F441263

General Info

Members Datasets Scaffolds Average Seq Length
426 243 852 264

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0068849|Ga0466967_0068849_758_1624
Length 271
Sequence VSAVSAGRRRRIRPRRVARHAAWNVVGVLVGVVFLFPVYWMITTALKPGVEIFSLTPHWWPHHPTLANFRDAMHRPFFWDDVKNSVVITGAKYRFYGRRALIIMXXXXQMVPLVALVIPIYLLLAKFGYVNTLPGVIATYLMFVLPFCVWTLRGFVLGVPKELEEAAQVDGATRFGAFVRILLPLVAPGLVATSVFAFIQAWNEYVMAYVLLQDQKKQTLTVWLANFTTQKGTEWGPLMAGATLTALPVVVFFVLVQRRIAAGITAGAVRG

Samples

Sample ID Description Type Environment
1 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
50 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
53 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
54 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
130 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
134 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
135 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
136 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
137 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
138 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
139 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
140 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
141 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
142 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
143 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
144 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
145 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
146 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
147 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
148 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
149 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
150 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
151 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
152 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
153 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
154 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
155 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
156 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
157 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
158 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
159 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
160 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
161 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
162 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
163 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
164 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
165 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
166 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
167 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
168 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
169 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
170 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
171 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
172 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
173 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
174 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
175 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
176 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
177 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
178 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
179 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
180 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
181 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
182 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
183 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
184 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
185 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
186 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
187 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
188 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
189 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
190 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
191 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
192 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
193 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
194 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
195 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
196 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
197 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
198 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
199 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
200 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
213 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
214 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
