F441228

General Info

Members Datasets Scaffolds Average Seq Length
426 308 852 247

Family's Representative Sequence

Representative Sequence 3300027312|Ga0209371_1024082|Ga0209371_10240822
Length 288
Sequence MHMIFTRFVLCFILFKFYSQLLWRNYVIVNLYENYYQGVVAMSEAAKTLDGWYCLHDFRTMDWTTWKMVPSEERQAAINEFLGLLEKWNAVQTNKQGSHAVYNIVGQKADFMMMILRPTMEELQQIETEFNKTKLAEFTVPAHSYVSVVELSNYLPSNSDEDPYENPHVKARLYPILPESKYVCFYPMDKRRQGNDNWYMLPMDDRKSLMRSHGMIGRQYAGKVKQIITGSVGFDDYEWGVTLFSDDVLQFKKLVYEMRFDEVSARYGEFGSFFVGNILSDIPAFLEV

Samples

Sample ID Description Type Environment
1 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
8 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
9 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
10 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
11 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
12 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
13 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
14 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
27 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
28 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
29 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
30 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
31 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
33 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
34 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
35 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
36 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
37 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
38 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
39 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
40 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
41 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
42 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
43 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
46 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
47 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
49 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
50 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
52 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
53 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
67 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
68 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
69 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
70 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
71 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
72 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
73 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
74 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
75 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
76 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
77 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
78 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
79 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
80 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
81 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
82 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
83 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
84 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
85 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
86 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
87 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
88 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
89 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
90 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
91 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
92 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
93 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
94 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
95 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
96 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
97 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
98 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
99 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
100 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
101 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
102 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
103 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
104 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
105 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
106 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
107 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
108 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
109 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
110 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
111 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
112 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
113 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
114 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
115 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
116 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
117 3300049133 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
118 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
119 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
120 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
121 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
122 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
123 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
124 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
125 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
126 3300049542 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
127 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
128 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
