F441228
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 426 | 308 | 852 | 247 |
Family's Representative Sequence
| Representative Sequence | 3300027312|Ga0209371_1024082|Ga0209371_10240822 |
| Length | 288 |
| Sequence | MHMIFTRFVLCFILFKFYSQLLWRNYVIVNLYENYYQGVVAMSEAAKTLDGWYCLHDFRTMDWTTWKMVPSEERQAAINEFLGLLEKWNAVQTNKQGSHAVYNIVGQKADFMMMILRPTMEELQQIETEFNKTKLAEFTVPAHSYVSVVELSNYLPSNSDEDPYENPHVKARLYPILPESKYVCFYPMDKRRQGNDNWYMLPMDDRKSLMRSHGMIGRQYAGKVKQIITGSVGFDDYEWGVTLFSDDVLQFKKLVYEMRFDEVSARYGEFGSFFVGNILSDIPAFLEV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 3 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 4 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 5 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 6 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 7 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 8 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 9 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 10 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 11 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 12 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 13 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 14 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 24 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 25 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 26 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 27 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 28 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 29 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 30 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 31 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 32 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 33 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 39 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 40 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 41 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 44 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 45 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 46 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 47 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 48 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 49 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 50 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 51 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 52 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 53 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300030083 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 | Metagenome | Unclassified |
| 67 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 68 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 69 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 70 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 71 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 72 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 73 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 74 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 75 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 76 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 77 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 78 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 79 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 80 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 81 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 82 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 83 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 84 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 85 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 86 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 87 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 88 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 89 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 90 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 91 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 92 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 93 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 94 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 95 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 96 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 97 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 98 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 