100489313 3300005440 Unclassified 931
34 Ga0070708_100033662 3300005445 Bacteria 4453
35 Ga0070708_100743749 3300005445 Unclassified 922
36 Ga0070708_100861408 3300005445 Bacteria 851
37 Ga0070681_10540515 3300005458 Bacteria 1079
38 Ga0070706_100004904 3300005467 Bacteria 12804
39 Ga0070706_100821578 3300005467 Bacteria 860
40 Ga0070707_100001595 3300005468 Bacteria 21973
41 Ga0070707_100137707 3300005468 Bacteria 2375
42 Ga0070707_100556941 3300005468 Bacteria 1109
43 Ga0070698_100004256 3300005471 Bacteria 15734
44 Ga0070698_100039197 3300005471 Bacteria 4877
45 Ga0070698_101715011 3300005471 Bacteria 581
46 Ga0070699_100017782 3300005518 Bacteria 6104
47 Ga0070699_100021315 3300005518 Bacteria 5589
48 Ga0070699_100453649 3300005518 Bacteria 1163
49 Ga0070699_100789059 3300005518 Unclassified 869
50 Ga0070679_100713582 3300005530 Bacteria 945
51 Ga0070684_100021044 3300005535 Bacteria 5420
52 Ga0070684_100093438 3300005535 Bacteria 2678
53 Ga0070684_100620009 3300005535 Unclassified 1006
54 Ga0070684_100760755 3300005535 Bacteria 905
55 Ga0070697_100663141 3300005536 Bacteria 919
56 Ga0070697_101172295 3300005536 Unclassified 684
57 Ga0068853_100796988 3300005539 Bacteria 905
58 Ga0070693_100923767 3300005547 Bacteria 655
59 Ga0070664_100822850 3300005564 Bacteria 869
60 Ga0068857_101381293 3300005577 Bacteria 685
61 Ga0068854_100960927 3300005578 Bacteria 754
62 Ga0068854_101714737 3300005578 Unclassified 575
63 Ga0068856_100013492 3300005614 Bacteria 7910
64 Ga0068856_100023310 3300005614 Bacteria 6018
65 Ga0068856_100062248 3300005614 Bacteria 3686
66 Ga0068856_100233348 3300005614 Bacteria 1855
67 Ga0068852_100803050 3300005616 Bacteria 955
68 Ga0081455_10102057 3300005937 Bacteria 2301
69 Ga0081455_10116904 3300005937 Bacteria 2108
70 Ga0081538_10000110 3300005981 Bacteria 81874
71 Ga0081538_10109558 3300005981 Bacteria 1360
72 Ga0081538_10257220 3300005981 Unclassified 661
73 Ga0081539_10372568 3300005985 Unclassified 597
74 Ga0070717_10031408 3300006028 Bacteria 4274
75 Ga0070717_10066936 3300006028 Bacteria 2988
76 Ga0070717_10431626 3300006028 Bacteria 1186
77 Ga0070717_10521086 3300006028 Bacteria 1075
78 Ga0070717_11084159 3300006028 Bacteria 729
79 Ga0070715_10000874 3300006163 Bacteria 8333
80 Ga0070716_100002553 3300006173 Bacteria 8421
81 Ga0070716_100249958 3300006173 Bacteria 1207
82 Ga0070712_100023253 3300006175 Bacteria 4092
83 Ga0097621_100294094 3300006237 Bacteria 1433
84 Ga0075428_100115506 3300006844 Bacteria 2924
85 Ga0075431_100057221 3300006847 Bacteria 4021
86 Ga0075434_100719493 3300006871 Bacteria 1015
87 Ga0075434_102305810 3300006871 Bacteria 541
88 Ga0075436_100298505 3300006914 Bacteria 1154
89 Ga0075435_100191562 3300007076 Bacteria 1731
90 Ga0105240_10131563 3300009093 Bacteria 3000
91 Ga0105240_12030730 3300009093 Unclassified 597
92 Ga0111539_10010544 3300009094 Bacteria 11636
93 Ga0111539_10813649 3300009094 Bacteria 1087
94 Ga0111539_11310156 3300009094 Unclassified 841
95 Ga0111539_13368806 3300009094 Unclassified 514
96 Ga0105245_10632086 3300009098 Unclassified 1099
97 Ga0105247_10277274 3300009101 Bacteria 1155
98 Ga0114129_10030395 3300009147 Bacteria 7642
99 Ga0114129_11487095 3300009147 Bacteria 833
100 Ga0105241_12331885 3300009174 Unclassified 533
101 Ga0105237_10179885 3300009545 Bacteria 2115
102 Ga0105237_10460840 3300009545 Bacteria 1277
103 Ga0105237_10486470 3300009545 Bacteria 1240
104 Ga0105238_10052329 3300009551 Bacteria 4104
105 Ga0105238_11127722 3300009551 Bacteria 807
106 Ga0105239_10571520 3300010375 Bacteria 1288
107 Ga0157373_10039453 3300013100 Bacteria 3381
108 Ga0157369_10214036 3300013105 Bacteria 2019
109 Ga0157369_10408341 3300013105 Bacteria 1408
110 Ga0157369_10432573 3300013105 Bacteria 1363
111 Ga0157369_10568750 3300013105 Bacteria 1171