215 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
216 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
217 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
218 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
219 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
220 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
221 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
222 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
223 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
224 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
225 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
228 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
229 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
230 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
231 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
232 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
233 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
234 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
235 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
236 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
237 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
238 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
239 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
240 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
241 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
242 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
243 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.46
Rhizosphere 95.31
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466967_0068849 3300045976 Bacteria 3162
2 JGI25407J50210_10007830 3300003373 Bacteria 2685
3 Ga0070690_100016817 3300005330 Bacteria 4391
4 Ga0068869_100295305 3300005334 Bacteria 1307
5 Ga0070666_10045509 3300005335 Bacteria 2942
6 Ga0070682_100002923 3300005337 Bacteria 9475
7 Ga0070682_100203534 3300005337 Bacteria 1398
8 Ga0068868_100008674 3300005338 Bacteria 7280
9 Ga0068868_100097538 3300005338 Bacteria 2375
10 Ga0070689_100003436 3300005340 Bacteria 10539
11 Ga0070687_100021659 3300005343 Bacteria 3026
12 Ga0070692_10004041 3300005345 Bacteria 6064
13 Ga0070668_100013747 3300005347 Bacteria 6046
14 Ga0070668_100120486 3300005347 Bacteria 2097
15 Ga0070675_100258245 3300005354 Bacteria 1526
16 Ga0070688_100015012 3300005365 Bacteria 4397
17 Ga0070714_100079158 3300005435 Bacteria 2857
18 Ga0070714_100566156 3300005435 Bacteria 1089
19 Ga0070713_100498550 3300005436 Bacteria 1149
20 Ga0070710_10006511 3300005437 Bacteria 5614
21 Ga0070701_10001025 3300005438 Bacteria 10175
22 Ga0070711_100009875 3300005439 Bacteria 5887
23 Ga0070711_100012596 3300005439 Bacteria 5288
24 Ga0070705_100005715 3300005440 Bacteria 6074
25 Ga0070705_100054453 3300005440 Bacteria 2347
26 Ga0070700_100005425 3300005441 Bacteria 6752
27 Ga0070700_100467837 3300005441 Bacteria 963
28 Ga0070708_100006601 3300005445 Bacteria 9236
29 Ga0070708_100027358 3300005445 Bacteria 4892
30 Ga0070708_100083003 3300005445 Bacteria 2903
31 Ga0070663_100027525 3300005455 Bacteria 3862
32 Ga0070678_100011596 3300005456 Bacteria 5444
33 Ga0070662_100031836 3300005457 Bacteria 3704
34 Ga0070662_100129405 3300005457 Bacteria 1944
35 Ga0070681_10061188 3300005458 Bacteria 3742
36 Ga0068867_100004039 3300005459 Bacteria 10323
37 Ga0068867_100162421 3300005459 Bacteria 1762
38 Ga0070685_10049570 3300005466 Bacteria 2422
39 Ga0070706_100008083 3300005467 Bacteria 9810
40 Ga0070706_100352844 3300005467 Bacteria 1371
41 Ga0070707_100143753 3300005468 Bacteria 2321
42 Ga0070698_100003544 3300005471 Bacteria 17162
43 Ga0070698_100035504 3300005471 Bacteria 5155
44 Ga0070699_100013925 3300005518 Bacteria 6917
45 Ga0070699_100042606 3300005518 Bacteria 3929
46 Ga0070699_100051712 3300005518 Bacteria 3557
47 Ga0070699_100301427 3300005518 Bacteria 1438
48 Ga0070697_100032687 3300005536 Bacteria 4188
49 Ga0070672_100092591 3300005543 Bacteria 2441
50 Ga0070686_100030100 3300005544 Bacteria 3308
51 Ga0070695_100033716 3300005545 Bacteria 3204
52 Ga0070695_100096743 3300005545 Bacteria 1981
53 Ga0070696_100003163 3300005546 Bacteria 10963
54 Ga0070696_100298291 3300005546 Bacteria 1233
55 Ga0070693_100005399 3300005547 Bacteria 6132
56 Ga0070665_100076452 3300005548 Bacteria 3355
57 Ga0070704_100013553 3300005549 Bacteria 5062
58 Ga0070704_100097613 3300005549 Bacteria 2205
59 Ga0070704_100672484 3300005549 Bacteria 916
60 Ga0068855_100829528 3300005563 Bacteria 981
61 Ga0068854_100354448 3300005578 Bacteria 1202
62 Ga0068856_100014205 3300005614 Bacteria 7697
63 Ga0070702_100016026 3300005615 Bacteria 3839
64 Ga0070702_100139626 3300005615 Bacteria 1542
65 Ga0068852_100009238 3300005616 Bacteria 7305