99 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 100 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 101 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 102 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 103 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 104 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 105 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 106 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 107 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 108 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 109 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 110 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 111 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 112 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 113 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 114 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 115 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 116 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 117 | 3300049133 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 118 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 119 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 120 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 121 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 122 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 123 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 124 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 125 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 126 | 3300049542 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 127 | 3300049550 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 128 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 129 | 3300049553 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 130 | 3300049655 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought | Metagenome | Rhizosphere |
| 131 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 132 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 133 | 2510917027 | Brevibacillus sp. CF112 | Isolate | Rhizosphere |
| 134 | 2511231119 | Bacillus velezensis CAU B946 | Isolate | Rhizosphere |
| 135 | 2512564013 | Brevibacillus sp. BC25 | Isolate | Rhizosphere |
| 136 | 2512564039 | Paenibacillus mucilaginosus 3016 | Isolate | Rhizosphere |
| 137 | 2524023129 | Paenibacillus pinihumi DSM 23905 | Isolate | Rhizosphere |
| 138 | 2540341094 | Bacillus subtilis XF-1 | Isolate | Rhizosphere |
| 139 | 2545555800 | Bacillus amyloliquefaciens EGD-AQ14 | Isolate | Rhizosphere |
| 140 | 2548877040 | Paenibacillus sonchi X19-5 | Isolate | Rhizosphere |
| 141 | 2554235283 | Bacillus safensis VK | Isolate | Rhizosphere |
| 142 | 2563366752 | Paenibacillus pini JCM 16418 | Isolate | Rhizosphere |
| 143 | 2571042143 | Paenibacillus graminis RSA19 | Isolate | Unclassified |
| 144 | 2576861599 | Bacillus amyloliquefaciens EGD-AQ14 | Isolate | Rhizosphere |
| 145 | 2585428059 | Paenibacillus chondroitinus OK414 | Isolate | Rhizosphere |
| 146 | 2593339198 | Paenibacillus sp. UNCCL117 | Isolate | Unclassified |
| 147 | 2599185353 | Staphylococcus sp. NFPP34 | Isolate | Rhizoplane |
| 148 | 2600254943 | Staphylococcus pasteuri NFIX07 | Isolate | Rhizoplane |
| 149 | 2600255286 | Paenibacillus sp. NFR01 | Isolate | Rhizoplane |
| 150 | 2630968484 | Bacillus methylotrophicus KACC 13105 | Isolate | Rhizosphere |
| 151 | 2643221543 | Paenibacillus sp. Root52 | Isolate | Unclassified |
| 152 | 2643221676 | Paenibacillus sp. Root444D2 | Isolate | Unclassified |
| 153 | 2643221729 | Bacillus sp. Root11 | Isolate | Unclassified |
| 154 | 2643221730 | Bacillus sp. Root131 | Isolate | Unclassified |
| 155 | 2643221731 | Bacillus sp. Root147 | Isolate | Unclassified |
| 156 | 2643221732 | Bacillus sp. Root239 | Isolate | Unclassified |
| 157 | 2643221735 | Bacillus sp. Root920 | Isolate | Unclassified |
| 158 | 2648501850 | Bacillus amyloliquefaciens RHNK22 | Isolate | Rhizosphere |
| 159 | 2671180330 | Peribacillus simplex SH-B26 | Isolate | Unclassified |
| 160 | 2671180694 | Paenibacillus sp. A3 | Isolate | Unclassified |
| 161 | 2671180844 | Bacillus amyloliquefaciens Bs006 | Isolate | Unclassified |
| 162 | 2684622632 | Bacillus cereus 905 | Isolate | Unclassified |
| 163 | 2684623153 | Bacillus pumilus SH-B9 | Isolate | Unclassified |
| 164 | 2687453109 | Bacillus pumilus SH-B11 | Isolate | Unclassified |