129 3300049553 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
130 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
131 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
132 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
133 2510917027 Brevibacillus sp. CF112 Isolate Rhizosphere
134 2511231119 Bacillus velezensis CAU B946 Isolate Rhizosphere
135 2512564013 Brevibacillus sp. BC25 Isolate Rhizosphere
136 2512564039 Paenibacillus mucilaginosus 3016 Isolate Rhizosphere
137 2524023129 Paenibacillus pinihumi DSM 23905 Isolate Rhizosphere
138 2540341094 Bacillus subtilis XF-1 Isolate Rhizosphere
139 2545555800 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
140 2548877040 Paenibacillus sonchi X19-5 Isolate Rhizosphere
141 2554235283 Bacillus safensis VK Isolate Rhizosphere
142 2563366752 Paenibacillus pini JCM 16418 Isolate Rhizosphere
143 2571042143 Paenibacillus graminis RSA19 Isolate Unclassified
144 2576861599 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
145 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
146 2593339198 Paenibacillus sp. UNCCL117 Isolate Unclassified
147 2599185353 Staphylococcus sp. NFPP34 Isolate Rhizoplane
148 2600254943 Staphylococcus pasteuri NFIX07 Isolate Rhizoplane
149 2600255286 Paenibacillus sp. NFR01 Isolate Rhizoplane
150 2630968484 Bacillus methylotrophicus KACC 13105 Isolate Rhizosphere
151 2643221543 Paenibacillus sp. Root52 Isolate Unclassified
152 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
153 2643221729 Bacillus sp. Root11 Isolate Unclassified
154 2643221730 Bacillus sp. Root131 Isolate Unclassified
155 2643221731 Bacillus sp. Root147 Isolate Unclassified
156 2643221732 Bacillus sp. Root239 Isolate Unclassified
157 2643221735 Bacillus sp. Root920 Isolate Unclassified
158 2648501850 Bacillus amyloliquefaciens RHNK22 Isolate Rhizosphere
159 2671180330 Peribacillus simplex SH-B26 Isolate Unclassified
160 2671180694 Paenibacillus sp. A3 Isolate Unclassified
161 2671180844 Bacillus amyloliquefaciens Bs006 Isolate Unclassified
162 2684622632 Bacillus cereus 905 Isolate Unclassified
163 2684623153 Bacillus pumilus SH-B9 Isolate Unclassified
164 2687453109 Bacillus pumilus SH-B11 Isolate Unclassified
165 2695420354 Bacillus sp. Co1-6 Isolate Unclassified
166 2695420987 Bacillus thuringiensis KNU-07 Isolate Unclassified
167 2703719227 Bacillus mycoides GOE6 Isolate Rhizosphere
168 2716884898 Bacillus methylotrophicus FKM10 Isolate Rhizosphere
169 2718218445 Bacillus sp. B25(2016b) Isolate Rhizosphere
170 2728368933 Paenibacillus jilunlii DSM 23019 Isolate Rhizosphere
171 2738541295 Bacillus sp. OK085 Isolate Unclassified
172 2738541299 Paenisporosarcina sp. OV554 Isolate Unclassified
173 2738541358 Bacillus sp. OV752 Isolate Unclassified
174 2738543006 Bacillus sp. OK077 Isolate Unclassified
175 2738543010 Bacillus sp. YR335 Isolate Unclassified
176 2744054657 Brevibacillus sp. SKDU10 Isolate Unclassified
177 2788500588 Lysinibacillus sp. YS11 Isolate Unclassified
178 2791355222 Paenibacillus oryzae 1DrF-4 Isolate Unclassified
179 2808606364 Bacillus sp. SLBN-3 Isolate Unclassified
180 2808606399 Bacillus sp. SJZ110 Isolate Rhizosphere
181 2811994870 Bacillus sp. JB4 Isolate Unclassified
182 2816332186 Peribacillus frigoritolerans 3612 Isolate Unclassified
183 2816332295 Bacillus paralicheniformis MDJK30 Isolate Rhizosphere
184 2816332336 Brevibacillus laterosporus ZQ2 Isolate Unclassified
185 2818991441 Niallia circulans 3243 Isolate Rhizosphere
186 2818991443 Bacillus thuringiensis 1230 Isolate Unclassified
187 2818991451 Lysinibacillus fusiformis 3193 Isolate Unclassified
188 2818991459 Paenibacillus sp. 597 Isolate Unclassified
189 2818991465 Priestia megaterium 3291 Isolate Rhizosphere
190 2818991468 Bacillus safensis 3300 Isolate Rhizosphere
191 2821111986 Paenibacillus illinoisensis 582 Isolate Unclassified
192 2823526263 Bacillus altitudinis P-10 Isolate Unclassified
193 2842682962 Bacillus sp. R-72492 Isolate Unclassified
194 2842882022 Bacillus sp. R-71893 Isolate Unclassified
195 2849139964 Bacillus sp. R-71875 Isolate Unclassified
196 2852673933 Sporosarcina sp. JAI121 Isolate Rhizosphere
197 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
198 2857460504 Brevibacillus sp. R-74223 Isolate Unclassified
199 2857465823 Brevibacillus sp. R-74266 Isolate Unclassified
200 2857472729 Cohnella sp. R-74144 Isolate Unclassified
201 2857581216 Bacillus sp. R-71922 Isolate Unclassified
202 2857591370 Brevibacillus sp. R-71934 Isolate Unclassified
203 2857604169 Domibacillus sp. R-71921 Isolate Unclassified
204 2857609550 Domibacillus sp. R-71929 Isolate Unclassified
205 2860837431 Bacillus sp. WR11 Isolate Unclassified
206 2864733723 Paenibacillus sp. JGP012 Isolate Rhizosphere
207 2864997549 Paenibacillus sp. R-72005 Isolate Unclassified
208 2877768649 Bacillus amyloliquefaciens Y14 Isolate Rhizosphere
209 2880169592 Bacillus velezensis T20E-257 Isolate Unclassified
210 2881644220 Siminovitchia terrae LMG 29736 Isolate Rhizosphere
211 2885526491 Paenibacillus sp. LK1 Isolate Rhizosphere
212 2888578766 Paenibacillus lycopersici 12200R-189 Isolate Rhizosphere
213 2889042446 Paenibacillus sp. 37 Isolate Rhizosphere
214 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
215 2889295896 Paenibacillus sp. PvR098 Isolate Rhizosphere
216 2898907183 Brevibacillus sp. SYP-B805 Isolate Rhizosphere
217 2904113452 Paenibacillus paridis py1325 Isolate Unclassified
218 2904162308 Paenibacillus sp. AD87 Isolate Unclassified
219 2904490793 Paenibacillus sp. 1295 Isolate Rhizosphere
220 2904524088 Priestia megaterium 1428 Isolate Rhizosphere
221 2904560550 Bacillus velezensis 1780 Isolate Rhizosphere
222 2904606771 Lysinibacillus macroides 1284 Isolate Rhizosphere
223 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