112 Ga0157369_10741628 3300013105 Bacteria 1011
113 Ga0157374_10380586 3300013296 Bacteria 1406
114 Ga0157372_10100615 3300013307 Bacteria 3299
115 Ga0157372_11643703 3300013307 Bacteria 739
116 Ga0157379_10443402 3300014968 Bacteria 1197
117 Ga0157379_11010881 3300014968 Bacteria 793
118 Ga0157376_10995803 3300014969 Unclassified 860
119 Ga0197907_10293920 3300020069 Bacteria 2013
120 Ga0206356_10579779 3300020070 Unclassified 1670
121 Ga0206353_10842633 3300020082 Bacteria 601
122 Ga0207692_10000851 3300025898 Bacteria 10961
123 Ga0207692_10052089 3300025898 Bacteria 2078
124 Ga0207685_10000668 3300025905 Bacteria 6132
125 Ga0207699_10002704 3300025906 Bacteria 8384
126 Ga0207699_10016319 3300025906 Bacteria 3883
127 Ga0207699_10070369 3300025906 Bacteria 2136
128 Ga0207699_10308314 3300025906 Bacteria 1107
129 Ga0207684_10002146 3300025910 Bacteria 20219
130 Ga0207707_10241566 3300025912 Bacteria 1570
131 Ga0207707_10886377 3300025912 Bacteria 738
132 Ga0207695_10410388 3300025913 Unclassified 1239
133 Ga0207693_10008604 3300025915 Bacteria 8351
134 Ga0207693_10036062 3300025915 Bacteria 3897
135 Ga0207693_11353285 3300025915 Unclassified 530
136 Ga0207663_10000191 3300025916 Bacteria 27261
137 Ga0207663_10190990 3300025916 Bacteria 1470
138 Ga0207649_10281869 3300025920 Unclassified 1208
139 Ga0207652_10287833 3300025921 Bacteria 1482
140 Ga0207652_10301087 3300025921 Bacteria 1447
141 Ga0207652_10728246 3300025921 Bacteria 884
142 Ga0207646_10000451 3300025922 Bacteria 54749
143 Ga0207646_10103485 3300025922 Bacteria 2553
144 Ga0207646_10220012 3300025922 Bacteria 1715
145 Ga0207646_11004343 3300025922 Unclassified 737
146 Ga0207694_10613503 3300025924 Bacteria 915
147 Ga0207687_10265184 3300025927 Bacteria 1371
148 Ga0207700_10004465 3300025928 Bacteria 8253
149 Ga0207700_10097275 3300025928 Bacteria 2339
150 Ga0207700_10849700 3300025928 Bacteria 817
151 Ga0207700_10893708 3300025928 Bacteria 795
152 Ga0207700_10969852 3300025928 Unclassified 761
153 Ga0207700_11202494 3300025928 Bacteria 677
154 Ga0207664_10002149 3300025929 Bacteria 12962
155 Ga0207664_10046482 3300025929 Bacteria 3407
156 Ga0207664_10071633 3300025929 Bacteria 2792
157 Ga0207664_10102529 3300025929 Bacteria 2366
158 Ga0207664_10106434 3300025929 Bacteria 2325
159 Ga0207664_10109266 3300025929 Bacteria 2297
160 Ga0207664_10425977 3300025929 Bacteria 1183
161 Ga0207664_10608878 3300025929 Unclassified 981
162 Ga0207664_11122048 3300025929 Bacteria 703
163 Ga0207644_11169919 3300025931 Bacteria 646
164 Ga0207690_11752491 3300025932 Bacteria 519
165 Ga0207665_10005631 3300025939 Bacteria 8352
166 Ga0207665_10018135 3300025939 Bacteria 4625
167 Ga0207661_10023883 3300025944 Bacteria 4625
168 Ga0207661_10278069 3300025944 Bacteria 1495
169 Ga0207661_10522492 3300025944 Bacteria 1086
170 Ga0207667_10594034 3300025949 Bacteria 1117
171 Ga0207640_10733928 3300025981 Unclassified 850
172 Ga0207677_10496723 3300026023 Bacteria 1054
173 Ga0207639_10614937 3300026041 Bacteria 1003
174 Ga0207702_10032456 3300026078 Bacteria 4357
175 Ga0207702_10186967 3300026078 Bacteria 1911
176 Ga0207702_11447329 3300026078 Bacteria 681
177 Ga0207702_11673796 3300026078 Bacteria 629
178 Ga0207428_10781831 3300027907 Unclassified 679
179 Ga0268266_11229812 3300028379 Bacteria 724
180 Ga0307408_100281576 3300031548 Bacteria 1385
181 Ga0307405_10233170 3300031731 Bacteria 1358
182 Ga0307405_10296799 3300031731 Bacteria 1224
183 Ga0307410_10158711 3300031852 Bacteria 1692
184 Ga0307406_10082543 3300031901 Bacteria 2141
185 Ga0307406_10104276 3300031901 Bacteria 1938
186 Ga0307407_10044033 3300031903 Bacteria 2513
187 Ga0307407_10083884 3300031903 Unclassified 1934
188 Ga0307409_100076795 3300031995 Bacteria 2680
189 Ga0307409_100990851 3300031995 Bacteria 858