| 165 | 2695420354 | Bacillus sp. Co1-6 | Isolate | Unclassified |
| 166 | 2695420987 | Bacillus thuringiensis KNU-07 | Isolate | Unclassified |
| 167 | 2703719227 | Bacillus mycoides GOE6 | Isolate | Rhizosphere |
| 168 | 2716884898 | Bacillus methylotrophicus FKM10 | Isolate | Rhizosphere |
| 169 | 2718218445 | Bacillus sp. B25(2016b) | Isolate | Rhizosphere |
| 170 | 2728368933 | Paenibacillus jilunlii DSM 23019 | Isolate | Rhizosphere |
| 171 | 2738541295 | Bacillus sp. OK085 | Isolate | Unclassified |
| 172 | 2738541299 | Paenisporosarcina sp. OV554 | Isolate | Unclassified |
| 173 | 2738541358 | Bacillus sp. OV752 | Isolate | Unclassified |
| 174 | 2738543006 | Bacillus sp. OK077 | Isolate | Unclassified |
| 175 | 2738543010 | Bacillus sp. YR335 | Isolate | Unclassified |
| 176 | 2744054657 | Brevibacillus sp. SKDU10 | Isolate | Unclassified |
| 177 | 2788500588 | Lysinibacillus sp. YS11 | Isolate | Unclassified |
| 178 | 2791355222 | Paenibacillus oryzae 1DrF-4 | Isolate | Unclassified |
| 179 | 2808606364 | Bacillus sp. SLBN-3 | Isolate | Unclassified |
| 180 | 2808606399 | Bacillus sp. SJZ110 | Isolate | Rhizosphere |
| 181 | 2811994870 | Bacillus sp. JB4 | Isolate | Unclassified |
| 182 | 2816332186 | Peribacillus frigoritolerans 3612 | Isolate | Unclassified |
| 183 | 2816332295 | Bacillus paralicheniformis MDJK30 | Isolate | Rhizosphere |
| 184 | 2816332336 | Brevibacillus laterosporus ZQ2 | Isolate | Unclassified |
| 185 | 2818991441 | Niallia circulans 3243 | Isolate | Rhizosphere |
| 186 | 2818991443 | Bacillus thuringiensis 1230 | Isolate | Unclassified |
| 187 | 2818991451 | Lysinibacillus fusiformis 3193 | Isolate | Unclassified |
| 188 | 2818991459 | Paenibacillus sp. 597 | Isolate | Unclassified |
| 189 | 2818991465 | Priestia megaterium 3291 | Isolate | Rhizosphere |
| 190 | 2818991468 | Bacillus safensis 3300 | Isolate | Rhizosphere |
| 191 | 2821111986 | Paenibacillus illinoisensis 582 | Isolate | Unclassified |
| 192 | 2823526263 | Bacillus altitudinis P-10 | Isolate | Unclassified |
| 193 | 2842682962 | Bacillus sp. R-72492 | Isolate | Unclassified |
| 194 | 2842882022 | Bacillus sp. R-71893 | Isolate | Unclassified |
| 195 | 2849139964 | Bacillus sp. R-71875 | Isolate | Unclassified |
| 196 | 2852673933 | Sporosarcina sp. JAI121 | Isolate | Rhizosphere |
| 197 | 2857453340 | Paenibacillus sp. R-74130 | Isolate | Unclassified |
| 198 | 2857460504 | Brevibacillus sp. R-74223 | Isolate | Unclassified |
| 199 | 2857465823 | Brevibacillus sp. R-74266 | Isolate | Unclassified |
| 200 | 2857472729 | Cohnella sp. R-74144 | Isolate | Unclassified |
| 201 | 2857581216 | Bacillus sp. R-71922 | Isolate | Unclassified |
| 202 | 2857591370 | Brevibacillus sp. R-71934 | Isolate | Unclassified |
| 203 | 2857604169 | Domibacillus sp. R-71921 | Isolate | Unclassified |
| 204 | 2857609550 | Domibacillus sp. R-71929 | Isolate | Unclassified |
| 205 | 2860837431 | Bacillus sp. WR11 | Isolate | Unclassified |
| 206 | 2864733723 | Paenibacillus sp. JGP012 | Isolate | Rhizosphere |
| 207 | 2864997549 | Paenibacillus sp. R-72005 | Isolate | Unclassified |
| 208 | 2877768649 | Bacillus amyloliquefaciens Y14 | Isolate | Rhizosphere |
| 209 | 2880169592 | Bacillus velezensis T20E-257 | Isolate | Unclassified |
| 210 | 2881644220 | Siminovitchia terrae LMG 29736 | Isolate | Rhizosphere |
| 211 | 2885526491 | Paenibacillus sp. LK1 | Isolate | Rhizosphere |
| 212 | 2888578766 | Paenibacillus lycopersici 12200R-189 | Isolate | Rhizosphere |
| 213 | 2889042446 | Paenibacillus sp. 37 | Isolate | Rhizosphere |
| 214 | 2889049205 | Paenibacillus rhizovicinus 14171R-81 | Isolate | Rhizosphere |
| 215 | 2889295896 | Paenibacillus sp. PvR098 | Isolate | Rhizosphere |
| 216 | 2898907183 | Brevibacillus sp. SYP-B805 | Isolate | Rhizosphere |
| 217 | 2904113452 | Paenibacillus paridis py1325 | Isolate | Unclassified |
| 218 | 2904162308 | Paenibacillus sp. AD87 | Isolate | Unclassified |
| 219 | 2904490793 | Paenibacillus sp. 1295 | Isolate | Rhizosphere |
| 220 | 2904524088 | Priestia megaterium 1428 | Isolate | Rhizosphere |
| 221 | 2904560550 | Bacillus velezensis 1780 | Isolate | Rhizosphere |
| 222 | 2904606771 | Lysinibacillus macroides 1284 | Isolate | Rhizosphere |
| 223 | 2904755435 | Paenibacillus aceris KACC 19194 | Isolate | Rhizosphere |
| 224 | 2908665501 | Bacillus pumilus 1391 | Isolate | Rhizosphere |
| 225 | 2915597211 | Brevibacillus brevis Ag35 | Isolate | Nodule |
| 226 | 2915606848 | Brevibacillus sp. HD1.4A | Isolate | Rhizosphere |