66 Ga0068866_10001538 3300005718 Bacteria 9797
67 Ga0068861_100013273 3300005719 Bacteria 5764
68 Ga0068861_100315331 3300005719 Bacteria 1360
69 Ga0068862_100341105 3300005844 Bacteria 1388
70 Ga0081455_10002352 3300005937 Bacteria 22577
71 Ga0081455_10015042 3300005937 Bacteria 7536
72 Ga0081455_10020665 3300005937 Bacteria 6191
73 Ga0081455_10039025 3300005937 Bacteria 4201
74 Ga0081538_10000317 3300005981 Bacteria 55110
75 Ga0081538_10004529 3300005981 Bacteria 12798
76 Ga0081538_10038524 3300005981 Bacteria 3082
77 Ga0081540_1000810 3300005983 Bacteria 28677
78 Ga0081540_1005151 3300005983 Bacteria 9786
79 Ga0081539_10004182 3300005985 Bacteria 16353
80 Ga0070717_10051160 3300006028 Bacteria 3399
81 Ga0075432_10011824 3300006058 Bacteria 2967
82 Ga0075432_10025953 3300006058 Bacteria 2011
83 Ga0070716_100016041 3300006173 Bacteria 3861
84 Ga0070712_100006792 3300006175 Bacteria 7120
85 Ga0070712_100008572 3300006175 Bacteria 6434
86 Ga0070712_100022479 3300006175 Bacteria 4155
87 Ga0097621_100017778 3300006237 Bacteria 5411
88 Ga0068871_100005748 3300006358 Bacteria 8705
89 Ga0075428_100019610 3300006844 Bacteria 7482
90 Ga0075430_100082947 3300006846 Bacteria 2686
91 Ga0075431_100058491 3300006847 Bacteria 3979
92 Ga0075431_100125513 3300006847 Bacteria 2648
93 Ga0075433_10124234 3300006852 Bacteria 2292
94 Ga0075433_10269561 3300006852 Bacteria 1509
95 Ga0075434_100034823 3300006871 Bacteria 4975
96 Ga0075434_100049292 3300006871 Bacteria 4181
97 Ga0075434_100060367 3300006871 Bacteria 3771
98 Ga0075434_100061838 3300006871 Bacteria 3726
99 Ga0075434_100282904 3300006871 Bacteria 1678
100 Ga0068865_100007746 3300006881 Bacteria 6621
101 Ga0075436_100026738 3300006914 Bacteria 3973
102 Ga0075436_100073325 3300006914 Bacteria 2369
103 Ga0075436_100129355 3300006914 Bacteria 1770
104 Ga0075436_100222251 3300006914 Bacteria 1340
105 Ga0075435_100028378 3300007076 Bacteria 4389
106 Ga0075435_100090913 3300007076 Bacteria 2518
107 Ga0105244_10163192 3300009036 Bacteria 1063
108 Ga0105240_10299016 3300009093 Bacteria 1842
109 Ga0105240_10567681 3300009093 Bacteria 1253
110 Ga0111539_10011828 3300009094 Bacteria 10939
111 Ga0111539_10020673 3300009094 Bacteria 8108
112 Ga0105245_10026609 3300009098 Bacteria 5093
113 Ga0105245_10040412 3300009098 Bacteria 4155
114 Ga0105245_10449063 3300009098 Bacteria 1297
115 Ga0105247_10090216 3300009101 Bacteria 1944
116 Ga0114129_10012703 3300009147 Bacteria 11987
117 Ga0114129_10089665 3300009147 Bacteria 4263
118 Ga0114129_10160264 3300009147 Bacteria 3074
119 Ga0114129_10306783 3300009147 Bacteria 2114
120 Ga0114129_10421513 3300009147 Bacteria 1755
121 Ga0105243_10009550 3300009148 Bacteria 7385
122 Ga0105243_10046984 3300009148 Bacteria 3397
123 Ga0105241_10009560 3300009174 Bacteria 7127
124 Ga0105242_10003117 3300009176 Bacteria 12934
125 Ga0105242_10138892 3300009176 Bacteria 2106
126 Ga0105242_10295199 3300009176 Bacteria 1477
127 Ga0105248_10018884 3300009177 Bacteria 7623
128 Ga0105248_10495346 3300009177 Bacteria 1378
129 Ga0105237_10056783 3300009545 Bacteria 3917
130 Ga0105238_10039088 3300009551 Bacteria 4813
131 Ga0105249_10004585 3300009553 Bacteria 11943
132 Ga0105249_10051204 3300009553 Bacteria 3766
133 Ga0105249_10270175 3300009553 Bacteria 1694
134 Ga0105239_10014371 3300010375 Bacteria 8785
135 Ga0105239_10055318 3300010375 Bacteria 4352
136 Ga0105239_10595511 3300010375 Bacteria 1261
137 Ga0105246_10100729 3300011119 Bacteria 2102
138 Ga0157374_10002122 3300013296 Bacteria 16690
139 Ga0163162_10012727 3300013306 Bacteria 8217
140 Ga0163162_10027048 3300013306 Bacteria 5672
141 Ga0163162_10341303 3300013306 Bacteria 1630
142 Ga0157372_10177028 3300013307 Bacteria 2469
143 Ga0157375_10068758 3300013308 Bacteria 3545
144 Ga0157375_10673406 3300013308 Bacteria 1190
145 Ga0157380_10607939 3300014326 Bacteria 1083
146 Ga0157377_10056541 3300014745 Bacteria 2228
147 Ga0157377_10123476 3300014745 Bacteria 1572
148 Ga0157376_10008815 3300014969 Bacteria 7298
149 Ga0163161_10136062 3300017792 Bacteria 1858
150 Ga0207653_10036540 3300025885 Bacteria 1600
151 Ga0207642_10001340 3300025899 Bacteria 7625
152 Ga0207710_10099320 3300025900 Bacteria 1371
153 Ga0207688_10014600 3300025901 Bacteria 4267
154 Ga0207647_10065203 3300025904 Bacteria 2211
155 Ga0207699_10158495 3300025906 Bacteria 1504
156 Ga0207684_10004072 3300025910 Bacteria 13947
157 Ga0207684_10073158 3300025910 Bacteria 2911
158 Ga0207654_10025918 3300025911 Bacteria 3170
159 Ga0207695_10192535 3300025913 Bacteria 1956
160 Ga0207693_10001615 3300025915 Bacteria 19912
161 Ga0207693_10019713 3300025915 Bacteria 5363
162 Ga0207693_10019747 3300025915 Bacteria 5357
163 Ga0207693_10029554 3300025915 Bacteria 4327
164 Ga0207693_10132034 3300025915 Bacteria 1963
165 Ga0207663_10044060 3300025916 Bacteria 2736