190 Ga0307409_101691279 3300031995 Unclassified 661
191 Ga0307416_100020010 3300032002 Bacteria 4763
192 Ga0307416_100131496 3300032002 Bacteria 2254
193 Ga0307416_101148310 3300032002 Bacteria 882
194 Ga0307416_101220287 3300032002 Bacteria 858
195 Ga0307411_10115657 3300032005 Bacteria 1930
196 Ga0307411_10259361 3300032005 Bacteria 1372
197 Ga0307415_100030570 3300032126 Bacteria 3459
198 Ga0307415_101011496 3300032126 Bacteria 773
199 Ga0373948_0187273 3300034817 Bacteria 534
200 Ga0373926_0160422 3300035083 Bacteria 858
201 Ga0373944_0187052 3300035089 Unclassified 745
202 Ga0373952_0123593 3300035092 Bacteria 704
203 Ga0373923_0001965 3300035111 Bacteria 6169
204 Ga0373939_0005226 3300035114 Bacteria 3087
205 Ga0373941_0144997 3300035115 Bacteria 866
206 Ga0373945_0391285 3300035116 Unclassified 608
207 Ga0373943_0044948 3300035170 Unclassified 2150
208 Ga0373955_0969044 3300035172 Bacteria 524
209 Ga0373942_0316675 3300035207 Unclassified 545
210 Ga0373924_0287543 3300035410 Bacteria 729
211 Ga0373931_0001243 3300035691 Bacteria 10883
212 Ga0373935_0121440 3300035692 Bacteria 1746
213 Ga0373935_0319601 3300035692 Unclassified 1101
214 Ga0373927_0188856 3300035695 Unclassified 1352
215 Ga0373927_0592700 3300035695 Bacteria 733
216 Ga0373947_0052265 3300035725 Bacteria 2461
217 Ga0373937_0114462 3300036401 Bacteria 2511
218 Ga0373937_0173397 3300036401 Bacteria 2024
219 Ga0373925_0016054 3300037068 Bacteria 5421
220 Ga0395899_0024761 3300037312 Bacteria 4536
221 Ga0395899_0051747 3300037312 Bacteria 3047
222 Ga0395899_0108453 3300037312 Bacteria 1998
223 Ga0395900_0013340 3300037418 Bacteria 8401
224 Ga0395900_0023624 3300037418 Bacteria 6290
225 Ga0395900_0042367 3300037418 Bacteria 4691
226 Ga0395900_0211260 3300037418 Bacteria 1959
227 Ga0395900_0313484 3300037418 Bacteria 1551
228 Ga0395900_0532789 3300037418 Bacteria 1121
229 Ga0395900_0695358 3300037418 Bacteria 951
230 Ga0395900_0909840 3300037418 Bacteria 803
231 Ga0395900_1161460 3300037418 Bacteria 688
232 Ga0395898_0009842 3300037466 Bacteria 10018
233 Ga0395898_0010212 3300037466 Bacteria 9831
234 Ga0395898_0637154 3300037466 Bacteria 1008
235 Ga0395898_0776080 3300037466 Bacteria 899
236 Ga0395898_1329829 3300037466 Unclassified 647
237 Ga0395898_1358178 3300037466 Bacteria 639
238 Ga0395905_0036248 3300037471 Bacteria 4632
239 Ga0395905_0124541 3300037471 Bacteria 2423
240 Ga0395905_0492501 3300037471 Unclassified 1126
241 Ga0436364_1222268 3300037853 Bacteria 1674
242 Ga0395901_0002091 3300038443 Bacteria 20489
243 Ga0395901_0006537 3300038443 Bacteria 11789
244 Ga0395901_0008509 3300038443 Bacteria 10369
245 Ga0395901_0021636 3300038443 Bacteria 6588
246 Ga0395901_0120357 3300038443 Bacteria 2759
247 Ga0395901_0875233 3300038443 Bacteria 882
248 Ga0439453_0038291 3300041408 Bacteria 933
249 Ga0451853_2726365 3300041512 Bacteria 559
250 Ga0466961_0963956 3300044693 Unclassified 507
251 Ga0466963_0094435 3300044694 Bacteria 2040
252 Ga0466971_0162647 3300044719 Bacteria 1045
253 Ga0466967_0017261 3300045976 Bacteria 5723
254 Ga0466967_0610111 3300045976 Bacteria 1077
255 Ga0466967_1135659 3300045976 Bacteria 778
256 Ga0495603_0273638 3300046455 Unclassified 971
257 Ga0495629_0008253 3300046459 Bacteria 7657
258 Ga0495641_0005062 3300046461 Bacteria 9063
259 Ga0495651_0024291 3300046462 Bacteria 4717
260 Ga0495651_0256714 3300046462 Bacteria 1191
261 Ga0495651_0476719 3300046462 Bacteria 802
262 Ga0495653_0006355 3300046463 Bacteria 9693
263 Ga0495653_0071164 3300046463 Bacteria 2601
264 Ga0495653_0330159 3300046463 Unclassified 986
265 Ga0495653_0654646 3300046463 Bacteria 641
266 Ga0495653_0813281 3300046463 Unclassified 561
267 Ga0495580_0021541 3300046472 Bacteria 4753
268 Ga0495582_0003576 3300046473 Bacteria 8764
269 Ga0495605_0116114 3300046474 Bacteria 1217