| 227 | 2916971899 | Alkalihalobacillus miscanthi AK13 | Isolate | Rhizosphere |
| 228 | 2919093281 | Bacillus safensis 1383 | Isolate | Rhizosphere |
| 229 | 2919143609 | Priestia megaterium 1751 | Isolate | Rhizosphere |
| 230 | 2919160200 | Paenibacillus sp. 2003 | Isolate | Unclassified |
| 231 | 2919414237 | Neobacillus niacini 3240 | Isolate | Rhizosphere |
| 232 | 2919425241 | Bacillus sp. 3255 | Isolate | Rhizosphere |
| 233 | 2919517244 | Priestia aryabhattai 3820 | Isolate | Unclassified |
| 234 | 2919720352 | Priestia megaterium 4340 | Isolate | Unclassified |
| 235 | 2919726948 | Bacillus pumilus 4489 | Isolate | Unclassified |
| 236 | 2925326138 | Paenibacillus hemerocallicola KCTC 33185 | Isolate | Unclassified |
| 237 | 2928093941 | Priestia aryabhattai 1389 | Isolate | Rhizosphere |
| 238 | 2928510474 | Sporosarcina psychrophila 1288 | Isolate | Rhizosphere |
| 239 | 2929004312 | Priestia megaterium 1104 | Isolate | Unclassified |
| 240 | 2929183550 | Brevibacillus sp. R-71971 Hybrid assembly | Isolate | Unclassified |
| 241 | 2929206907 | Paenibacillus sp. R-74146 Hybrid assembly | Isolate | Unclassified |
| 242 | 2929233124 | Bacillus sp. R-74298 Hybrid assembly | Isolate | Unclassified |
| 243 | 2931384279 | Paenibacillus sp. DR312 | Isolate | Rhizosphere |
| 244 | 2938649242 | Paenibacillus helianthi P26E | Isolate | Rhizosphere |
| 245 | 2938917290 | Bacillus sp. CR71 | Isolate | Unclassified |
| 246 | 2939593269 | Lysinibacillus parviboronicapiens 736 | Isolate | Rhizosphere |
| 247 | 2939679117 | Paenibacillus sp. 4624 | Isolate | Rhizosphere |
| 248 | 2945991243 | Paenibacillus sp. B21a W2I17 | Isolate | Rhizosphere |
| 249 | 2946053406 | Paenibacillus sp. W4I10 | Isolate | Rhizosphere |
| 250 | 2947426588 | Bacillus sp. RZ2MS9 | Isolate | Rhizosphere |
| 251 | 2954773129 | Bacillus sp. TBS-096 | Isolate | Rhizosphere |
| 252 | 2956897341 | Ectobacillus funiculus W18-2 | Isolate | Rhizosphere |
| 253 | 2960319331 | Priestia megaterium AFS057444 | Isolate | Unclassified |
| 254 | 2960375949 | Priestia megaterium AFS067084 | Isolate | Unclassified |
| 255 | 2962290636 | Bacillus subtilis TLO3 | Isolate | Rhizosphere |
| 256 | 2964375228 | Anaerobacillus alkaliphilus B16-10 | Isolate | Rhizosphere |
| 257 | 2965761152 | Bacillus sp. COPE52 | Isolate | Unclassified |
| 258 | 2968558590 | Paenibacillus sp. P3E | Isolate | Rhizosphere |
| 259 | 2969136845 | Bacillus subtilis TLO3 | Isolate | Rhizosphere |
| 260 | 2969141011 | Bacillus velezensis MH25 | Isolate | Unclassified |
| 261 | 2969765954 | Bacillus intestinalis GM2 | Isolate | Rhizosphere |
| 262 | 2969770375 | Bacillus subtilis GM5 | Isolate | Rhizosphere |
| 263 | 2971403814 | Paenibacillus tritici LMG 29502 | Isolate | Unclassified |
| 264 | 2971410472 | Paenibacillus oryzisoli 1ZS3-15 | Isolate | Unclassified |
| 265 | 2971893375 | Bacillus sp. HNA3 | Isolate | Rhizosphere |
| 266 | 2977254563 | Bacillus sp. SORGH_AS 510 | Isolate | Unclassified |
| 267 | 2979083700 | Bacillus toyonensis SORGH_AS 407 | Isolate | Unclassified |
| 268 | 2980125574 | Paenibacillus sp. tmac-D7 | Isolate | Unclassified |
| 269 | 2980182181 | Paenibacillus cymbidii R196 | Isolate | Unclassified |
| 270 | 2980492589 | Bacillus subtilis GQJK2 | Isolate | Rhizosphere |
| 271 | 2981284811 | Paenibacillus sp. PvR052 | Isolate | Rhizosphere |
| 272 | 2981289755 | Paenibacillus sp. PvR148 | Isolate | Rhizosphere |
| 273 | 2981980479 | Paenibacillus sp. PvR018 | Isolate | Rhizosphere |
| 274 | 2981985349 | Paenibacillus sp. PvR053 | Isolate | Rhizosphere |
| 275 | 2988225383 | Paenibacillus sp. P46E | Isolate | Rhizosphere |
| 276 | 2996632988 | Paenibacillus sp. P32E | Isolate | Rhizosphere |
| 277 | 3001267043 | Bacillus sp. FJAT-49870 | Isolate | Rhizosphere |
| 278 | 3001272096 | Lederbergia citrisecunda FJAT-49732 | Isolate | Rhizosphere |
| 279 | 3001892409 | Neobacillus rhizophilus FJAT-49825 | Isolate | Rhizosphere |
| 280 | 3006826541 | Bacillus haikouensis CrR16 | Isolate | Unclassified |
| 281 | 3006858327 | Bacillus paralicheniformis SUBG0010 | Isolate | Unclassified |
| 282 | 3006969106 | Bacillus sp. FJAT-50079 | Isolate | Rhizosphere |
| 283 | 3006973921 | Bacillus sp. FJAT-49736 | Isolate | Rhizosphere |
| 284 | 3006978542 | Bacillus sp. FJAT-49705 | Isolate | Rhizosphere |
| 285 | 3006984091 | Lederbergia citrea FJAT-49754 | Isolate | Rhizosphere |
| 286 | 3006988479 | Bacillus sp. FJAT-49711 | Isolate | Rhizosphere |