166 Ga0207663_10053906 3300025916 Bacteria 2515
167 Ga0207663_10072396 3300025916 Bacteria 2227
168 Ga0207663_10096979 3300025916 Bacteria 1971
169 Ga0207660_10022469 3300025917 Bacteria 4250
170 Ga0207660_10286242 3300025917 Bacteria 1309
171 Ga0207662_10035473 3300025918 Bacteria 2913
172 Ga0207662_10211698 3300025918 Bacteria 1259
173 Ga0207657_10048015 3300025919 Bacteria 3729
174 Ga0207646_10003077 3300025922 Bacteria 19179
175 Ga0207659_10221732 3300025926 Bacteria 1521
176 Ga0207687_10030553 3300025927 Bacteria 3633
177 Ga0207687_10106410 3300025927 Bacteria 2074
178 Ga0207664_10053377 3300025929 Bacteria 3199
179 Ga0207644_10010013 3300025931 Bacteria 6241
180 Ga0207690_10176924 3300025932 Bacteria 1603
181 Ga0207706_10004352 3300025933 Bacteria 13301
182 Ga0207706_10015686 3300025933 Bacteria 6849
183 Ga0207686_10000935 3300025934 Bacteria 17459
184 Ga0207686_10147523 3300025934 Bacteria 1634
185 Ga0207709_10000846 3300025935 Bacteria 23440
186 Ga0207669_10414270 3300025937 Bacteria 1059
187 Ga0207704_10006244 3300025938 Bacteria 5541
188 Ga0207665_10031797 3300025939 Bacteria 3493
189 Ga0207691_10009101 3300025940 Bacteria 9530
190 Ga0207711_10010153 3300025941 Bacteria 7818
191 Ga0207667_10144963 3300025949 Bacteria 2445
192 Ga0207667_10239191 3300025949 Bacteria 1858
193 Ga0207712_10004666 3300025961 Bacteria 8660
194 Ga0207712_10267049 3300025961 Bacteria 1390
195 Ga0207668_10131272 3300025972 Bacteria 1913
196 Ga0207640_10151315 3300025981 Bacteria 1705
197 Ga0207640_10174396 3300025981 Bacteria 1606
198 Ga0207639_10021310 3300026041 Bacteria 4653
199 Ga0207678_10044360 3300026067 Bacteria 3847
200 Ga0207708_10004143 3300026075 Bacteria 10666
201 Ga0207702_10015563 3300026078 Bacteria 6295
202 Ga0207648_10002386 3300026089 Bacteria 20220
203 Ga0207648_10163590 3300026089 Bacteria 1966
204 Ga0207675_100001149 3300026118 Bacteria 26254
205 Ga0207675_100124231 3300026118 Bacteria 2444
206 Ga0207675_100329188 3300026118 Bacteria 1493
207 Ga0207683_10000699 3300026121 Bacteria 30634
208 Ga0207683_10010861 3300026121 Bacteria 7766
209 Ga0207698_10054233 3300026142 Bacteria 3083
210 Ga0207428_10022533 3300027907 Bacteria 5313
211 Ga0207428_10032576 3300027907 Bacteria 4285
212 Ga0207428_10034611 3300027907 Bacteria 4136
213 Ga0268266_10006426 3300028379 Bacteria 10766
214 Ga0268265_10251474 3300028380 Bacteria 1566
215 Ga0268265_10357442 3300028380 Bacteria 1336
216 Ga0268264_10093789 3300028381 Bacteria 2594
217 Ga0307406_10019292 3300031901 Bacteria 4000
218 Ga0307406_10325085 3300031901 Bacteria 1191
219 Ga0307409_100124779 3300031995 Bacteria 2188
220 Ga0307416_100186758 3300032002 Bacteria 1949
221 Ga0373928_0011241 3300035084 Bacteria 1770
222 Ga0373951_0004676 3300035091 Bacteria 3240
223 Ga0373955_0040921 3300035172 Bacteria 2482
224 Ga0373931_0004018 3300035691 Bacteria 6663
225 Ga0373925_0120327 3300037068 Bacteria 2038
226 Ga0395899_0002773 3300037312 Bacteria 14135
227 Ga0395899_0004852 3300037312 Bacteria 10477
228 Ga0395899_0007674 3300037312 Bacteria 8319
229 Ga0395899_0013359 3300037312 Bacteria 6281
230 Ga0395899_0027824 3300037312 Bacteria 4259
231 Ga0395899_0048544 3300037312 Bacteria 3159
232 Ga0395899_0249205 3300037312 Bacteria 1219
233 Ga0395900_0006819 3300037418 Bacteria 11849
234 Ga0395900_0009795 3300037418 Bacteria 9819
235 Ga0395900_0024880 3300037418 Bacteria 6127
236 Ga0395900_0028288 3300037418 Bacteria 5742
237 Ga0395900_0039492 3300037418 Bacteria 4863
238 Ga0395900_0045668 3300037418 Bacteria 4512
239 Ga0395900_0053482 3300037418 Bacteria 4156
240 Ga0395900_0056132 3300037418 Bacteria 4054
241 Ga0395900_0061571 3300037418 Bacteria 3858
242 Ga0395900_0063224 3300037418 Bacteria 3804
243 Ga0395900_0126932 3300037418 Bacteria 2616
244 Ga0395900_0138664 3300037418 Bacteria 2491
245 Ga0395900_0157443 3300037418 Bacteria 2320
246 Ga0395900_0204697 3300037418 Bacteria 1995
247 Ga0395900_0225421 3300037418 Bacteria 1887
248 Ga0395898_0014303 3300037466 Bacteria 8155
249 Ga0395898_0029434 3300037466 Bacteria 5501
250 Ga0395898_0034958 3300037466 Bacteria 5001
251 Ga0395898_0036343 3300037466 Bacteria 4890
252 Ga0395898_0059463 3300037466 Bacteria 3717
253 Ga0395898_0062203 3300037466 Bacteria 3625
254 Ga0395898_0078496 3300037466 Bacteria 3185
255 Ga0395898_0081867 3300037466 Bacteria 3112
256 Ga0395898_0097302 3300037466 Bacteria 2827
257 Ga0395898_0143405 3300037466 Bacteria 2286
258 Ga0395898_0213601 3300037466 Bacteria 1840
259 Ga0395898_0247205 3300037466 Bacteria 1701
260 Ga0395905_0001294 3300037471 Bacteria 30743
261 Ga0395905_0003235 3300037471 Bacteria 17515
262 Ga0395905_0005622 3300037471 Bacteria 12758
263 Ga0395905_0026122 3300037471 Bacteria 5507
264 Ga0395905_0047230 3300037471 Bacteria 4036
265 Ga0395905_0049337 3300037471 Bacteria 3944