270 Ga0495639_0007529 3300046475 Bacteria 4676
271 Ga0495662_0067042 3300046476 Bacteria 1736
272 Ga0495664_0007492 3300046477 Bacteria 6064
273 Ga0495664_0449383 3300046477 Bacteria 772
274 Ga0495664_0482473 3300046477 Bacteria 741
275 Ga0495664_0515085 3300046477 Bacteria 714
276 Ga0495594_0381927 3300046499 Bacteria 802
277 Ga0495608_0194947 3300046511 Bacteria 1278
278 Ga0495618_0008110 3300046514 Bacteria 6360
279 Ga0495630_0031027 3300046517 Bacteria 3978
280 Ga0495630_0089829 3300046517 Unclassified 2321
281 Ga0495630_0518731 3300046517 Bacteria 914
282 Ga0495630_1528626 3300046517 Bacteria 500
283 Ga0495666_0564453 3300046526 Unclassified 507
284 Ga0495652_0029151 3300046529 Bacteria 4849
285 Ga0495652_0520910 3300046529 Bacteria 822
286 Ga0495652_0629339 3300046529 Bacteria 729
287 Ga0495665_0001814 3300046531 Bacteria 11513
288 Ga0495665_0360382 3300046531 Bacteria 740
289 Ga0495640_0011368 3300046533 Bacteria 6852
290 Ga0495640_0874006 3300046533 Unclassified 533
291 Ga0495645_0056748 3300046543 Bacteria 2843
292 Ga0495645_0113674 3300046543 Bacteria 1914
293 Ga0495667_0084604 3300046559 Bacteria 2059
294 Ga0495667_0131226 3300046559 Bacteria 1616
295 Ga0495667_0162928 3300046559 Bacteria 1434
296 Ga0495667_0165535 3300046559 Unclassified 1421
297 Ga0495634_0008109 3300046642 Bacteria 7830
298 Ga0495635_0004337 3300046663 Bacteria 9823
299 Ga0495635_0407975 3300046663 Bacteria 902
300 Ga0495588_0034387 3300046674 Bacteria 2565
301 Ga0495657_0355356 3300046675 Bacteria 867
302 Ga0495599_0098227 3300046678 Bacteria 1825
303 Ga0495599_0117294 3300046678 Bacteria 1656
304 Ga0495599_0570771 3300046678 Bacteria 661
305 Ga0495647_0036597 3300046681 Bacteria 1848
306 Ga0495658_0004947 3300046683 Bacteria 6536
307 Ga0495613_0005616 3300046689 Bacteria 9411
308 Ga0495624_0009737 3300046690 Bacteria 6649
309 Ga0495600_0014647 3300046809 Bacteria 4943
310 Ga0495600_0198000 3300046809 Bacteria 1291
311 Ga0495581_0002487 3300047315 Bacteria 10440
312 Ga0495604_0147461 3300047317 Bacteria 1676
313 Ga0495674_0014048 3300047319 Bacteria 7506
314 Ga0495674_0034241 3300047319 Bacteria 4594
315 Ga0495674_0164718 3300047319 Bacteria 1853
316 Ga0495674_0423130 3300047319 Bacteria 1073
317 Ga0495674_0555700 3300047319 Bacteria 913
318 Ga0495674_1120111 3300047319 Bacteria 598
319 Ga0495676_0012130 3300047321 Bacteria 7774
320 Ga0495676_0437369 3300047321 Bacteria 864
321 Ga0495676_0586902 3300047321 Unclassified 726
322 Ga0495680_0008871 3300047322 Bacteria 9095
323 Ga0495680_0009673 3300047322 Bacteria 8651
324 Ga0495680_0331031 3300047322 Bacteria 1064
325 Ga0495680_0864482 3300047322 Bacteria 587
326 Ga0495675_0426615 3300047444 Bacteria 770
327 Ga0495684_0010463 3300047471 Bacteria 7173
328 Ga0495684_0672883 3300047471 Bacteria 690
329 Ga0495684_0899025 3300047471 Bacteria 570
330 Ga0495593_0003608 3300047673 Bacteria 9251
331 Ga0496100_0041142 3300048903 Bacteria 2944
332 Ga0496100_0043924 3300048903 Bacteria 2860
333 Ga0496101_0018308 3300048904 Bacteria 4761
334 Ga0496101_0019998 3300048904 Bacteria 4578
335 Ga0496102_0095203 3300048905 Bacteria 2760
336 Ga0496102_0095977 3300048905 Bacteria 2749
337 Ga0496102_0285254 3300048905 Bacteria 1556
338 Ga0496103_0099787 3300048906 Bacteria 1837
339 Ga0496103_0381324 3300048906 Bacteria 906
340 Ga0496104_0013256 3300048907 Bacteria 7430
341 Ga0496104_0070862 3300048907 Bacteria 3315
342 Ga0496104_0292641 3300048907 Bacteria 1541
343 Ga0496104_0670591 3300048907 Bacteria 945
344 Ga0496105_0006677 3300048908 Bacteria 8881
345 Ga0496106_0005224 3300048909 Bacteria 9617
346 Ga0496106_0047368 3300048909 Bacteria 3235
347 Ga0496107_0021954 3300048910 Bacteria 4509
348 Ga0496107_0106492 3300048910 Bacteria 2059
349 Ga0496108_0004864 3300048911 Bacteria 10846