| 287 | 8002317523 | Cohnella sp. GbtcB17 | Isolate | Unclassified |
| 288 | 8022621104 | Bacillus sp. PIC28 | Isolate | Rhizosphere |
| 289 | 8022630665 | Bacillus sp. PW192 | Isolate | Rhizosphere |
| 290 | 8022653035 | Bacillus sp. Rc4 | Isolate | Unclassified |
| 291 | 8022792930 | Bacillus sp. Xin | Isolate | Rhizosphere |
| 292 | 8022893055 | Bacillus aryabhattai AFS007213 | Isolate | Unclassified |
| 293 | 8022914991 | Bacillus aryabhattai SQU-R12 | Isolate | Unclassified |
| 294 | 8022948649 | Bacillus endophyticus FH5 | Isolate | Rhizosphere |
| 295 | 8023438354 | Bacillus sp. BH2 | Isolate | Unclassified |
| 296 | 8023444577 | Bacillus sp. BH32 | Isolate | Unclassified |
| 297 | 8046991243 | Cohnella rhizosphaerae DSM 28161 | Isolate | Rhizosphere |
| 298 | 8052174270 | Bacillus velezensis CH13 | Isolate | Rhizosphere |
| 299 | 8054280661 | Metabacillus kandeliae GX 13764 | Isolate | Rhizosphere |
| 300 | 8054465665 | Paenibacillus sonchi IIRRBNF1 | Isolate | Rhizosphere |
| 301 | 8054795415 | Paenibacillus periandrae PM10 | Isolate | Nodule |
| 302 | 8055531788 | Lysinibacillus pakistanensis LY1 | Isolate | Rhizosphere |
| 303 | 8055632911 | Paenibacillus radicibacter N1-5-1-14 | Isolate | Unclassified |
| 304 | 8056533031 | Paenibacillus qinlingensis TEGT-2 | Isolate | Unclassified |
| 305 | 8057473075 | Paenibacillus endoradicis T3-5-0-4 | Isolate | Unclassified |
| 306 | 8057582654 | Bacillus arachidis YX15 | Isolate | Rhizosphere |
| 307 | 8057632132 | Cytobacillus kochii RZ2 | Isolate | Rhizosphere |
| 308 | 8057977335 | Paenibacillus oenotherae DT7-4 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 53.29 |
| Metatranscriptomes | 4.93 |
| Isolates | 41.78 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.97 |
| Nodule | 0.47 |
| Rhizoplane | 7.75 |
| Rhizosphere | 49.53 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.47 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0209371_1024082 | 3300027312 | Bacteria | 1422 |
| 2 | JGI25151J46595_10000061 | 3300003187 | Bacteria | 146828 |
| 3 | JGI25151J46595_10001316 | 3300003187 | Bacteria | 17391 |
| 4 | JGI25151J46595_10004024 | 3300003187 | Bacteria | 7892 |
| 5 | JGI25151J46595_10008736 | 3300003187 | Bacteria | 4843 |
| 6 | JGI25151J46595_10015451 | 3300003187 | Bacteria | 3362 |
| 7 | JGI25151J46595_10015657 | 3300003187 | Bacteria | 3334 |
| 8 | JGI25151J46595_10018208 | 3300003187 | Bacteria | 3025 |
| 9 | JGI25151J46595_10070962 | 3300003187 | Bacteria | 1055 |
| 10 | rootH1_10000350 | 3300003316 | Bacteria | 17202 |
| 11 | rootH2_10040044 | 3300003320 | Bacteria | 14085 |
| 12 | rootL2_10010890 | 3300003322 | Bacteria | 24266 |
| 13 | rootH1_10183510 | 3300003323 | Bacteria | 4656 |
| 14 | Ga0006562J51391_1001581 | 3300003578 | Bacteria | 1990 |
| 15 | Ga0006562J51391_1001959 | 3300003578 | Bacteria | 4264 |
| 16 | Ga0006562J51391_1001961 | 3300003578 | Bacteria | 9250 |
| 17 | Ga0055538_1000106 | 3300003751 | Bacteria | 66606 |
| 18 | Ga0055532_1002024 | 3300003758 | Bacteria | 4658 |
| 19 | Ga0055532_1003369 | 3300003758 | Bacteria | 2773 |
| 20 | Ga0055535_1006158 | 3300003761 | Bacteria | 2483 |
| 21 | Ga0055536_1010972 | 3300003781 | Bacteria | 3529 |
| 22 | Ga0055528_1002504 | 3300003790 | Bacteria | 9805 |
| 23 | Ga0055541_1001865 | 3300003841 | Bacteria | 4395 |
| 24 | Ga0055541_1003500 | 3300003841 | Bacteria | 2947 |
| 25 | Ga0065704_10114119 | 3300005289 | Bacteria | 1898 |
| 26 | Ga0070670_100098574 | 3300005331 | Bacteria | 2515 |
| 27 | Ga0070689_100429603 | 3300005340 | Bacteria | 1121 |
| 28 | Ga0070669_100264746 | 3300005353 | Bacteria | 1373 |
| 29 | Ga0070675_100054705 | 3300005354 | Bacteria | 3284 |
| 30 | Ga0070675_100210521 | 3300005354 | Bacteria | 1690 |
| 31 | Ga0070667_100204933 | 3300005367 | Bacteria | 1751 |
| 32 | Ga0070711_100141946 | 3300005439 | Bacteria | 1802 |
| 33 | Ga0070672_100320446 | 3300005543 | Bacteria | 1317 |
| 34 | Ga0070665_100141816 | 3300005548 | Bacteria | 2406 |
| 35 | Ga0068855_100005335 | 3300005563 | Bacteria | 15687 |
| 36 | Ga0068864_100118113 | 3300005618 | Bacteria | 2368 |
| 37 | Ga0068863_100065960 | 3300005841 | Bacteria | 3425 |
| 38 | Ga0105251_10007503 | 3300009011 | Bacteria | 6707 |
| 39 | Ga0105251_10014974 | 3300009011 | Bacteria | 4257 |
| 40 | Ga0105251_10038056 | 3300009011 | Bacteria | 2357 |
| 41 | Ga0105251_10047872 | 3300009011 | Bacteria | 2052 |
| 42 | Ga0105244_10011253 | 3300009036 | Bacteria | 5381 |