266 Ga0395905_0061533 3300037471 Bacteria 3512
267 Ga0395905_0075339 3300037471 Bacteria 3163
268 Ga0395905_0119295 3300037471 Bacteria 2479
269 Ga0395905_0128700 3300037471 Bacteria 2381
270 Ga0395905_0283641 3300037471 Bacteria 1542
271 Ga0395901_0002205 3300038443 Bacteria 19868
272 Ga0395901_0002459 3300038443 Bacteria 18785
273 Ga0395901_0008470 3300038443 Bacteria 10393
274 Ga0395901_0009747 3300038443 Bacteria 9739
275 Ga0395901_0010874 3300038443 Bacteria 9222
276 Ga0395901_0019699 3300038443 Bacteria 6897
277 Ga0395901_0028318 3300038443 Bacteria 5761
278 Ga0395901_0029701 3300038443 Bacteria 5629
279 Ga0395901_0033048 3300038443 Bacteria 5338
280 Ga0395901_0035034 3300038443 Bacteria 5187
281 Ga0395901_0044963 3300038443 Bacteria 4581
282 Ga0395901_0048743 3300038443 Bacteria 4399
283 Ga0395901_0100466 3300038443 Bacteria 3034
284 Ga0395901_0122996 3300038443 Bacteria 2727
285 Ga0395901_0219743 3300038443 Bacteria 1986
286 Ga0395901_0250002 3300038443 Bacteria 1847
287 Ga0395901_0503423 3300038443 Bacteria 1233
288 Ga0439439_0002595 3300041406 Bacteria 3864
289 Ga0439461_0005719 3300041410 Bacteria 2135
290 Ga0451855_0378690 3300041511 Bacteria 1793
291 Ga0439433_0005134 3300041999 Bacteria 2813
292 Ga0439448_0050580 3300042005 Bacteria 1360
293 Ga0439449_0055814 3300042007 Bacteria 1459
294 Ga0439446_0022384 3300042156 Bacteria 1791
295 Ga0439434_0016737 3300042435 Bacteria 2191
296 Ga0466963_0007272 3300044694 Bacteria 6602
297 Ga0466963_0093873 3300044694 Bacteria 2046
298 Ga0466964_0003071 3300044706 Bacteria 6065
299 Ga0466964_0036182 3300044706 Bacteria 1978
300 Ga0466971_0033278 3300044719 Bacteria 2310
301 Ga0466960_0047019 3300044901 Bacteria 2068
302 Ga0451576_0012434 3300045051 Bacteria 9560
303 Ga0451576_0152849 3300045051 Bacteria 2407
304 Ga0466958_0229236 3300045836 Bacteria 1186
305 Ga0466967_0000573 3300045976 Bacteria 18126
306 Ga0466967_0140713 3300045976 Bacteria 2247
307 Ga0466967_0215377 3300045976 Bacteria 1823
308 Ga0495592_0220454 3300046454 Bacteria 1269
309 Ga0495641_0068218 3300046461 Bacteria 1599
310 Ga0495664_0098590 3300046477 Bacteria 1760
311 Ga0495630_0120363 3300046517 Bacteria 1991
312 Ga0495631_0012313 3300046518 Bacteria 4184
313 Ga0495637_0083022 3300046520 Bacteria 1275
314 Ga0495644_0040125 3300046523 Bacteria 1765
315 Ga0495640_0094039 3300046533 Bacteria 1975
316 Ga0495586_0008813 3300046535 Bacteria 5374
317 Ga0495587_0127652 3300046536 Bacteria 1454
318 Ga0495609_0026898 3300046538 Bacteria 2631
319 Ga0495597_0101270 3300046542 Bacteria 1215
320 Ga0495645_0072760 3300046543 Bacteria 2477
321 Ga0495656_0004895 3300046615 Bacteria 4610
322 Ga0495634_0271607 3300046642 Bacteria 1032
323 Ga0495661_0026830 3300046665 Bacteria 3705
324 Ga0495657_0042075 3300046675 Bacteria 3121
325 Ga0495599_0070410 3300046678 Bacteria 2183
326 Ga0495623_0087008 3300046679 Bacteria 1925
327 Ga0495658_0019299 3300046683 Bacteria 3556
328 Ga0495624_0028584 3300046690 Bacteria 3642
329 Ga0495670_0055806 3300046691 Bacteria 1981
330 Ga0495589_0055683 3300046794 Bacteria 1948
331 Ga0495636_0036088 3300047318 Bacteria 2038
332 Ga0495674_0080822 3300047319 Bacteria 2789
333 Ga0495676_0122911 3300047321 Bacteria 1885
334 Ga0495680_0133377 3300047322 Bacteria 1823
335 Ga0495677_0073968 3300047445 Bacteria 1272
336 Ga0495684_0318240 3300047471 Bacteria 1113
337 Ga0496101_0035765 3300048904 Bacteria 3514
338 Ga0496101_0036666 3300048904 Bacteria 3473
339 Ga0496103_0014022 3300048906 Bacteria 4757
340 Ga0496103_0112674 3300048906 Bacteria 1729
341 Ga0496105_0148221 3300048908 Bacteria 1929
342 Ga0496106_0062400 3300048909 Bacteria 2829
343 Ga0496106_0085754 3300048909 Bacteria 2425
344 Ga0496106_0088859 3300048909 Bacteria 2382
345 Ga0496107_0004412 3300048910 Bacteria 9530
346 Ga0496108_0032854 3300048911 Bacteria 4310
347 Ga0496108_0365657 3300048911 Bacteria 1259
348 Ga0496109_0024800 3300048912 Bacteria 5335
349 Ga0496109_0132959 3300048912 Bacteria 2323
350 Ga0496112_0552224 3300048915 Bacteria 1085
351 Ga0496113_0241640 3300048916 Bacteria 1441
352 Ga0496114_0009217 3300048917 Bacteria 7827
353 Ga0496115_0005145 3300048918 Bacteria 9513
354 Ga0496115_0043992 3300048918 Bacteria 3561
355 Ga0496115_0231594 3300048918 Bacteria 1523
356 Ga0501031_0011153 3300049568 Bacteria 5857
357 Ga0501033_0028843 3300049570 Bacteria 4170
358 Ga0501034_0132856 3300049571 Bacteria 2472
359 Ga0501036_0021085 3300049572 Bacteria 5473
360 Ga0501037_0047178 3300049573 Bacteria 3158
361 Ga0501038_0009225 3300049574 Bacteria 9052
362 Ga0501040_0046004 3300049576 Bacteria 2978
363 Ga0501041_0005594 3300049577 Bacteria 7347
364 Ga0501042_0009966 3300049578 Bacteria 6352
365 Ga0501046_0002052 3300049580 Bacteria 19128
366 Ga0501047_0034285 3300049581 Bacteria 4901