350 Ga0496109_0022490 3300048912 Bacteria 5586
351 Ga0496109_0121641 3300048912 Bacteria 2432
352 Ga0496109_0305034 3300048912 Bacteria 1502
353 Ga0496110_0081275 3300048913 Bacteria 2889
354 Ga0496110_0258895 3300048913 Unclassified 1584
355 Ga0496110_1450289 3300048913 Bacteria 596
356 Ga0496112_0006203 3300048915 Bacteria 10466
357 Ga0496112_0060852 3300048915 Bacteria 3721
358 Ga0496113_0028876 3300048916 Bacteria 3995
359 Ga0496113_0314135 3300048916 Bacteria 1256
360 Ga0496114_0008600 3300048917 Bacteria 8090
361 Ga0496114_0073303 3300048917 Bacteria 2881
362 Ga0496115_0000949 3300048918 Bacteria 21039
363 Ga0496115_0014387 3300048918 Bacteria 5989
364 Ga0496115_0836344 3300048918 Bacteria 714
365 Ga0501031_0304225 3300049568 Bacteria 1033
366 Ga0501032_0202044 3300049569 Bacteria 1297
367 Ga0501036_0297582 3300049572 Bacteria 1350
368 Ga0501036_0315147 3300049572 Bacteria 1307
369 Ga0501037_0394823 3300049573 Bacteria 949
370 Ga0501037_0522629 3300049573 Bacteria 803
371 Ga0501038_0178629 3300049574 Bacteria 1714
372 Ga0501038_0738128 3300049574 Bacteria 735
373 Ga0501039_0095461 3300049575 Bacteria 2318
374 Ga0501039_0155376 3300049575 Bacteria 1797
375 Ga0501040_0102709 3300049576 Bacteria 1995
376 Ga0501040_0240171 3300049576 Bacteria 1291
377 Ga0501040_0474794 3300049576 Bacteria 901
378 Ga0501041_0035132 3300049577 Bacteria 3036
379 Ga0501042_0036805 3300049578 Bacteria 3472
380 Ga0501042_0046288 3300049578 Bacteria 3101
381 Ga0501042_0370446 3300049578 Bacteria 1036
382 Ga0501043_0659893 3300049579 Unclassified 767
383 Ga0501043_1270107 3300049579 Bacteria 515
384 Ga0501046_0373680 3300049580 Bacteria 1033
385 Ga0501046_0723477 3300049580 Bacteria 700
386 Ga0501047_0172871 3300049581 Bacteria 2029
387 Ga0501048_0349596 3300049582 Bacteria 1054
388 Ga0501048_0434875 3300049582 Bacteria 939
389 Ga0501069_0406801 3300049585 Bacteria 806
390 Ga0501071_0012676 3300049587 Bacteria 5730
391 Ga0501071_0170640 3300049587 Bacteria 1628
392 Ga0501072_0029595 3300049588 Bacteria 4279
393 Ga0501072_0679801 3300049588 Bacteria 809
394 Ga0501074_0433111 3300049590 Bacteria 933
395 Ga0501075_0094158 3300049591 Bacteria 2274
396 Ga0501075_0155842 3300049591 Bacteria 1741
397 Ga0501075_0313674 3300049591 Bacteria 1195
398 Ga0501076_0027339 3300049592 Bacteria 4424
399 Ga0501076_0033429 3300049592 Bacteria 4015
400 Ga0501076_0207825 3300049592 Bacteria 1599
401 Ga0501077_0036154 3300049593 Bacteria 3146
402 Ga0501079_0077811 3300049741 Bacteria 2566
403 Ga0501079_0234191 3300049741 Bacteria 1435
404 Ga0501080_0205827 3300049742 Bacteria 1805
405 Ga0501081_0014603 3300049743 Bacteria 5182
406 Ga0501035_0351996 3300049822 Bacteria 1232
407 Ga0501035_1398439 3300049822 Unclassified 536
408 Ga0501045_0033409 3300049824 Bacteria 3730
409 Ga0501045_0153176 3300049824 Bacteria 1715
410 nmdc:mga05p37_1685189_c1 3300050507 Bacteria 619
411 nmdc:mga05p37_40190_c1 3300050507 Bacteria 5744
412 nmdc:mga0qj67_1270467_c1 3300050509 Unclassified 571
413 nmdc:mga06r32_293253_c1 3300050510 Bacteria 1613
414 nmdc:mga08y16_81926_c1 3300050511 Bacteria 3364
415 nmdc:mga0n895_236273_c1 3300050512 Bacteria 1855
416 nmdc:mga0a205_929528_c1 3300050515 Bacteria 716
417 Ga0495601_0007876 3300053077 Bacteria 6275
418 Ga0495612_0437015 3300053078 Unclassified 597
419 Ga0495619_0026464 3300053085 Bacteria 3732
420 Ga0495619_0727031 3300053085 Bacteria 674
421 Ga0501084_0172558 3300054114 Bacteria 1825
422 Ga0590075_004091 3300059424 Bacteria 3450
423 Ga0501082_0057479 3300060353 Bacteria 3352
424 Ga0501082_0537351 3300060353 Bacteria 1022
425 Ga0530510_0004297 3300061734 Bacteria 9858
426 Ga0530510_0334462 3300061734 Bacteria 1136
427 Ga0495640_0434202
428 Ga0070683_100006250
429 Ga0070683_100207959
430 Ga0070683_100958065
431 Ga0070680_100797490