| 43 | Ga0105244_10018107 | 3300009036 | Bacteria | 3962 |
| 44 | Ga0105244_10018459 | 3300009036 | Bacteria | 3913 |
| 45 | Ga0105244_10022243 | 3300009036 | Bacteria | 3492 |
| 46 | Ga0105244_10074618 | 3300009036 | Bacteria | 1687 |
| 47 | Ga0105244_10229889 | 3300009036 | Bacteria | 868 |
| 48 | Ga0105250_10004149 | 3300009092 | Bacteria | 6719 |
| 49 | Ga0105250_10012762 | 3300009092 | Bacteria | 3461 |
| 50 | Ga0105250_10040276 | 3300009092 | Bacteria | 1874 |
| 51 | Ga0105245_10049070 | 3300009098 | Bacteria | 3778 |
| 52 | Ga0105247_10029585 | 3300009101 | Bacteria | 3320 |
| 53 | Ga0114129_11327764 | 3300009147 | Bacteria | 890 |
| 54 | Ga0105243_10091198 | 3300009148 | Bacteria | 2509 |
| 55 | Ga0105242_10005936 | 3300009176 | Bacteria | 9420 |
| 56 | Ga0105238_10188352 | 3300009551 | Unclassified | 2040 |
| 57 | Ga0105249_10295291 | 3300009553 | Bacteria | 1623 |
| 58 | Ga0105239_10288992 | 3300010375 | Bacteria | 1846 |
| 59 | Ga0105246_10003894 | 3300011119 | Bacteria | 9045 |
| 60 | Ga0105246_10025089 | 3300011119 | Bacteria | 3883 |
| 61 | Ga0157371_10216349 | 3300013102 | Bacteria | 1376 |
| 62 | Ga0157374_10001546 | 3300013296 | Bacteria | 19403 |
| 63 | Ga0157374_10387157 | 3300013296 | Bacteria | 1393 |
| 64 | Ga0157378_10002187 | 3300013297 | Bacteria | 17345 |
| 65 | Ga0157377_10001433 | 3300014745 | Bacteria | 10287 |
| 66 | Ga0157376_10019662 | 3300014969 | Bacteria | 5210 |
| 67 | Ga0209784_100051 | 3300025224 | Bacteria | 183666 |
| 68 | Ga0209784_100092 | 3300025224 | Bacteria | 116472 |
| 69 | Ga0209566_100130 | 3300025225 | Bacteria | 91966 |
| 70 | Ga0209566_100319 | 3300025225 | Bacteria | 43567 |
| 71 | Ga0209566_100363 | 3300025225 | Bacteria | 38102 |
| 72 | Ga0209147_100045 | 3300025229 | Bacteria | 299264 |
| 73 | Ga0209147_101279 | 3300025229 | Bacteria | 9815 |
| 74 | Ga0209147_101772 | 3300025229 | Bacteria | 6841 |
| 75 | Ga0209147_102685 | 3300025229 | Bacteria | 4106 |
| 76 | Ga0209437_100703 | 3300025233 | Bacteria | 17455 |
| 77 | Ga0209258_103931 | 3300025242 | Bacteria | 2990 |
| 78 | Ga0209673_1004297 | 3300025273 | Bacteria | 7701 |
| 79 | Ga0209673_1007022 | 3300025273 | Bacteria | 5294 |
| 80 | Ga0209130_1000355 | 3300025284 | Bacteria | 52430 |
| 81 | Ga0209130_1022437 | 3300025284 | Bacteria | 1409 |
| 82 | Ga0209130_1036888 | 3300025284 | Bacteria | 968 |
| 83 | Ga0209676_1000784 | 3300025292 | Bacteria | 42325 |
| 84 | Ga0209676_1009176 | 3300025292 | Bacteria | 4302 |
| 85 | Ga0209676_1012411 | 3300025292 | Bacteria | 3350 |
| 86 | Ga0209676_1032485 | 3300025292 | Bacteria | 1569 |
| 87 | Ga0209025_1000011 | 3300025294 | Bacteria | 976387 |
| 88 | Ga0209025_1000331 | 3300025294 | Bacteria | 104721 |
| 89 | Ga0209025_1001330 | 3300025294 | Bacteria | 33454 |
| 90 | Ga0209025_1002660 | 3300025294 | Bacteria | 18263 |
| 91 | Ga0209025_1002664 | 3300025294 | Bacteria | 18239 |
| 92 | Ga0209025_1002858 | 3300025294 | Bacteria | 17322 |
| 93 | Ga0209025_1002923 | 3300025294 | Bacteria | 17011 |
| 94 | Ga0209025_1004635 | 3300025294 | Bacteria | 11762 |
| 95 | Ga0209025_1006516 | 3300025294 | Bacteria | 9029 |
| 96 | Ga0209025_1006559 | 3300025294 | Bacteria | 8981 |
| 97 | Ga0209025_1006594 | 3300025294 | Bacteria | 8946 |
| 98 | Ga0209025_1016849 | 3300025294 | Bacteria | 4269 |
| 99 | Ga0209025_1017464 | 3300025294 | Bacteria | 4138 |
| 100 | Ga0209025_1031114 | 3300025294 | Bacteria | 2533 |
| 101 | Ga0207426_1005201 | 3300025302 | Bacteria | 6042 |
| 102 | Ga0207696_1005887 | 3300025711 | Bacteria | 5023 |
| 103 | Ga0207696_1008730 | 3300025711 | Bacteria | 3843 |
| 104 | Ga0207696_1017053 | 3300025711 | Bacteria | 2415 |
| 105 | Ga0207696_1026072 | 3300025711 | Bacteria | 1813 |
| 106 | Ga0207655_1001008 | 3300025728 | Bacteria | 28660 |
| 107 | Ga0207655_1011718 | 3300025728 | Bacteria | 5190 |
| 108 | Ga0207655_1018802 | 3300025728 | Bacteria | 3644 |
| 109 | Ga0207655_1034930 | 3300025728 | Bacteria | 2254 |
| 110 | Ga0207655_1042933 | 3300025728 | Bacteria | 1919 |
| 111 | Ga0207713_1001728 | 3300025735 | Bacteria | 16834 |
| 112 | Ga0207713_1004589 | 3300025735 | Bacteria | 8937 |
| 113 | Ga0207713_1120568 | 3300025735 | Bacteria | 880 |
| 114 | Ga0207685_10077708 | 3300025905 | Bacteria | 1364 |
| 115 | Ga0207681_10017266 | 3300025923 | Bacteria | 4530 |
| 116 | Ga0207650_10048376 | 3300025925 | Bacteria | 3136 |
| 117 | Ga0207686_10030256 | 3300025934 | Bacteria | 3204 |
| 118 | Ga0207709_10020716 | 3300025935 | Bacteria | 3713 |