367 Ga0501048_0000902 3300049582 Bacteria 21901
368 Ga0501068_0021541 3300049584 Bacteria 3764
369 Ga0501070_0040928 3300049586 Bacteria 3862
370 Ga0501070_0221642 3300049586 Bacteria 1551
371 Ga0501071_0002832 3300049587 Bacteria 10690
372 Ga0501072_0012285 3300049588 Bacteria 6544
373 Ga0501073_0144359 3300049589 Bacteria 1649
374 Ga0501074_0009463 3300049590 Bacteria 7076
375 Ga0501075_0013647 3300049591 Bacteria 5802
376 Ga0501076_0002366 3300049592 Bacteria 12905
377 Ga0501077_0095046 3300049593 Bacteria 1889
378 Ga0501079_0004997 3300049741 Bacteria 9833
379 Ga0501080_0114069 3300049742 Bacteria 2505
380 Ga0501080_0441051 3300049742 Bacteria 1168
381 Ga0501081_0006665 3300049743 Bacteria 7508
382 Ga0501083_0056577 3300049744 Bacteria 2628
383 Ga0501035_0021147 3300049822 Bacteria 5980
384 Ga0501035_0307712 3300049822 Bacteria 1334
385 Ga0501044_0371304 3300049823 Bacteria 1347
386 Ga0501045_0001149 3300049824 Bacteria 17521
387 nmdc:mga05p37_261980_c1 3300050507 Bacteria 2069
388 nmdc:mga05p37_491398_c1 3300050507 Bacteria 1411
389 nmdc:mga05p37_665195_c1 3300050507 Bacteria 1163
390 nmdc:mga05p37_79446_c1 3300050507 Bacteria 4039
391 nmdc:mga09592_281791_c1 3300050508 Bacteria 1441
392 nmdc:mga0qj67_369931_c1 3300050509 Bacteria 1158
393 nmdc:mga06r32_13549_c1 3300050510 Bacteria 7389
394 nmdc:mga06r32_329964_c1 3300050510 Bacteria 1511
395 nmdc:mga06r32_406687_c1 3300050510 Bacteria 1343
396 nmdc:mga08y16_20188_c1 3300050511 Bacteria 7032
397 nmdc:mga08y16_249690_c1 3300050511 Bacteria 1833
398 nmdc:mga08y16_343755_c1 3300050511 Bacteria 1533
399 nmdc:mga08y16_54815_c1 3300050511 Bacteria 4167
400 nmdc:mga08y16_60108_c1 3300050511 Bacteria 3970
401 nmdc:mga08y16_687840_c1 3300050511 Bacteria 1024
402 nmdc:mga0n895_142201_c1 3300050512 Bacteria 2428
403 nmdc:mga0n895_326625_c1 3300050512 Bacteria 1554
404 nmdc:mga0n895_463_c1 3300050512 Bacteria 27175
405 nmdc:mga0n895_65348_c1 3300050512 Bacteria 3601
406 nmdc:mga0n895_97744_c1 3300050512 Bacteria 2942
407 nmdc:mga0rr50_110887_c1 3300050513 Bacteria 2171
408 nmdc:mga0rr50_126052_c1 3300050513 Bacteria 2045
409 nmdc:mga0rr50_38166_c1 3300050513 Bacteria 3474
410 nmdc:mga0rr50_47908_c1 3300050513 Bacteria 3156
411 nmdc:mga08x19_126321_c1 3300050514 Bacteria 1718
412 nmdc:mga08x19_211474_c1 3300050514 Bacteria 1331
413 nmdc:mga08x19_48707_c1 3300050514 Bacteria 2715
414 nmdc:mga08x19_93374_c1 3300050514 Bacteria 1989
415 nmdc:mga08x19_95863_c1 3300050514 Bacteria 1963
416 nmdc:mga0a205_50148_c1 3300050515 Bacteria 4029
417 Ga0495595_0043811 3300053084 Bacteria 2054
418 Ga0501084_0008957 3300054114 Bacteria 8278
419 Ga0501084_0030960 3300054114 Bacteria 4474
420 Ga0590071_015532 3300059421 Bacteria 1785
421 Ga0590075_034160 3300059424 Bacteria 1293
422 Ga0590077_001618 3300059426 Bacteria 5162
423 Ga0590077_012129 3300059426 Bacteria 1784
424 Ga0501082_0013698 3300060353 Bacteria 6971
425 Ga0530510_0004118 3300061734 Bacteria 10038
426 Ga0530510_0223376 3300061734 Bacteria 1400
427 Ga0466967_0068849
428 JGI25407J50210_10007830
429 Ga0070690_100016817
430 Ga0068869_100295305
431 Ga0070666_10045509
432 Ga0070682_100002923
433 Ga0070682_100203534
434 Ga0068868_100008674
435 Ga0068868_100097538
436 Ga0070689_100003436
437 Ga0070687_100021659
438 Ga0070692_10004041
439 Ga0070668_100013747
440 Ga0070668_100120486
441 Ga0070675_100258245
442 Ga0070688_100015012
443 Ga0070714_100079158
444 Ga0070714_100566156
445 Ga0070713_100498550
446 Ga0070710_10006511
447 Ga0070701_10001025
448 Ga0070711_100009875
449 Ga0070711_100012596
450 Ga0070705_100005715
451 Ga0070705_100054453
452 Ga0070700_100005425
453 Ga0070700_100467837
454 Ga0070708_100006601
455 Ga0070708_100027358
456 Ga0070708_100083003
457 Ga0070663_100027525
458 Ga0070678_100011596
459 Ga0070662_100031836
460 Ga0070662_100129405
461 Ga0070681_10061188
462 Ga0068867_100004039
463 Ga0068867_100162421
464 Ga0070685_10049570
465 Ga0070706_100008083
466 Ga0070706_100352844
467 Ga0070707_100143753
468 Ga0070698_100003544
469 Ga0070698_100035504
470 Ga0070699_100013925
471 Ga0070699_100042606
472 Ga0070699_100051712
473 Ga0070699_100301427
474 Ga0070697_100032687
475 Ga0070672_100092591
476 Ga0070686_100030100
477 Ga0070695_100033716
478 Ga0070695_100096743
479 Ga0070696_100003163
480 Ga0070696_100298291
481 Ga0070693_100005399
482 Ga0070665_100076452
483 Ga0070704_100013553
484 Ga0070704_100097613
485 Ga0070704_100672484
486 Ga0068855_100829528
487 Ga0068854_100354448
488 Ga0068856_100014205
489 Ga0070702_100016026
490 Ga0070702_100139626
491 Ga0068852_100009238
492 Ga0068866_10001538
493 Ga0068861_100013273
494 Ga0068861_100315331
495 Ga0068862_100341105
496 Ga0081455_10002352
497 Ga0081455_10015042
498 Ga0081455_10020665
499 Ga0081455_10039025
500 Ga0081538_10000317
501 Ga0081538_10004529