432 Ga0070682_100694653
433 Ga0070682_100816286
434 Ga0068868_100596657
435 Ga0070660_101196690
436 Ga0070661_101858851
437 Ga0070671_101288270
438 Ga0070659_102114875
439 Ga0070709_10019709
440 Ga0070709_10038895
441 Ga0070714_100011749
442 Ga0070714_100037528
443 Ga0070714_100162068
444 Ga0070714_100216745
445 Ga0070714_100493364
446 Ga0070714_100579064
447 Ga0070714_101289433
448 Ga0070713_100011171
449 Ga0070713_100043326
450 Ga0070713_100156694
451 Ga0070713_100479769
452 Ga0070713_100615351
453 Ga0070710_10006968
454 Ga0070710_10027416
455 Ga0070710_10548661
456 Ga0070711_100007473
457 Ga0070711_100031166
458 Ga0070711_101358168
459 Ga0070705_100489313
460 Ga0070708_100033662
461 Ga0070708_100743749
462 Ga0070708_100861408
463 Ga0070681_10540515
464 Ga0070706_100004904
465 Ga0070706_100821578
466 Ga0070707_100001595
467 Ga0070707_100137707
468 Ga0070707_100556941
469 Ga0070698_100004256
470 Ga0070698_100039197
471 Ga0070698_101715011
472 Ga0070699_100017782
473 Ga0070699_100021315
474 Ga0070699_100453649
475 Ga0070699_100789059
476 Ga0070679_100713582
477 Ga0070684_100021044
478 Ga0070684_100093438
479 Ga0070684_100620009
480 Ga0070684_100760755
481 Ga0070697_100663141
482 Ga0070697_101172295
483 Ga0068853_100796988
484 Ga0070693_100923767
485 Ga0070664_100822850
486 Ga0068857_101381293
487 Ga0068854_100960927
488 Ga0068854_101714737
489 Ga0068856_100013492
490 Ga0068856_100023310
491 Ga0068856_100062248
492 Ga0068856_100233348
493 Ga0068852_100803050
494 Ga0081455_10102057
495 Ga0081455_10116904
496 Ga0081538_10000110
497 Ga0081538_10109558
498 Ga0081538_10257220
499 Ga0081539_10372568
500 Ga0070717_10031408
501 Ga0070717_10066936
502 Ga0070717_10431626
503 Ga0070717_10521086
504 Ga0070717_11084159
505 Ga0070715_10000874
506 Ga0070716_100002553
507 Ga0070716_100249958
508 Ga0070712_100023253
509 Ga0097621_100294094
510 Ga0075428_100115506
511 Ga0075431_100057221
512 Ga0075434_100719493
513 Ga0075434_102305810
514 Ga0075436_100298505
515 Ga0075435_100191562
516 Ga0105240_10131563
517 Ga0105240_12030730
518 Ga0111539_10010544
519 Ga0111539_10813649
520 Ga0111539_11310156
521 Ga0111539_13368806
522 Ga0105245_10632086
523 Ga0105247_10277274
524 Ga0114129_10030395
525 Ga0114129_11487095
526 Ga0105241_12331885
527 Ga0105237_10179885
528 Ga0105237_10460840
529 Ga0105237_10486470
530 Ga0105238_10052329
531 Ga0105238_11127722
532 Ga0105239_10571520
533 Ga0157373_10039453
534 Ga0157369_10214036
535 Ga0157369_10408341
536 Ga0157369_10432573
537 Ga0157369_10568750
538 Ga0157369_10741628
539 Ga0157374_10380586
540 Ga0157372_10100615
541 Ga0157372_11643703
542 Ga0157379_10443402
543 Ga0157379_11010881
544 Ga0157376_10995803
545 Ga0197907_10293920
546 Ga0206356_10579779
547 Ga0206353_10842633
548 Ga0207692_10000851
549 Ga0207692_10052089
550 Ga0207685_10000668
551 Ga0207699_10002704
552 Ga0207699_10016319
553 Ga0207699_10070369
554 Ga0207699_10308314
555 Ga0207684_10002146
556 Ga0207707_10241566
557 Ga0207707_10886377
558 Ga0207695_10410388
559 Ga0207693_10008604
560 Ga0207693_10036062
561 Ga0207693_11353285
562 Ga0207663_10000191
563 Ga0207663_10190990
564 Ga0207649_10281869
565 Ga0207652_10287833
566 Ga0207652_10301087
567 Ga0207652_10728246
568 Ga0207646_10000451
569 Ga0207646_10103485
570 Ga0207646_10220012
571 Ga0207646_11004343
572 Ga0207694_10613503
573 Ga0207687_10265184
574 Ga0207700_10004465
575 Ga0207700_10097275
576 Ga0207700_10849700
577 Ga0207700_10893708
578 Ga0207700_10969852
579 Ga0207700_11202494
580 Ga0207664_10002149
581 Ga0207664_10046482
582 Ga0207664_10071633
583 Ga0207664_10102529
584 Ga0207664_10106434
585 Ga0207664_10109266
586 Ga0207664_10425977
587 Ga0207664_10608878
588 Ga0207664_11122048
589 Ga0207644_11169919
590 Ga0207690_11752491
591 Ga0207665_10005631
592 Ga0207665_10018135
593 Ga0207661_10023883