| 119 | Ga0207665_10200371 | 3300025939 | Bacteria | 1454 |
| 120 | Ga0207691_10292253 | 3300025940 | Bacteria | 1401 |
| 121 | Ga0207667_10001175 | 3300025949 | Bacteria | 32903 |
| 122 | Ga0207641_10029802 | 3300026088 | Unclassified | 4513 |
| 123 | Ga0268266_10229694 | 3300028379 | Bacteria | 1709 |
| 124 | Ga0237817_10046 | 3300030083 | Bacteria | 42105 |
| 125 | Ga0237817_10084 | 3300030083 | Bacteria | 28761 |
| 126 | Ga0268256_1027324 | 3300030500 | Bacteria | 1422 |
| 127 | Ga0307408_100026135 | 3300031548 | Bacteria | 4005 |
| 128 | Ga0307407_10180823 | 3300031903 | Bacteria | 1398 |
| 129 | Ga0307416_100126107 | 3300032002 | Bacteria | 2293 |
| 130 | Ga0307416_100127392 | 3300032002 | Bacteria | 2283 |
| 131 | Ga0395899_0013860 | 3300037312 | Bacteria | 6158 |
| 132 | Ga0395899_0060153 | 3300037312 | Bacteria | 2799 |
| 133 | Ga0395899_0498242 | 3300037312 | Bacteria | 790 |
| 134 | Ga0237819_00023 | 3300038705 | Bacteria | 52093 |
| 135 | Ga0237819_02748 | 3300038705 | Bacteria | 3385 |
| 136 | Ga0439439_0001727 | 3300041406 | Bacteria | 4454 |
| 137 | Ga0439433_0012022 | 3300041999 | Bacteria | 1897 |
| 138 | Ga0439449_0011028 | 3300042007 | Bacteria | 3408 |
| 139 | Ga0450903_021389 | 3300042138 | Bacteria | 1000 |
| 140 | Ga0466969_0002580 | 3300044656 | Bacteria | 9676 |
| 141 | Ga0466966_0046106 | 3300044684 | Bacteria | 2785 |
| 142 | Ga0466961_0054842 | 3300044693 | Bacteria | 2542 |
| 143 | Ga0466959_0003973 | 3300045049 | Bacteria | 9831 |
| 144 | Ga0451576_0235514 | 3300045051 | Bacteria | 1912 |
| 145 | Ga0466967_0000081 | 3300045976 | Bacteria | 34669 |
| 146 | Ga0466967_1058737 | 3300045976 | Bacteria | 808 |
| 147 | Ga0495627_048531 | 3300046453 | Bacteria | 1284 |
| 148 | Ga0495603_0027784 | 3300046455 | Bacteria | 3412 |
| 149 | Ga0495590_0074077 | 3300046457 | Bacteria | 1197 |
| 150 | Ga0495606_0092143 | 3300046507 | Bacteria | 1862 |
| 151 | Ga0495661_0022465 | 3300046665 | Bacteria | 4104 |
| 152 | Ga0495661_0123793 | 3300046665 | Bacteria | 1424 |
| 153 | Ga0495661_0141067 | 3300046665 | Bacteria | 1311 |
| 154 | Ga0495670_0123194 | 3300046691 | Bacteria | 1348 |
| 155 | Ga0495670_0197126 | 3300046691 | Bacteria | 1066 |
| 156 | Ga0495589_0062243 | 3300046794 | Bacteria | 1831 |
| 157 | Ga0495589_0229467 | 3300046794 | Bacteria | 871 |
| 158 | Ga0495660_0067302 | 3300046810 | Bacteria | 1908 |
| 159 | Ga0495660_0111123 | 3300046810 | Bacteria | 1398 |
| 160 | Ga0495683_0069876 | 3300047323 | Bacteria | 1725 |
| 161 | Ga0496100_0000595 | 3300048903 | Bacteria | 17071 |
| 162 | Ga0496100_0001375 | 3300048903 | Bacteria | 11916 |
| 163 | Ga0496101_0000506 | 3300048904 | Bacteria | 24503 |
| 164 | Ga0496101_0000959 | 3300048904 | Bacteria | 17029 |
| 165 | Ga0496101_0126650 | 3300048904 | Bacteria | 1936 |
| 166 | Ga0496102_0003257 | 3300048905 | Bacteria | 13770 |
| 167 | Ga0496102_0022236 | 3300048905 | Bacteria | 5617 |
| 168 | Ga0496103_0000741 | 3300048906 | Bacteria | 24067 |
| 169 | Ga0496103_0019707 | 3300048906 | Bacteria | 4048 |
| 170 | Ga0496104_0001102 | 3300048907 | Bacteria | 23106 |
| 171 | Ga0496104_0001346 | 3300048907 | Bacteria | 21272 |
| 172 | Ga0496105_0004994 | 3300048908 | Bacteria | 10040 |
| 173 | Ga0496105_0009758 | 3300048908 | Bacteria | 7518 |
| 174 | Ga0496106_0008997 | 3300048909 | Bacteria | 7380 |
| 175 | Ga0496107_0000306 | 3300048910 | Bacteria | 26247 |
| 176 | Ga0496107_0000471 | 3300048910 | Bacteria | 22095 |
| 177 | Ga0496108_0002954 | 3300048911 | Bacteria | 13670 |
| 178 | Ga0496108_0046358 | 3300048911 | Bacteria | 3632 |
| 179 | Ga0496109_0001301 | 3300048912 | Bacteria | 20661 |
| 180 | Ga0496109_0001532 | 3300048912 | Bacteria | 19232 |
| 181 | Ga0496110_0001021 | 3300048913 | Bacteria | 19714 |
| 182 | Ga0496110_0002559 | 3300048913 | Bacteria | 13670 |
| 183 | Ga0496110_0072656 | 3300048913 | Bacteria | 3053 |
| 184 | Ga0496111_0000702 | 3300048914 | Bacteria | 17720 |
| 185 | Ga0496111_0001455 | 3300048914 | Bacteria | 13533 |
| 186 | Ga0496111_0002682 | 3300048914 | Bacteria | 10810 |
| 187 | Ga0496112_0000548 | 3300048915 | Bacteria | 25751 |
| 188 | Ga0496112_0005699 | 3300048915 | Bacteria | 10816 |
| 189 | Ga0496113_0001054 | 3300048916 | Bacteria | 14888 |
| 190 | Ga0496113_0072975 | 3300048916 | Bacteria | 2613 |
| 191 | Ga0496116_0000782 | 3300048919 | Bacteria | 40453 |
| 192 | Ga0496116_0001854 | 3300048919 | Bacteria | 22868 |
| 193 | Ga0496116_0018155 | 3300048919 | Bacteria | 5432 |