502 Ga0081538_10038524
503 Ga0081540_1000810
504 Ga0081540_1005151
505 Ga0081539_10004182
506 Ga0070717_10051160
507 Ga0075432_10011824
508 Ga0075432_10025953
509 Ga0070716_100016041
510 Ga0070712_100006792
511 Ga0070712_100008572
512 Ga0070712_100022479
513 Ga0097621_100017778
514 Ga0068871_100005748
515 Ga0075428_100019610
516 Ga0075430_100082947
517 Ga0075431_100058491
518 Ga0075431_100125513
519 Ga0075433_10124234
520 Ga0075433_10269561
521 Ga0075434_100034823
522 Ga0075434_100049292
523 Ga0075434_100060367
524 Ga0075434_100061838
525 Ga0075434_100282904
526 Ga0068865_100007746
527 Ga0075436_100026738
528 Ga0075436_100073325
529 Ga0075436_100129355
530 Ga0075436_100222251
531 Ga0075435_100028378
532 Ga0075435_100090913
533 Ga0105244_10163192
534 Ga0105240_10299016
535 Ga0105240_10567681
536 Ga0111539_10011828
537 Ga0111539_10020673
538 Ga0105245_10026609
539 Ga0105245_10040412
540 Ga0105245_10449063
541 Ga0105247_10090216
542 Ga0114129_10012703
543 Ga0114129_10089665
544 Ga0114129_10160264
545 Ga0114129_10306783
546 Ga0114129_10421513
547 Ga0105243_10009550
548 Ga0105243_10046984
549 Ga0105241_10009560
550 Ga0105242_10003117
551 Ga0105242_10138892
552 Ga0105242_10295199
553 Ga0105248_10018884
554 Ga0105248_10495346
555 Ga0105237_10056783
556 Ga0105238_10039088
557 Ga0105249_10004585
558 Ga0105249_10051204
559 Ga0105249_10270175
560 Ga0105239_10014371
561 Ga0105239_10055318
562 Ga0105239_10595511
563 Ga0105246_10100729
564 Ga0157374_10002122
565 Ga0163162_10012727
566 Ga0163162_10027048
567 Ga0163162_10341303
568 Ga0157372_10177028
569 Ga0157375_10068758
570 Ga0157375_10673406
571 Ga0157380_10607939
572 Ga0157377_10056541
573 Ga0157377_10123476
574 Ga0157376_10008815
575 Ga0163161_10136062
576 Ga0207653_10036540
577 Ga0207642_10001340
578 Ga0207710_10099320
579 Ga0207688_10014600
580 Ga0207647_10065203
581 Ga0207699_10158495
582 Ga0207684_10004072
583 Ga0207684_10073158
584 Ga0207654_10025918
585 Ga0207695_10192535
586 Ga0207693_10001615
587 Ga0207693_10019713
588 Ga0207693_10019747
589 Ga0207693_10029554
590 Ga0207693_10132034
591 Ga0207663_10044060
592 Ga0207663_10053906
593 Ga0207663_10072396
594 Ga0207663_10096979
595 Ga0207660_10022469
596 Ga0207660_10286242
597 Ga0207662_10035473
598 Ga0207662_10211698
599 Ga0207657_10048015
600 Ga0207646_10003077
601 Ga0207659_10221732
602 Ga0207687_10030553
603 Ga0207687_10106410
604 Ga0207664_10053377
605 Ga0207644_10010013
606 Ga0207690_10176924
607 Ga0207706_10004352
608 Ga0207706_10015686
609 Ga0207686_10000935
610 Ga0207686_10147523
611 Ga0207709_10000846
612 Ga0207669_10414270
613 Ga0207704_10006244
614 Ga0207665_10031797
615 Ga0207691_10009101
616 Ga0207711_10010153
617 Ga0207667_10144963
618 Ga0207667_10239191
619 Ga0207712_10004666
620 Ga0207712_10267049
621 Ga0207668_10131272
622 Ga0207640_10151315
623 Ga0207640_10174396
624 Ga0207639_10021310
625 Ga0207678_10044360
626 Ga0207708_10004143
627 Ga0207702_10015563
628 Ga0207648_10002386
629 Ga0207648_10163590
630 Ga0207675_100001149
631 Ga0207675_100124231
632 Ga0207675_100329188
633 Ga0207683_10000699
634 Ga0207683_10010861
635 Ga0207698_10054233
636 Ga0207428_10022533
637 Ga0207428_10032576
638 Ga0207428_10034611
639 Ga0268266_10006426
640 Ga0268265_10251474
641 Ga0268265_10357442
642 Ga0268264_10093789
643 Ga0307406_10019292
644 Ga0307406_10325085
645 Ga0307409_100124779
646 Ga0307416_100186758
647 Ga0373928_0011241
648 Ga0373951_0004676
649 Ga0373955_0040921
650 Ga0373931_0004018
651 Ga0373925_0120327
652 Ga0395899_0002773
653 Ga0395899_0004852
654 Ga0395899_0007674
655 Ga0395899_0013359
656 Ga0395899_0027824
657 Ga0395899_0048544
658 Ga0395899_0249205
659 Ga0395900_0006819
660 Ga0395900_0009795
661 Ga0395900_0024880
662 Ga0395900_0028288
663 Ga0395900_0039492
664 Ga0395900_0045668
665 Ga0395900_0053482
666 Ga0395900_0056132
667 Ga0395900_0061571
668 Ga0395900_0063224
669 Ga0395900_0126932
670 Ga0395900_0138664
671 Ga0395900_0157443
672 Ga0395900_0204697
673 Ga0395900_0225421
674 Ga0395898_0014303
675 Ga0395898_0029434
676 Ga0395898_0034958
677 Ga0395898_0036343
678 Ga0395898_0059463
679 Ga0395898_0062203
680 Ga0395898_0078496
681 Ga0395898_0081867
682 Ga0395898_0097302
683 Ga0395898_0143405
684 Ga0395898_0213601
685 Ga0395898_0247205
686 Ga0395905_0001294
687 Ga0395905_0003235
688 Ga0395905_0005622
689 Ga0395905_0026122
690 Ga0395905_0047230
691 Ga0395905_0049337
692 Ga0395905_0061533
693 Ga0395905_0075339
694 Ga0395905_0119295
695 Ga0395905_0128700
696 Ga0395905_0283641
697 Ga0395901_0002205
698 Ga0395901_0002459
699 Ga0395901_0008470
700 Ga0395901_0009747
701 Ga0395901_0010874
702 Ga0395901_0019699
703 Ga0395901_0028318
704 Ga0395901_0029701
705 Ga0395901_0033048
706 Ga0395901_0035034
707 Ga0395901_0044963
708 Ga0395901_0048743
709 Ga0395901_0100466
710 Ga0395901_0122996
711 Ga0395901_0219743