594 Ga0207661_10278069
595 Ga0207661_10522492
596 Ga0207667_10594034
597 Ga0207640_10733928
598 Ga0207677_10496723
599 Ga0207639_10614937
600 Ga0207702_10032456
601 Ga0207702_10186967
602 Ga0207702_11447329
603 Ga0207702_11673796
604 Ga0207428_10781831
605 Ga0268266_11229812
606 Ga0307408_100281576
607 Ga0307405_10233170
608 Ga0307405_10296799
609 Ga0307410_10158711
610 Ga0307406_10082543
611 Ga0307406_10104276
612 Ga0307407_10044033
613 Ga0307407_10083884
614 Ga0307409_100076795
615 Ga0307409_100990851
616 Ga0307409_101691279
617 Ga0307416_100020010
618 Ga0307416_100131496
619 Ga0307416_101148310
620 Ga0307416_101220287
621 Ga0307411_10115657
622 Ga0307411_10259361
623 Ga0307415_100030570
624 Ga0307415_101011496
625 Ga0373948_0187273
626 Ga0373926_0160422
627 Ga0373944_0187052
628 Ga0373952_0123593
629 Ga0373923_0001965
630 Ga0373939_0005226
631 Ga0373941_0144997
632 Ga0373945_0391285
633 Ga0373943_0044948
634 Ga0373955_0969044
635 Ga0373942_0316675
636 Ga0373924_0287543
637 Ga0373931_0001243
638 Ga0373935_0121440
639 Ga0373935_0319601
640 Ga0373927_0188856
641 Ga0373927_0592700
642 Ga0373947_0052265
643 Ga0373937_0114462
644 Ga0373937_0173397
645 Ga0373925_0016054
646 Ga0395899_0024761
647 Ga0395899_0051747
648 Ga0395899_0108453
649 Ga0395900_0013340
650 Ga0395900_0023624
651 Ga0395900_0042367
652 Ga0395900_0211260
653 Ga0395900_0313484
654 Ga0395900_0532789
655 Ga0395900_0695358
656 Ga0395900_0909840
657 Ga0395900_1161460
658 Ga0395898_0009842
659 Ga0395898_0010212
660 Ga0395898_0637154
661 Ga0395898_0776080
662 Ga0395898_1329829
663 Ga0395898_1358178
664 Ga0395905_0036248
665 Ga0395905_0124541
666 Ga0395905_0492501
667 Ga0436364_1222268
668 Ga0395901_0002091
669 Ga0395901_0006537
670 Ga0395901_0008509
671 Ga0395901_0021636
672 Ga0395901_0120357
673 Ga0395901_0875233
674 Ga0439453_0038291
675 Ga0451853_2726365
676 Ga0466961_0963956
677 Ga0466963_0094435
678 Ga0466971_0162647
679 Ga0466967_0017261
680 Ga0466967_0610111
681 Ga0466967_1135659
682 Ga0495603_0273638
683 Ga0495629_0008253
684 Ga0495641_0005062
685 Ga0495651_0024291
686 Ga0495651_0256714
687 Ga0495651_0476719
688 Ga0495653_0006355
689 Ga0495653_0071164
690 Ga0495653_0330159
691 Ga0495653_0654646
692 Ga0495653_0813281
693 Ga0495580_0021541
694 Ga0495582_0003576
695 Ga0495605_0116114
696 Ga0495639_0007529
697 Ga0495662_0067042
698 Ga0495664_0007492
699 Ga0495664_0449383
700 Ga0495664_0482473
701 Ga0495664_0515085
702 Ga0495594_0381927
703 Ga0495608_0194947
704 Ga0495618_0008110
705 Ga0495630_0031027
706 Ga0495630_0089829
707 Ga0495630_0518731
708 Ga0495630_1528626
709 Ga0495666_0564453
710 Ga0495652_0029151
711 Ga0495652_0520910
712 Ga0495652_0629339
713 Ga0495665_0001814
714 Ga0495665_0360382
715 Ga0495640_0011368
716 Ga0495640_0874006
717 Ga0495645_0056748
718 Ga0495645_0113674
719 Ga0495667_0084604
720 Ga0495667_0131226
721 Ga0495667_0162928
722 Ga0495667_0165535
723 Ga0495634_0008109
724 Ga0495635_0004337
725 Ga0495635_0407975
726 Ga0495588_0034387
727 Ga0495657_0355356
728 Ga0495599_0098227
729 Ga0495599_0117294
730 Ga0495599_0570771
731 Ga0495647_0036597
732 Ga0495658_0004947
733 Ga0495613_0005616
734 Ga0495624_0009737
735 Ga0495600_0014647
736 Ga0495600_0198000
737 Ga0495581_0002487
738 Ga0495604_0147461
739 Ga0495674_0014048
740 Ga0495674_0034241
741 Ga0495674_0164718
742 Ga0495674_0423130
743 Ga0495674_0555700
744 Ga0495674_1120111
745 Ga0495676_0012130
746 Ga0495676_0437369
747 Ga0495676_0586902
748 Ga0495680_0008871
749 Ga0495680_0009673
750 Ga0495680_0331031
751 Ga0495680_0864482
752 Ga0495675_0426615
753 Ga0495684_0010463
754 Ga0495684_0672883
755 Ga0495684_0899025
756 Ga0495593_0003608
757 Ga0496100_0041142
758 Ga0496100_0043924
759 Ga0496101_0018308
760 Ga0496101_0019998
761 Ga0496102_0095203
762 Ga0496102_0095977
763 Ga0496102_0285254