224 2908665501 Bacillus pumilus 1391 Isolate Rhizosphere
225 2915597211 Brevibacillus brevis Ag35 Isolate Nodule
226 2915606848 Brevibacillus sp. HD1.4A Isolate Rhizosphere
227 2916971899 Alkalihalobacillus miscanthi AK13 Isolate Rhizosphere
228 2919093281 Bacillus safensis 1383 Isolate Rhizosphere
229 2919143609 Priestia megaterium 1751 Isolate Rhizosphere
230 2919160200 Paenibacillus sp. 2003 Isolate Unclassified
231 2919414237 Neobacillus niacini 3240 Isolate Rhizosphere
232 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
233 2919517244 Priestia aryabhattai 3820 Isolate Unclassified
234 2919720352 Priestia megaterium 4340 Isolate Unclassified
235 2919726948 Bacillus pumilus 4489 Isolate Unclassified
236 2925326138 Paenibacillus hemerocallicola KCTC 33185 Isolate Unclassified
237 2928093941 Priestia aryabhattai 1389 Isolate Rhizosphere
238 2928510474 Sporosarcina psychrophila 1288 Isolate Rhizosphere
239 2929004312 Priestia megaterium 1104 Isolate Unclassified
240 2929183550 Brevibacillus sp. R-71971 Hybrid assembly Isolate Unclassified
241 2929206907 Paenibacillus sp. R-74146 Hybrid assembly Isolate Unclassified
242 2929233124 Bacillus sp. R-74298 Hybrid assembly Isolate Unclassified
243 2931384279 Paenibacillus sp. DR312 Isolate Rhizosphere
244 2938649242 Paenibacillus helianthi P26E Isolate Rhizosphere
245 2938917290 Bacillus sp. CR71 Isolate Unclassified
246 2939593269 Lysinibacillus parviboronicapiens 736 Isolate Rhizosphere
247 2939679117 Paenibacillus sp. 4624 Isolate Rhizosphere
248 2945991243 Paenibacillus sp. B21a W2I17 Isolate Rhizosphere
249 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere
250 2947426588 Bacillus sp. RZ2MS9 Isolate Rhizosphere
251 2954773129 Bacillus sp. TBS-096 Isolate Rhizosphere
252 2956897341 Ectobacillus funiculus W18-2 Isolate Rhizosphere
253 2960319331 Priestia megaterium AFS057444 Isolate Unclassified
254 2960375949 Priestia megaterium AFS067084 Isolate Unclassified
255 2962290636 Bacillus subtilis TLO3 Isolate Rhizosphere
256 2964375228 Anaerobacillus alkaliphilus B16-10 Isolate Rhizosphere
257 2965761152 Bacillus sp. COPE52 Isolate Unclassified
258 2968558590 Paenibacillus sp. P3E Isolate Rhizosphere
259 2969136845 Bacillus subtilis TLO3 Isolate Rhizosphere
260 2969141011 Bacillus velezensis MH25 Isolate Unclassified
261 2969765954 Bacillus intestinalis GM2 Isolate Rhizosphere
262 2969770375 Bacillus subtilis GM5 Isolate Rhizosphere
263 2971403814 Paenibacillus tritici LMG 29502 Isolate Unclassified
264 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
265 2971893375 Bacillus sp. HNA3 Isolate Rhizosphere
266 2977254563 Bacillus sp. SORGH_AS 510 Isolate Unclassified
267 2979083700 Bacillus toyonensis SORGH_AS 407 Isolate Unclassified
268 2980125574 Paenibacillus sp. tmac-D7 Isolate Unclassified
269 2980182181 Paenibacillus cymbidii R196 Isolate Unclassified
270 2980492589 Bacillus subtilis GQJK2 Isolate Rhizosphere
271 2981284811 Paenibacillus sp. PvR052 Isolate Rhizosphere
272 2981289755 Paenibacillus sp. PvR148 Isolate Rhizosphere
273 2981980479 Paenibacillus sp. PvR018 Isolate Rhizosphere
274 2981985349 Paenibacillus sp. PvR053 Isolate Rhizosphere
275 2988225383 Paenibacillus sp. P46E Isolate Rhizosphere
276 2996632988 Paenibacillus sp. P32E Isolate Rhizosphere
277 3001267043 Bacillus sp. FJAT-49870 Isolate Rhizosphere
278 3001272096 Lederbergia citrisecunda FJAT-49732 Isolate Rhizosphere
279 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere
280 3006826541 Bacillus haikouensis CrR16 Isolate Unclassified
281 3006858327 Bacillus paralicheniformis SUBG0010 Isolate Unclassified
282 3006969106 Bacillus sp. FJAT-50079 Isolate Rhizosphere
283 3006973921 Bacillus sp. FJAT-49736 Isolate Rhizosphere
284 3006978542 Bacillus sp. FJAT-49705 Isolate Rhizosphere
285 3006984091 Lederbergia citrea FJAT-49754 Isolate Rhizosphere
286 3006988479 Bacillus sp. FJAT-49711 Isolate Rhizosphere
287 8002317523 Cohnella sp. GbtcB17 Isolate Unclassified
288 8022621104 Bacillus sp. PIC28 Isolate Rhizosphere
289 8022630665 Bacillus sp. PW192 Isolate Rhizosphere
290 8022653035 Bacillus sp. Rc4 Isolate Unclassified
291 8022792930 Bacillus sp. Xin Isolate Rhizosphere
292 8022893055 Bacillus aryabhattai AFS007213 Isolate Unclassified
293 8022914991 Bacillus aryabhattai SQU-R12 Isolate Unclassified
294 8022948649 Bacillus endophyticus FH5 Isolate Rhizosphere
295 8023438354 Bacillus sp. BH2 Isolate Unclassified
296 8023444577 Bacillus sp. BH32 Isolate Unclassified
297 8046991243 Cohnella rhizosphaerae DSM 28161 Isolate Rhizosphere
298 8052174270 Bacillus velezensis CH13 Isolate Rhizosphere
299 8054280661 Metabacillus kandeliae GX 13764 Isolate Rhizosphere
300 8054465665 Paenibacillus sonchi IIRRBNF1 Isolate Rhizosphere
301 8054795415 Paenibacillus periandrae PM10 Isolate Nodule
302 8055531788 Lysinibacillus pakistanensis LY1 Isolate Rhizosphere
303 8055632911 Paenibacillus radicibacter N1-5-1-14 Isolate Unclassified
304 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified
305 8057473075 Paenibacillus endoradicis T3-5-0-4 Isolate Unclassified
306 8057582654 Bacillus arachidis YX15 Isolate Rhizosphere
307 8057632132 Cytobacillus kochii RZ2 Isolate Rhizosphere
308 8057977335 Paenibacillus oenotherae DT7-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 53.29
Metatranscriptomes 4.93
Isolates 41.78

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.97
Nodule 0.47
Rhizoplane 7.75
Rhizosphere 49.53
Stem 0
Stem Tuber 0
Unclassified 0.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0209371_1024082 3300027312 Bacteria 1422
2 JGI25151J46595_10000061 3300003187 Bacteria 146828
3 JGI25151J46595_10001316 3300003187 Bacteria 17391
4 JGI25151J46595_10004024 3300003187 Bacteria 7892
5 JGI25151J46595_10008736 3300003187 Bacteria 4843
6 JGI25151J46595_10015451 3300003187 Bacteria 3362