712 Ga0395901_0250002
713 Ga0395901_0503423
714 Ga0439439_0002595
715 Ga0439461_0005719
716 Ga0451855_0378690
717 Ga0439433_0005134
718 Ga0439448_0050580
719 Ga0439449_0055814
720 Ga0439446_0022384
721 Ga0439434_0016737
722 Ga0466963_0007272
723 Ga0466963_0093873
724 Ga0466964_0003071
725 Ga0466964_0036182
726 Ga0466971_0033278
727 Ga0466960_0047019
728 Ga0451576_0012434
729 Ga0451576_0152849
730 Ga0466958_0229236
731 Ga0466967_0000573
732 Ga0466967_0140713
733 Ga0466967_0215377
734 Ga0495592_0220454
735 Ga0495641_0068218
736 Ga0495664_0098590
737 Ga0495630_0120363
738 Ga0495631_0012313
739 Ga0495637_0083022
740 Ga0495644_0040125
741 Ga0495640_0094039
742 Ga0495586_0008813
743 Ga0495587_0127652
744 Ga0495609_0026898
745 Ga0495597_0101270
746 Ga0495645_0072760
747 Ga0495656_0004895
748 Ga0495634_0271607
749 Ga0495661_0026830
750 Ga0495657_0042075
751 Ga0495599_0070410
752 Ga0495623_0087008
753 Ga0495658_0019299
754 Ga0495624_0028584
755 Ga0495670_0055806
756 Ga0495589_0055683
757 Ga0495636_0036088
758 Ga0495674_0080822
759 Ga0495676_0122911
760 Ga0495680_0133377
761 Ga0495677_0073968
762 Ga0495684_0318240
763 Ga0496101_0035765
764 Ga0496101_0036666
765 Ga0496103_0014022
766 Ga0496103_0112674
767 Ga0496105_0148221
768 Ga0496106_0062400
769 Ga0496106_0085754
770 Ga0496106_0088859
771 Ga0496107_0004412
772 Ga0496108_0032854
773 Ga0496108_0365657
774 Ga0496109_0024800
775 Ga0496109_0132959
776 Ga0496112_0552224
777 Ga0496113_0241640
778 Ga0496114_0009217
779 Ga0496115_0005145
780 Ga0496115_0043992
781 Ga0496115_0231594
782 Ga0501031_0011153
783 Ga0501033_0028843
784 Ga0501034_0132856
785 Ga0501036_0021085
786 Ga0501037_0047178
787 Ga0501038_0009225
788 Ga0501040_0046004
789 Ga0501041_0005594
790 Ga0501042_0009966
791 Ga0501046_0002052
792 Ga0501047_0034285
793 Ga0501048_0000902
794 Ga0501068_0021541
795 Ga0501070_0040928
796 Ga0501070_0221642
797 Ga0501071_0002832
798 Ga0501072_0012285
799 Ga0501073_0144359
800 Ga0501074_0009463
801 Ga0501075_0013647
802 Ga0501076_0002366
803 Ga0501077_0095046
804 Ga0501079_0004997
805 Ga0501080_0114069
806 Ga0501080_0441051
807 Ga0501081_0006665
808 Ga0501083_0056577
809 Ga0501035_0021147
810 Ga0501035_0307712
811 Ga0501044_0371304
812 Ga0501045_0001149
813 nmdc:mga05p37_261980_c1
814 nmdc:mga05p37_491398_c1
815 nmdc:mga05p37_665195_c1
816 nmdc:mga05p37_79446_c1
817 nmdc:mga09592_281791_c1
818 nmdc:mga0qj67_369931_c1
819 nmdc:mga06r32_13549_c1
820 nmdc:mga06r32_329964_c1
821 nmdc:mga06r32_406687_c1
822 nmdc:mga08y16_20188_c1
823 nmdc:mga08y16_249690_c1
824 nmdc:mga08y16_343755_c1
825 nmdc:mga08y16_54815_c1
826 nmdc:mga08y16_60108_c1
827 nmdc:mga08y16_687840_c1
828 nmdc:mga0n895_142201_c1
829 nmdc:mga0n895_326625_c1
830 nmdc:mga0n895_463_c1
831 nmdc:mga0n895_65348_c1
832 nmdc:mga0n895_97744_c1
833 nmdc:mga0rr50_110887_c1
834 nmdc:mga0rr50_126052_c1
835 nmdc:mga0rr50_38166_c1
836 nmdc:mga0rr50_47908_c1
837 nmdc:mga08x19_126321_c1
838 nmdc:mga08x19_211474_c1
839 nmdc:mga08x19_48707_c1
840 nmdc:mga08x19_93374_c1
841 nmdc:mga08x19_95863_c1
842 nmdc:mga0a205_50148_c1
843 Ga0495595_0043811
844 Ga0501084_0008957
845 Ga0501084_0030960
846 Ga0590071_015532
847 Ga0590075_034160
848 Ga0590077_001618
849 Ga0590077_012129
850 Ga0501082_0013698
851 Ga0530510_0004118
852 Ga0530510_0223376

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

87

266

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hpr-assembly1.cif.gz_B lpqy-sugabc in state 4 0.8366 4 243
8hpn-assembly1.cif.gz_B lpqy-sugabc in state 3 0.8279 4 251
8hps-assembly1.cif.gz_A lpqy-sugabc in state 5 0.8222 36 248
7cad-assembly1.cif.gz_A mycobacterium smegmatis sugabc complex 0.8146 36 248
4jbw-assembly2.cif.gz_I crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc 0.814 14 246
ID Description Score Start End Superfamily
af_I6Y1U3_2_266_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9031 15 249 1.10.3720.10
af_P77716_1_267_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8826 10 243 1.10.3720.10
af_Q2G1E7_1_266_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8729 6 245 1.10.3720.10
af_O53483_6_271_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.858 9 249 1.10.3720.10
af_L7N652_1_266_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8558 15 249 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A7Y6FHZ2-F1-model_v4 Carbohydrate ABC transporter permease 0.9216 9 224 GO:0005886
GO:0055085
AF-A0A0R2Q3N9-F1-model_v4 Sugar ABC transporter permease 0.9206 9 225 GO:0005886
GO:0055085
AF-A0A4U0SLV7-F1-model_v4 Carbohydrate ABC transporter permease 0.9186 15 259 GO:0005886
GO:0055085
AF-A0A5C8QDU9-F1-model_v4 Carbohydrate ABC transporter permease 0.9166 9 259 GO:0005886
GO:0055085
AF-A0A2K2TRL6-F1-model_v4 Carbohydrate ABC transporter permease 0.9149 11 259 GO:0005886
GO:0055085

Map