764 Ga0496103_0099787
765 Ga0496103_0381324
766 Ga0496104_0013256
767 Ga0496104_0070862
768 Ga0496104_0292641
769 Ga0496104_0670591
770 Ga0496105_0006677
771 Ga0496106_0005224
772 Ga0496106_0047368
773 Ga0496107_0021954
774 Ga0496107_0106492
775 Ga0496108_0004864
776 Ga0496109_0022490
777 Ga0496109_0121641
778 Ga0496109_0305034
779 Ga0496110_0081275
780 Ga0496110_0258895
781 Ga0496110_1450289
782 Ga0496112_0006203
783 Ga0496112_0060852
784 Ga0496113_0028876
785 Ga0496113_0314135
786 Ga0496114_0008600
787 Ga0496114_0073303
788 Ga0496115_0000949
789 Ga0496115_0014387
790 Ga0496115_0836344
791 Ga0501031_0304225
792 Ga0501032_0202044
793 Ga0501036_0297582
794 Ga0501036_0315147
795 Ga0501037_0394823
796 Ga0501037_0522629
797 Ga0501038_0178629
798 Ga0501038_0738128
799 Ga0501039_0095461
800 Ga0501039_0155376
801 Ga0501040_0102709
802 Ga0501040_0240171
803 Ga0501040_0474794
804 Ga0501041_0035132
805 Ga0501042_0036805
806 Ga0501042_0046288
807 Ga0501042_0370446
808 Ga0501043_0659893
809 Ga0501043_1270107
810 Ga0501046_0373680
811 Ga0501046_0723477
812 Ga0501047_0172871
813 Ga0501048_0349596
814 Ga0501048_0434875
815 Ga0501069_0406801
816 Ga0501071_0012676
817 Ga0501071_0170640
818 Ga0501072_0029595
819 Ga0501072_0679801
820 Ga0501074_0433111
821 Ga0501075_0094158
822 Ga0501075_0155842
823 Ga0501075_0313674
824 Ga0501076_0027339
825 Ga0501076_0033429
826 Ga0501076_0207825
827 Ga0501077_0036154
828 Ga0501079_0077811
829 Ga0501079_0234191
830 Ga0501080_0205827
831 Ga0501081_0014603
832 Ga0501035_0351996
833 Ga0501035_1398439
834 Ga0501045_0033409
835 Ga0501045_0153176
836 nmdc:mga05p37_1685189_c1
837 nmdc:mga05p37_40190_c1
838 nmdc:mga0qj67_1270467_c1
839 nmdc:mga06r32_293253_c1
840 nmdc:mga08y16_81926_c1
841 nmdc:mga0n895_236273_c1
842 nmdc:mga0a205_929528_c1
843 Ga0495601_0007876
844 Ga0495612_0437015
845 Ga0495619_0026464
846 Ga0495619_0727031
847 Ga0501084_0172558
848 Ga0590075_004091
849 Ga0501082_0057479
850 Ga0501082_0537351
851 Ga0530510_0004297
852 Ga0530510_0334462

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12680

SnoaL_2

SnoaL-like domain

20

115

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3f40-assembly1.cif.gz_A-2 crystal structure of ntf2-like protein of unknown function (yp_677363.1) from cytophaga hutchinsonii atcc 33406 at 1.27 a resolution 0.8994 1 113
5evh-assembly1.cif.gz_A-2 crystal structure of known function protein from kribbella flavida dsm 17836 0.8681 5 118
4u13-assembly1.cif.gz_B crystal structure of putative polyketide cyclase (protein sma1630) from sinorhizobium meliloti at 2.3 a resolution 0.8645 5 106
3fh1-assembly1.cif.gz_A-2 crystal structure of a ntf2-like protein of unknown function (mll8193) from mesorhizobium loti at 1.60 a resolution 0.8611 3 108
3f40-assembly1.cif.gz_A-2 crystal structure of ntf2-like protein of unknown function (yp_677363.1) from cytophaga hutchinsonii atcc 33406 at 1.27 a resolution 0.8543 1 113
ID Description Score Start End Superfamily
3f40A00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8653 2 113 3.10.450.50
4u13B00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8488 7 106 3.10.450.50
2k54A00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8458 3 108 3.10.450.50
5evhA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8428 5 118 3.10.450.50
4lmiA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8418 3 108 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A3D4WWH5-F1-model_v4 SnoaL-like domain-containing protein 0.9877 1 118
AF-A0A438ME73-F1-model_v4 Uncharacterized protein (TIGR03086 family) 0.9838 1 118 GO:0046872
AF-A0A1I5GPP0-F1-model_v4 SnoaL-like domain-containing protein 0.9798 1 82
AF-A0A429HTF0-F1-model_v4 deleted 0.9688 1 118
AF-A0A1H4MYY1-F1-model_v4 SnoaL-like domain-containing protein 0.9685 1 118

Map