7 JGI25151J46595_10015657 3300003187 Bacteria 3334
8 JGI25151J46595_10018208 3300003187 Bacteria 3025
9 JGI25151J46595_10070962 3300003187 Bacteria 1055
10 rootH1_10000350 3300003316 Bacteria 17202
11 rootH2_10040044 3300003320 Bacteria 14085
12 rootL2_10010890 3300003322 Bacteria 24266
13 rootH1_10183510 3300003323 Bacteria 4656
14 Ga0006562J51391_1001581 3300003578 Bacteria 1990
15 Ga0006562J51391_1001959 3300003578 Bacteria 4264
16 Ga0006562J51391_1001961 3300003578 Bacteria 9250
17 Ga0055538_1000106 3300003751 Bacteria 66606
18 Ga0055532_1002024 3300003758 Bacteria 4658
19 Ga0055532_1003369 3300003758 Bacteria 2773
20 Ga0055535_1006158 3300003761 Bacteria 2483
21 Ga0055536_1010972 3300003781 Bacteria 3529
22 Ga0055528_1002504 3300003790 Bacteria 9805
23 Ga0055541_1001865 3300003841 Bacteria 4395
24 Ga0055541_1003500 3300003841 Bacteria 2947
25 Ga0065704_10114119 3300005289 Bacteria 1898
26 Ga0070670_100098574 3300005331 Bacteria 2515
27 Ga0070689_100429603 3300005340 Bacteria 1121
28 Ga0070669_100264746 3300005353 Bacteria 1373
29 Ga0070675_100054705 3300005354 Bacteria 3284
30 Ga0070675_100210521 3300005354 Bacteria 1690
31 Ga0070667_100204933 3300005367 Bacteria 1751
32 Ga0070711_100141946 3300005439 Bacteria 1802
33 Ga0070672_100320446 3300005543 Bacteria 1317
34 Ga0070665_100141816 3300005548 Bacteria 2406
35 Ga0068855_100005335 3300005563 Bacteria 15687
36 Ga0068864_100118113 3300005618 Bacteria 2368
37 Ga0068863_100065960 3300005841 Bacteria 3425
38 Ga0105251_10007503 3300009011 Bacteria 6707
39 Ga0105251_10014974 3300009011 Bacteria 4257
40 Ga0105251_10038056 3300009011 Bacteria 2357
41 Ga0105251_10047872 3300009011 Bacteria 2052
42 Ga0105244_10011253 3300009036 Bacteria 5381
43 Ga0105244_10018107 3300009036 Bacteria 3962
44 Ga0105244_10018459 3300009036 Bacteria 3913
45 Ga0105244_10022243 3300009036 Bacteria 3492
46 Ga0105244_10074618 3300009036 Bacteria 1687
47 Ga0105244_10229889 3300009036 Bacteria 868
48 Ga0105250_10004149 3300009092 Bacteria 6719
49 Ga0105250_10012762 3300009092 Bacteria 3461
50 Ga0105250_10040276 3300009092 Bacteria 1874
51 Ga0105245_10049070 3300009098 Bacteria 3778
52 Ga0105247_10029585 3300009101 Bacteria 3320
53 Ga0114129_11327764 3300009147 Bacteria 890
54 Ga0105243_10091198 3300009148 Bacteria 2509
55 Ga0105242_10005936 3300009176 Bacteria 9420
56 Ga0105238_10188352 3300009551 Unclassified 2040
57 Ga0105249_10295291 3300009553 Bacteria 1623
58 Ga0105239_10288992 3300010375 Bacteria 1846
59 Ga0105246_10003894 3300011119 Bacteria 9045
60 Ga0105246_10025089 3300011119 Bacteria 3883
61 Ga0157371_10216349 3300013102 Bacteria 1376
62 Ga0157374_10001546 3300013296 Bacteria 19403
63 Ga0157374_10387157 3300013296 Bacteria 1393
64 Ga0157378_10002187 3300013297 Bacteria 17345
65 Ga0157377_10001433 3300014745 Bacteria 10287
66 Ga0157376_10019662 3300014969 Bacteria 5210
67 Ga0209784_100051 3300025224 Bacteria 183666
68 Ga0209784_100092 3300025224 Bacteria 116472
69 Ga0209566_100130 3300025225 Bacteria 91966
70 Ga0209566_100319 3300025225 Bacteria 43567
71 Ga0209566_100363 3300025225 Bacteria 38102
72 Ga0209147_100045 3300025229 Bacteria 299264
73 Ga0209147_101279 3300025229 Bacteria 9815
74 Ga0209147_101772 3300025229 Bacteria 6841
75 Ga0209147_102685 3300025229 Bacteria 4106
76 Ga0209437_100703 3300025233 Bacteria 17455
77 Ga0209258_103931 3300025242 Bacteria 2990
78 Ga0209673_1004297 3300025273 Bacteria 7701
79 Ga0209673_1007022 3300025273 Bacteria 5294
80 Ga0209130_1000355 3300025284 Bacteria 52430
81 Ga0209130_1022437 3300025284 Bacteria 1409
82 Ga0209130_1036888 3300025284 Bacteria 968
83 Ga0209676_1000784 3300025292 Bacteria 42325
84 Ga0209676_1009176 3300025292 Bacteria 4302
85 Ga0209676_1012411 3300025292 Bacteria 3350
86 Ga0209676_1032485 3300025292 Bacteria 1569
87 Ga0209025_1000011 3300025294 Bacteria 976387
88 Ga0209025_1000331 3300025294 Bacteria 104721
89 Ga0209025_1001330 3300025294 Bacteria 33454
90 Ga0209025_1002660 3300025294 Bacteria 18263
91 Ga0209025_1002664 3300025294 Bacteria 18239
92 Ga0209025_1002858 3300025294 Bacteria 17322
93 Ga0209025_1002923 3300025294 Bacteria 17011
94 Ga0209025_1004635 3300025294 Bacteria 11762
95 Ga0209025_1006516 3300025294 Bacteria 9029
96 Ga0209025_1006559 3300025294 Bacteria 8981
97 Ga0209025_1006594 3300025294 Bacteria 8946
98 Ga0209025_1016849 3300025294 Bacteria 4269
99 Ga0209025_1017464 3300025294 Bacteria 4138
100 Ga0209025_1031114 3300025294 Bacteria 2533
101 Ga0207426_1005201 3300025302 Bacteria 6042
102 Ga0207696_1005887 3300025711 Bacteria 5023
103 Ga0207696_1008730 3300025711 Bacteria 3843
104 Ga0207696_1017053 3300025711 Bacteria 2415
105 Ga0207696_1026072 3300025711 Bacteria 1813
106 Ga0207655_1001008 3300025728 Bacteria 28660
107 Ga0207655_1011718 3300025728 Bacteria 5190
108 Ga0207655_1018802 3300025728 Bacteria 3644
109 Ga0207655_1034930 3300025728 Bacteria 2254
110 Ga0207655_1042933 3300025728 Bacteria 1919
111 Ga0207713_1001728 3300025735 Bacteria 16834
112 Ga0207713_1004589 3300025735 Bacteria 8937
113 Ga0207713_1120568 3300025735 Bacteria 880
114 Ga0207685_10077708 3300025905 Bacteria 1364
115 Ga0207681_10017266 3300025923 Bacteria 4530
116 Ga0207650_10048376 3300025925 Bacteria 3136
117 Ga0207686_10030256 3300025934 Bacteria 3204
118 Ga0207709_10020716 3300025935 Bacteria 3713
119 Ga0207665_10200371 3300025939 Bacteria 1454
120 Ga0207691_10292253 3300025940 Bacteria 1401
121 Ga0207667_10001175 3300025949 Bacteria 32903
122 Ga0207641_10029802 3300026088 Unclassified 4513
123 Ga0268266_10229694 3300028379 Bacteria 1709
124 Ga0237817_10046 3300030083 Bacteria 42105
125 Ga0237817_10084 3300030083 Bacteria 28761
126 Ga0268256_1027324 3300030500 Bacteria 1422
127 Ga0307408_100026135 3300031548 Bacteria 4005
128 Ga0307407_10180823 3300031903 Bacteria 1398
129 Ga0307416_100126107 3300032002 Bacteria 2293
130 Ga0307416_100127392 3300032002 Bacteria 2283
131 Ga0395899_0013860 3300037312 Bacteria 6158
132 Ga0395899_0060153 3300037312 Bacteria 2799
133 Ga0395899_0498242 3300037312 Bacteria 790
134 Ga0237819_00023 3300038705 Bacteria 52093
135 Ga0237819_02748 3300038705 Bacteria 3385
136 Ga0439439_0001727 3300041406 Bacteria 4454
137 Ga0439433_0012022 3300041999 Bacteria 1897
138 Ga0439449_0011028 3300042007 Bacteria 3408
139 Ga0450903_021389 3300042138 Bacteria 1000
140 Ga0466969_0002580 3300044656 Bacteria 9676
141 Ga0466966_0046106 3300044684 Bacteria 2785
142 Ga0466961_0054842 3300044693 Bacteria 2542
143 Ga0466959_0003973 3300045049 Bacteria 9831
144 Ga0451576_0235514 3300045051 Bacteria 1912
145 Ga0466967_0000081 3300045976 Bacteria 34669
146 Ga0466967_1058737 3300045976 Bacteria 808
147 Ga0495627_048531 3300046453 Bacteria 1284
148 Ga0495603_0027784 3300046455 Bacteria 3412
149 Ga0495590_0074077 3300046457 Bacteria 1197
150 Ga0495606_0092143 3300046507 Bacteria 1862
151 Ga0495661_0022465 3300046665 Bacteria 4104
152 Ga0495661_0123793 3300046665 Bacteria 1424
153 Ga0495661_0141067 3300046665 Bacteria 1311
154 Ga0495670_0123194 3300046691 Bacteria 1348
155 Ga0495670_0197126 3300046691 Bacteria 1066
156 Ga0495589_0062243 3300046794 Bacteria 1831
157 Ga0495589_0229467 3300046794 Bacteria 871
158 Ga0495660_0067302 3300046810 Bacteria 1908
159 Ga0495660_0111123 3300046810 Bacteria 1398
160 Ga0495683_0069876 3300047323 Bacteria 1725
161 Ga0496100_0000595 3300048903 Bacteria 17071
162 Ga0496100_0001375 3300048903 Bacteria 11916
163 Ga0496101_0000506 3300048904 Bacteria 24503
164 Ga0496101_0000959 3300048904 Bacteria 17029
165 Ga0496101_0126650 3300048904 Bacteria 1936
166 Ga0496102_0003257 3300048905 Bacteria 13770
167 Ga0496102_0022236 3300048905 Bacteria 5617
168 Ga0496103_0000741 3300048906 Bacteria 24067
169 Ga0496103_0019707 3300048906 Bacteria 4048
170 Ga0496104_0001102 3300048907 Bacteria 23106
171 Ga0496104_0001346 3300048907 Bacteria 21272
172 Ga0496105_0004994 3300048908 Bacteria 10040
173 Ga0496105_0009758 3300048908 Bacteria 7518
174 Ga0496106_0008997 3300048909 Bacteria 7380
175 Ga0496107_0000306 3300048910 Bacteria 26247
176 Ga0496107_0000471 3300048910 Bacteria 22095
177 Ga0496108_0002954 3300048911 Bacteria 13670
178 Ga0496108_0046358 3300048911 Bacteria 3632
179 Ga0496109_0001301 3300048912 Bacteria 20661
180 Ga0496109_0001532 3300048912 Bacteria 19232
181 Ga0496110_0001021 3300048913 Bacteria 19714
182 Ga0496110_0002559 3300048913 Bacteria 13670
183 Ga0496110_0072656 3300048913 Bacteria 3053
184 Ga0496111_0000702 3300048914 Bacteria 17720
185 Ga0496111_0001455 3300048914 Bacteria 13533
186 Ga0496111_0002682 3300048914 Bacteria 10810
187 Ga0496112_0000548 3300048915 Bacteria 25751
188 Ga0496112_0005699 3300048915 Bacteria 10816
189 Ga0496113_0001054 3300048916 Bacteria 14888
190 Ga0496113_0072975 3300048916 Bacteria 2613
191 Ga0496116_0000782 3300048919 Bacteria 40453
192 Ga0496116_0001854 3300048919 Bacteria 22868
193 Ga0496116_0018155 3300048919 Bacteria 5432
194 Ga0496116_0024794 3300048919 Bacteria 4424
195 Ga0496116_0172792 3300048919 Bacteria 1169
196 Ga0496116_0179859 3300048919 Bacteria 1134
197 Ga0496117_0023767 3300048920 Bacteria 4871
198 Ga0496117_0050995 3300048920 Bacteria 2930
199 Ga0496118_0071259 3300048921 Bacteria 2503
200 Ga0496118_0364446 3300048921 Bacteria 765
201 Ga0496119_0002406 3300048922 Bacteria 20551
202 Ga0496119_0002498 3300048922 Bacteria 20103
203 Ga0496119_0017774 3300048922 Bacteria 5331
204 Ga0496120_0000212 3300048923 Bacteria 99961
205 Ga0496121_0132258 3300048924 Bacteria 1865
206 Ga0496122_0002204 3300048925 Bacteria 28441
207 Ga0496122_0005811 3300048925 Bacteria 14503
208 Ga0496122_0008160 3300048925 Bacteria 11387
209 Ga0496122_0015508 3300048925 Bacteria 7280
210 Ga0496122_0016083 3300048925 Bacteria 7109
211 Ga0496122_0040062 3300048925 Bacteria 3729
212 Ga0496122_0065888 3300048925 Bacteria 2622
213 Ga0496123_0004407 3300048926 Bacteria 14836
214 Ga0496123_0065897 3300048926 Bacteria 2298
215 Ga0496124_0000170 3300048927 Bacteria 131603
216 Ga0496124_0000998 3300048927 Bacteria 44860
217 Ga0496124_0039112 3300048927 Bacteria 4114
218 Ga0496124_0052629 3300048927 Bacteria 3458
219 Ga0496125_0000620 3300048928 Bacteria 59641
220 Ga0496125_0022744 3300048928 Bacteria 5811
221 Ga0496125_0360791 3300048928 Bacteria 864
222 Ga0496126_0002583 3300048929 Bacteria 24153
223 Ga0496126_0003050 3300048929 Bacteria 21710
224 Ga0496126_0031727 3300048929 Bacteria 4986
225 Ga0496126_0091826 3300048929 Bacteria 2669
226 Ga0496126_0314851 3300048929 Bacteria 1288
227 Ga0501344_03586 3300049133 Bacteria 832
228 Ga0501305_006849 3300049161 Bacteria 1428
229 Ga0501305_023795 3300049161 Bacteria 919
230 Ga0501312_036858 3300049528 Bacteria 787
231 Ga0501315_009996 3300049531 Bacteria 1131
232 Ga0501315_024623 3300049531 Bacteria 834
233 Ga0501316_021557 3300049532 Bacteria 815
234 Ga0501316_023393 3300049532 Bacteria 793
235 Ga0501317_004117 3300049533 Bacteria 1495
236 Ga0501317_016051 3300049533 Bacteria 967
237 Ga0501317_019113 3300049533 Bacteria 912
238 Ga0501318_022845 3300049534 Bacteria 805
239 Ga0501320_018887 3300049536 Bacteria 782
240 Ga0501321_012567 3300049537 Bacteria 960
241 Ga0501326_03874 3300049542 Bacteria 780
242 Ga0501334_05782 3300049550 Bacteria 822
243 Ga0501335_009140 3300049551 Bacteria 941
244 Ga0501337_005193 3300049553 Bacteria 868
245 Ga0501208_037019 3300049655 Bacteria 888
246 Ga0501217_005344 3300049661 Bacteria 2682
247 Ga0501217_013735 3300049661 Bacteria 1820
248 Ga0501234_014562 3300049707 Bacteria 1236
249 2511180221 2510917027 Bacteria 5287437
250 2511701491 2511231119 Bacteria 4019861
251 2512635564 2512564013 Bacteria 6286191
252 2512730639 2512564039 Bacteria 8739048
253 2524191849 2524023129 Bacteria 6762600
254 2540608693 2540341094 Bacteria 4061186
255 2545557795 2545555800 Bacteria 4222588
256 2550903784 2548877040 Bacteria 7507281
257 2555468647 2554235283 Bacteria 3683090
258 2563928553 2563366752 Bacteria 4961801
259 2571532043 2571042143 Bacteria 6986194
260 2578932185 2576861599 Bacteria 4217202
261 2587745326 2585428059 Bacteria 8696589
262 2595319580 2593339198 Bacteria 7267884
263 2600199953 2599185353 Bacteria 2219443
264 2600402287 2600254943 Bacteria 2613887
265 2601640729 2600255286 Bacteria 5390125
266 2631983341 2630968484 Bacteria 3876276
267 2643740919 2643221543 Bacteria 6628015
268 2644428126 2643221676 Bacteria 8119172
269 2644702507 2643221729 Bacteria 6621700
270 2644715137 2643221730 Bacteria 6523787
271 2644720488 2643221731 Bacteria 5623886
272 2644726427 2643221732 Bacteria 5756404
273 2644738560 2643221735 Bacteria 3676263
274 2651531092 2648501850 Bacteria 3975476
275 2672338701 2671180330 Bacteria 5521719
276 2673818112 2671180694 Bacteria 7506943
277 2674421569 2671180844 Bacteria 4164150
278 2685153345 2684622632 Bacteria 5380049
279 2686998788 2684623153 Bacteria 3878815
280 2687500080 2687453109 Bacteria 3860091
281 2695629448 2695420354 Bacteria 3922431
282 2698319843 2695420987 Bacteria 6152737
283 2705997258 2703719227 Bacteria 5631989
284 2717914860 2716884898 Bacteria 3928789
285 2721508507 2718218445 Bacteria 5113413
286 2728532150 2728368933 Bacteria 7044283
287 2738813599 2738541295 Bacteria 5730091
288 2738839172 2738541299 Bacteria 4020721
289 2739156852 2738541358 Bacteria 5932299
290 2739209398 2738543006 Bacteria 5904091
291 2739232324 2738543010 Bacteria 5583595
292 2745170069 2744054657 Bacteria 5016802
293 2791211821 2788500588 Bacteria 4584915
294 2793185140 2791355222 Bacteria 5898266
295 2808870766 2808606364 Bacteria 4465927
296 2809053832 2808606399 Bacteria 4021018
297 2812313970 2811994870 Bacteria 3776934
298 2816865375 2816332186 Bacteria 5331395
299 2817482076 2816332295 Bacteria 4352468
300 2817620441 2816332336 Bacteria 5207640
301 2819567414 2818991441 Bacteria 5062707
302 2819583685 2818991443 Bacteria 6598732
303 2819626633 2818991451 Bacteria 4697364
304 2819674858 2818991459 Bacteria 8736032
305 2819711011 2818991465 Bacteria 5388835
306 2819722992 2818991468 Bacteria 3723169
307 2821117353 2821111986 Bacteria 6894338
308 2823530022 2823526263 Bacteria 3765752
309 2842687553 2842682962 Bacteria 5589973
310 2842886428 2842882022 Bacteria 6158489
311 2849142964 2849139964 Bacteria 5613304
312 2852674201 2852673933 Bacteria 3347676
313 2857458011 2857453340 Bacteria 8090534
314 2857461888 2857460504 Bacteria 5194327
315 2857469227 2857465823 Bacteria 6772595
316 2857475977 2857472729 Bacteria 6568124
317 2857583163 2857581216 Bacteria 5522813
318 2857595389 2857591370 Bacteria 6569758
319 2857609132 2857604169 Bacteria 5111450
320 2857610331 2857609550 Bacteria 3753890
321 2860841510 2860837431 Bacteria 4202080
322 2864735604 2864733723 Bacteria 6770668
323 2865001291 2864997549 Bacteria 5139696
324 2877772375 2877768649 Bacteria 3957164
325 2880173224 2880169592 Bacteria 3900066
326 2881646069 2881644220 Bacteria 5302661
327 2885533034 2885526491 Bacteria 7164189
328 2888580573 2888578766 Bacteria 6743310
329 2889047625 2889042446 Bacteria 7618936
330 2889050773 2889049205 Bacteria 7524325
331 2889300501 2889295896 Bacteria 4704906
332 2898908495 2898907183 Bacteria 4067722
333 2904116608 2904113452 Bacteria 7796941
334 2904162426 2904162308 Bacteria 7086713
335 2904495583 2904490793 Bacteria 7046938
336 2904528841 2904524088 Bacteria 5887454
337 2904561819 2904560550 Bacteria 4029838
338 2904608956 2904606771 Bacteria 4684500
339 2904759379 2904755435 Bacteria 7986759
340 2908667255 2908665501 Bacteria 3678115
341 2915603303 2915597211 Bacteria 6475886
342 2915610179 2915606848 Bacteria 6032732
343 2916976226 2916971899 Bacteria 4250608
344 2919094729 2919093281 Bacteria 3660974
345 2919148471 2919143609 Bacteria 6219228
346 2919164532 2919160200 Bacteria 6929020
347 2919416126 2919414237 Bacteria 5429133
348 2919418150 2919414237 Bacteria 5429133
349 2919428599 2919425241 Bacteria 8055701
350 2919521760 2919517244 Bacteria 5858162
351 2919724890 2919720352 Bacteria 5986006
352 2919727293 2919726948 Bacteria 3696050
353 2925328839 2925326138 Bacteria 9652120
354 2928098183 2928093941 Bacteria 5965005
355 2928510843 2928510474 Bacteria 4815308
356 2929007617 2929004312 Bacteria 5678476
357 2929188381 2929183550 Bacteria 6377511
358 2929211113 2929206907 Bacteria 5918291
359 2929239055 2929233124 Bacteria 5948380
360 2931384676 2931384279 Bacteria 7299545
361 2938652873 2938649242 Bacteria 7118381
362 2938923280 2938917290 Bacteria 5914775
363 2939597791 2939593269 Bacteria 4798695
364 2939683949 2939679117 Bacteria 6921672
365 2945996668 2945991243 Bacteria 7008369
366 2946059346 2946053406 Bacteria 6978655
367 2947432149 2947426588 Bacteria 5357194
368 2954776567 2954773129 Bacteria 3741715
369 2956902317 2956897341 Bacteria 5447711
370 2960321410 2960319331 Bacteria 5502575
371 2960378356 2960375949 Bacteria 5361395
372 2962294748 2962290636 Bacteria 4072939
373 2964375460 2964375228 Bacteria 4909004
374 2965766674 2965761152 Bacteria 5806513
375 2968563657 2968558590 Bacteria 6956864
376 2969140671 2969136845 Bacteria 3923176
377 2969144942 2969141011 Bacteria 4118468
378 2969768502 2969765954 Bacteria 4216713
379 2969770852 2969770375 Bacteria 4271280
380 2971408795 2971403814 Bacteria 7370929
381 2971413488 2971410472 Bacteria 8311090
382 2971897066 2971893375 Bacteria 3929648
383 2977254967 2977254563 Bacteria 4828420
384 2979089035 2979083700 Bacteria 5894929
385 2980126820 2980125574 Bacteria 5567337
386 2980185939 2980182181 Bacteria 9454109
387 2980496515 2980492589 Bacteria 4072961
388 2981287584 2981284811 Bacteria 4641497
389 2981292779 2981289755 Bacteria 4641509
390 2981983007 2981980479 Bacteria 4641628
391 2981987917 2981985349 Bacteria 4641497
392 2988226001 2988225383 Bacteria 7221625
393 2996637647 2996632988 Bacteria 6921523
394 3001269721 3001267043 Bacteria 4823521
395 3001275067 3001272096 Bacteria 4729684
396 3001894426 3001892409 Bacteria 6328293
397 3006826613 3006826541 Bacteria 4678913
398 3006862505 3006858327 Bacteria 4317835
399 3006969530 3006969106 Bacteria 4739423
400 3006977986 3006973921 Bacteria 4423788
401 3006978905 3006978542 Bacteria 5328100
402 3006980421 3006978542 Bacteria 5328100
403 3006986481 3006984091 Bacteria 4207523
404 3006990802 3006988479 Bacteria 4767936
405 8002324341 8002317523 Bacteria 8051857
406 8022626869 8022621104 Bacteria 5241040
407 8022632593 8022630665 Bacteria 3886130
408 8022655563 8022653035 Bacteria 4035078
409 8022793670 8022792930 Bacteria 5693794
410 8022894458 8022893055 Bacteria 5300455
411 8022918430 8022914991 Bacteria 5584517
412 8022954064 8022948649 Bacteria 5366783
413 8023441528 8023438354 Bacteria 5779374
414 8023449049 8023444577 Bacteria 5661597
415 8046995581 8046991243 Bacteria 8497463
416 8052175917 8052174270 Bacteria 3881265
417 8054283823 8054280661 Bacteria 4232245
418 8054470714 8054465665 Bacteria 7323556
419 8054797977 8054795415 Bacteria 9785225
420 8055532408 8055531788 Bacteria 5249694
421 8055633443 8055632911 Bacteria 5283357
422 8056535764 8056533031 Bacteria 8964429
423 8057477368 8057473075 Bacteria 5892720
424 8057587802 8057582654 Bacteria 5218944
425 8057636719 8057632132 Bacteria 4726859
426 8057978064 8057977335 Bacteria 5694872
427 Ga0209371_1024082
428 JGI25151J46595_10000061
429 JGI25151J46595_10001316
430 JGI25151J46595_10004024
431 JGI25151J46595_10008736
432 JGI25151J46595_10015451
433 JGI25151J46595_10015657
434 JGI25151J46595_10018208
435 JGI25151J46595_10070962
436 rootH1_10000350
437 rootH2_10040044
438 rootL2_10010890
439 rootH1_10183510
440 Ga0006562J51391_1001581
441 Ga0006562J51391_1001959
442 Ga0006562J51391_1001961
443 Ga0055538_1000106
444 Ga0055532_1002024
445 Ga0055532_1003369
446 Ga0055535_1006158
447 Ga0055536_1010972
448 Ga0055528_1002504
449 Ga0055541_1001865
450 Ga0055541_1003500
451 Ga0065704_10114119
452 Ga0070670_100098574
453 Ga0070689_100429603
454 Ga0070669_100264746
455 Ga0070675_100054705
456 Ga0070675_100210521
457 Ga0070667_100204933
458 Ga0070711_100141946
459 Ga0070672_100320446
460 Ga0070665_100141816
461 Ga0068855_100005335
462 Ga0068864_100118113
463 Ga0068863_100065960
464 Ga0105251_10007503
465 Ga0105251_10014974
466 Ga0105251_10038056
467 Ga0105251_10047872
468 Ga0105244_10011253
469 Ga0105244_10018107
470 Ga0105244_10018459
471 Ga0105244_10022243
472 Ga0105244_10074618
473 Ga0105244_10229889
474 Ga0105250_10004149
475 Ga0105250_10012762
476 Ga0105250_10040276
477 Ga0105245_10049070
478 Ga0105247_10029585
479 Ga0114129_11327764
480 Ga0105243_10091198
481 Ga0105242_10005936
482 Ga0105238_10188352
483 Ga0105249_10295291
484 Ga0105239_10288992
485 Ga0105246_10003894
486 Ga0105246_10025089
487 Ga0157371_10216349
488 Ga0157374_10001546
489 Ga0157374_10387157
490 Ga0157378_10002187
491 Ga0157377_10001433
492 Ga0157376_10019662
493 Ga0209784_100051
494 Ga0209784_100092
495 Ga0209566_100130
496 Ga0209566_100319
497 Ga0209566_100363
498 Ga0209147_100045
499 Ga0209147_101279
500 Ga0209147_101772
501 Ga0209147_102685
502 Ga0209437_100703
503 Ga0209258_103931
504 Ga0209673_1004297
505 Ga0209673_1007022
506 Ga0209130_1000355
507 Ga0209130_1022437
508 Ga0209130_1036888
509 Ga0209676_1000784
510 Ga0209676_1009176
511 Ga0209676_1012411
512 Ga0209676_1032485
513 Ga0209025_1000011
514 Ga0209025_1000331
515 Ga0209025_1001330
516 Ga0209025_1002660
517 Ga0209025_1002664
518 Ga0209025_1002858
519 Ga0209025_1002923
520 Ga0209025_1004635
521 Ga0209025_1006516
522 Ga0209025_1006559
523 Ga0209025_1006594
524 Ga0209025_1016849
525 Ga0209025_1017464
526 Ga0209025_1031114
527 Ga0207426_1005201
528 Ga0207696_1005887
529 Ga0207696_1008730
530 Ga0207696_1017053
531 Ga0207696_1026072
532 Ga0207655_1001008
533 Ga0207655_1011718
534 Ga0207655_1018802
535 Ga0207655_1034930
536 Ga0207655_1042933
537 Ga0207713_1001728
538 Ga0207713_1004589
539 Ga0207713_1120568
540 Ga0207685_10077708
541 Ga0207681_10017266
542 Ga0207650_10048376
543 Ga0207686_10030256
544 Ga0207709_10020716
545 Ga0207665_10200371
546 Ga0207691_10292253
547 Ga0207667_10001175
548 Ga0207641_10029802
549 Ga0268266_10229694
550 Ga0237817_10046
551 Ga0237817_10084
552 Ga0268256_1027324
553 Ga0307408_100026135
554 Ga0307407_10180823
555 Ga0307416_100126107
556 Ga0307416_100127392
557 Ga0395899_0013860
558 Ga0395899_0060153
559 Ga0395899_0498242
560 Ga0237819_00023
561 Ga0237819_02748
562 Ga0439439_0001727
563 Ga0439433_0012022
564 Ga0439449_0011028
565 Ga0450903_021389
566 Ga0466969_0002580
567 Ga0466966_0046106
568 Ga0466961_0054842
569 Ga0466959_0003973
570 Ga0451576_0235514
571 Ga0466967_0000081
572 Ga0466967_1058737
573 Ga0495627_048531
574 Ga0495603_0027784
575 Ga0495590_0074077
576 Ga0495606_0092143
577 Ga0495661_0022465
578 Ga0495661_0123793
579 Ga0495661_0141067
580 Ga0495670_0123194
581 Ga0495670_0197126
582 Ga0495589_0062243
583 Ga0495589_0229467
584 Ga0495660_0067302
585 Ga0495660_0111123
586 Ga0495683_0069876
587 Ga0496100_0000595
588 Ga0496100_0001375
589 Ga0496101_0000506
590 Ga0496101_0000959
591 Ga0496101_0126650
592 Ga0496102_0003257
593 Ga0496102_0022236
594 Ga0496103_0000741
595 Ga0496103_0019707
596 Ga0496104_0001102
597 Ga0496104_0001346
598 Ga0496105_0004994
599 Ga0496105_0009758
600 Ga0496106_0008997
601 Ga0496107_0000306
602 Ga0496107_0000471
603 Ga0496108_0002954
604 Ga0496108_0046358
605 Ga0496109_0001301
606 Ga0496109_0001532
607 Ga0496110_0001021
608 Ga0496110_0002559
609 Ga0496110_0072656
610 Ga0496111_0000702
611 Ga0496111_0001455
612 Ga0496111_0002682
613 Ga0496112_0000548
614 Ga0496112_0005699
615 Ga0496113_0001054
616 Ga0496113_0072975
617 Ga0496116_0000782
618 Ga0496116_0001854
619 Ga0496116_0018155
620 Ga0496116_0024794
621 Ga0496116_0172792
622 Ga0496116_0179859
623 Ga0496117_0023767
624 Ga0496117_0050995
625 Ga0496118_0071259
626 Ga0496118_0364446
627 Ga0496119_0002406
628 Ga0496119_0002498
629 Ga0496119_0017774
630 Ga0496120_0000212
631 Ga0496121_0132258
632 Ga0496122_0002204
633 Ga0496122_0005811
634 Ga0496122_0008160
635 Ga0496122_0015508
636 Ga0496122_0016083
637 Ga0496122_0040062
638 Ga0496122_0065888
639 Ga0496123_0004407
640 Ga0496123_0065897
641 Ga0496124_0000170
642 Ga0496124_0000998
643 Ga0496124_0039112
644 Ga0496124_0052629
645 Ga0496125_0000620
646 Ga0496125_0022744
647 Ga0496125_0360791
648 Ga0496126_0002583
649 Ga0496126_0003050
650 Ga0496126_0031727
651 Ga0496126_0091826
652 Ga0496126_0314851
653 Ga0501344_03586
654 Ga0501305_006849
655 Ga0501305_023795
656 Ga0501312_036858
657 Ga0501315_009996
658 Ga0501315_024623
659 Ga0501316_021557
660 Ga0501316_023393
661 Ga0501317_004117
662 Ga0501317_016051
663 Ga0501317_019113
664 Ga0501318_022845
665 Ga0501320_018887
666 Ga0501321_012567
667 Ga0501326_03874
668 Ga0501334_05782
669 Ga0501335_009140
670 Ga0501337_005193
671 Ga0501208_037019
672 Ga0501217_005344
673 Ga0501217_013735
674 Ga0501234_014562
675 2511180221
676 2511701491
677 2512635564
678 2512730639
679 2524191849
680 2540608693
681 2545557795
682 2550903784
683 2555468647
684 2563928553
685 2571532043
686 2578932185
687 2587745326
688 2595319580
689 2600199953
690 2600402287
691 2601640729
692 2631983341
693 2643740919
694 2644428126
695 2644702507
696 2644715137
697 2644720488
698 2644726427
699 2644738560
700 2651531092
701 2672338701
702 2673818112
703 2674421569
704 2685153345
705 2686998788
706 2687500080
707 2695629448
708 2698319843
709 2705997258
710 2717914860
711 2721508507
712 2728532150
713 2738813599
714 2738839172
715 2739156852
716 2739209398
717 2739232324
718 2745170069
719 2791211821
720 2793185140
721 2808870766
722 2809053832
723 2812313970
724 2816865375
725 2817482076
726 2817620441
727 2819567414
728 2819583685
729 2819626633
730 2819674858
731 2819711011
732 2819722992
733 2821117353
734 2823530022
735 2842687553
736 2842886428
737 2849142964
738 2852674201
739 2857458011
740 2857461888
741 2857469227
742 2857475977
743 2857583163
744 2857595389
745 2857609132
746 2857610331
747 2860841510
748 2864735604
749 2865001291
750 2877772375
751 2880173224
752 2881646069
753 2885533034
754 2888580573
755 2889047625
756 2889050773
757 2889300501
758 2898908495
759 2904116608
760 2904162426
761 2904495583
762 2904528841
763 2904561819
764 2904608956
765 2904759379
766 2908667255
767 2915603303
768 2915610179
769 2916976226
770 2919094729
771 2919148471
772 2919164532
773 2919416126
774 2919418150
775 2919428599
776 2919521760
777 2919724890
778 2919727293
779 2925328839
780 2928098183
781 2928510843
782 2929007617
783 2929188381
784 2929211113
785 2929239055
786 2931384676
787 2938652873
788 2938923280
789 2939597791
790 2939683949
791 2945996668
792 2946059346
793 2947432149
794 2954776567
795 2956902317
796 2960321410
797 2960378356
798 2962294748
799 2964375460
800 2965766674
801 2968563657
802 2969140671
803 2969144942
804 2969768502
805 2969770852
806 2971408795
807 2971413488
808 2971897066
809 2977254967
810 2979089035
811 2980126820
812 2980185939
813 2980496515
814 2981287584
815 2981292779
816 2981983007
817 2981987917
818 2988226001
819 2996637647
820 3001269721
821 3001275067
822 3001894426
823 3006826613
824 3006862505
825 3006969530
826 3006977986
827 3006978905
828 3006980421
829 3006986481
830 3006990802
831 8002324341
832 8022626869
833 8022632593
834 8022655563
835 8022793670
836 8022894458
837 8022918430
838 8022954064
839 8023441528
840 8023449049
841 8046995581
842 8052175917
843 8054283823
844 8054470714
845 8054797977
846 8055532408
847 8055633443
848 8056535764
849 8057477368
850 8057587802
851 8057636719
852 8057978064

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06778

Chlor_dismutase

Chlorite dismutase

43

279

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5t2k-assembly1.cif.gz_B geobacillus stearothermophilus hemq with manganese-coproporphyrin iii 0.9907 9 256
5loq-assembly1.cif.gz_C structure of coproheme bound hemq from listeria monocytogenes 0.9905 9 256
5t2k-assembly1.cif.gz_E geobacillus stearothermophilus hemq with manganese-coproporphyrin iii 0.9901 9 256
6fxj-assembly1.cif.gz_B structure of coproheme decarboxylase from listeria monocytogenes in complex with iron coproporphyrin iii 0.9894 9 256
5loq-assembly1.cif.gz_E structure of coproheme bound hemq from listeria monocytogenes 0.9891 12 256
ID Description Score Start End Superfamily
5loqB02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Apc35880; domain 1 0.9922 147 256 3.30.70.1030
af_Q2G0J1_1_118_3.30.70.1030 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Apc35880; domain 1 0.992 9 122 3.30.70.1030
5loqE01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Apc35880; domain 1 0.9854 12 144 3.30.70.1030
5loqB02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Apc35880; domain 1 0.9746 147 256 3.30.70.1030
5loqE01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Apc35880; domain 1 0.9699 12 144 3.30.70.1030
ID Description Score Start End GO Terms
AF-A0A5C8MQY7-F1-model_v4 Heme-dependent peroxidase 0.9945 146 256 GO:0004601
GO:0020037
GO:0046872
AF-A0A2S6DJ08-F1-model_v4 deleted 0.993 54 216
AF-W4QCL1-F1-model_v4 Hemoprotein HemQ 0.993 176 255 GO:0016491
GO:0020037
GO:0046872
AF-A0A7M2QR76-F1-model_v4 Coproheme decarboxylase (Coproheme III oxidative decarboxylase) (Hydrogen peroxide-dependent heme synthase) 0.9913 9 256 GO:0004601
GO:0006783
GO:0020037
GO:0046872
AF-A0A3A0UU01-F1-model_v4 Heme-dependent peroxidase 0.9913 163 256 GO:0004601
GO:0020037
GO:0046872

Map