| 194 | Ga0496116_0024794 | 3300048919 | Bacteria | 4424 |
| 195 | Ga0496116_0172792 | 3300048919 | Bacteria | 1169 |
| 196 | Ga0496116_0179859 | 3300048919 | Bacteria | 1134 |
| 197 | Ga0496117_0023767 | 3300048920 | Bacteria | 4871 |
| 198 | Ga0496117_0050995 | 3300048920 | Bacteria | 2930 |
| 199 | Ga0496118_0071259 | 3300048921 | Bacteria | 2503 |
| 200 | Ga0496118_0364446 | 3300048921 | Bacteria | 765 |
| 201 | Ga0496119_0002406 | 3300048922 | Bacteria | 20551 |
| 202 | Ga0496119_0002498 | 3300048922 | Bacteria | 20103 |
| 203 | Ga0496119_0017774 | 3300048922 | Bacteria | 5331 |
| 204 | Ga0496120_0000212 | 3300048923 | Bacteria | 99961 |
| 205 | Ga0496121_0132258 | 3300048924 | Bacteria | 1865 |
| 206 | Ga0496122_0002204 | 3300048925 | Bacteria | 28441 |
| 207 | Ga0496122_0005811 | 3300048925 | Bacteria | 14503 |
| 208 | Ga0496122_0008160 | 3300048925 | Bacteria | 11387 |
| 209 | Ga0496122_0015508 | 3300048925 | Bacteria | 7280 |
| 210 | Ga0496122_0016083 | 3300048925 | Bacteria | 7109 |
| 211 | Ga0496122_0040062 | 3300048925 | Bacteria | 3729 |
| 212 | Ga0496122_0065888 | 3300048925 | Bacteria | 2622 |
| 213 | Ga0496123_0004407 | 3300048926 | Bacteria | 14836 |
| 214 | Ga0496123_0065897 | 3300048926 | Bacteria | 2298 |
| 215 | Ga0496124_0000170 | 3300048927 | Bacteria | 131603 |
| 216 | Ga0496124_0000998 | 3300048927 | Bacteria | 44860 |
| 217 | Ga0496124_0039112 | 3300048927 | Bacteria | 4114 |
| 218 | Ga0496124_0052629 | 3300048927 | Bacteria | 3458 |
| 219 | Ga0496125_0000620 | 3300048928 | Bacteria | 59641 |
| 220 | Ga0496125_0022744 | 3300048928 | Bacteria | 5811 |
| 221 | Ga0496125_0360791 | 3300048928 | Bacteria | 864 |
| 222 | Ga0496126_0002583 | 3300048929 | Bacteria | 24153 |
| 223 | Ga0496126_0003050 | 3300048929 | Bacteria | 21710 |
| 224 | Ga0496126_0031727 | 3300048929 | Bacteria | 4986 |
| 225 | Ga0496126_0091826 | 3300048929 | Bacteria | 2669 |
| 226 | Ga0496126_0314851 | 3300048929 | Bacteria | 1288 |
| 227 | Ga0501344_03586 | 3300049133 | Bacteria | 832 |
| 228 | Ga0501305_006849 | 3300049161 | Bacteria | 1428 |
| 229 | Ga0501305_023795 | 3300049161 | Bacteria | 919 |
| 230 | Ga0501312_036858 | 3300049528 | Bacteria | 787 |
| 231 | Ga0501315_009996 | 3300049531 | Bacteria | 1131 |
| 232 | Ga0501315_024623 | 3300049531 | Bacteria | 834 |
| 233 | Ga0501316_021557 | 3300049532 | Bacteria | 815 |
| 234 | Ga0501316_023393 | 3300049532 | Bacteria | 793 |
| 235 | Ga0501317_004117 | 3300049533 | Bacteria | 1495 |
| 236 | Ga0501317_016051 | 3300049533 | Bacteria | 967 |
| 237 | Ga0501317_019113 | 3300049533 | Bacteria | 912 |
| 238 | Ga0501318_022845 | 3300049534 | Bacteria | 805 |
| 239 | Ga0501320_018887 | 3300049536 | Bacteria | 782 |
| 240 | Ga0501321_012567 | 3300049537 | Bacteria | 960 |
| 241 | Ga0501326_03874 | 3300049542 | Bacteria | 780 |
| 242 | Ga0501334_05782 | 3300049550 | Bacteria | 822 |
| 243 | Ga0501335_009140 | 3300049551 | Bacteria | 941 |
| 244 | Ga0501337_005193 | 3300049553 | Bacteria | 868 |
| 245 | Ga0501208_037019 | 3300049655 | Bacteria | 888 |
| 246 | Ga0501217_005344 | 3300049661 | Bacteria | 2682 |
| 247 | Ga0501217_013735 | 3300049661 | Bacteria | 1820 |
| 248 | Ga0501234_014562 | 3300049707 | Bacteria | 1236 |
| 249 | 2511180221 | 2510917027 | Bacteria | 5287437 |
| 250 | 2511701491 | 2511231119 | Bacteria | 4019861 |
| 251 | 2512635564 | 2512564013 | Bacteria | 6286191 |
| 252 | 2512730639 | 2512564039 | Bacteria | 8739048 |
| 253 | 2524191849 | 2524023129 | Bacteria | 6762600 |
| 254 | 2540608693 | 2540341094 | Bacteria | 4061186 |
| 255 | 2545557795 | 2545555800 | Bacteria | 4222588 |
| 256 | 2550903784 | 2548877040 | Bacteria | 7507281 |
| 257 | 2555468647 | 2554235283 | Bacteria | 3683090 |
| 258 | 2563928553 | 2563366752 | Bacteria | 4961801 |
| 259 | 2571532043 | 2571042143 | Bacteria | 6986194 |
| 260 | 2578932185 | 2576861599 | Bacteria | 4217202 |
| 261 | 2587745326 | 2585428059 | Bacteria | 8696589 |
| 262 | 2595319580 | 2593339198 | Bacteria | 7267884 |
| 263 | 2600199953 | 2599185353 | Bacteria | 2219443 |
| 264 | 2600402287 | 2600254943 | Bacteria | 2613887 |
| 265 | 2601640729 | 2600255286 | Bacteria | 5390125 |
| 266 | 2631983341 | 2630968484 | Bacteria | 3876276 |
| 267 | 2643740919 | 2643221543 | Bacteria | 6628015 |
| 268 | 2644428126 | 2643221676 | Bacteria | 8119172 |
| 269 | 2644702507 | 2643221729 | Bacteria | 6621700 |
| 270 | 2644715137 | 2643221730 | Bacteria | 6523787 |
| 271 | 2644720488 | 2643221731 | Bacteria | 5623886 |
| 272 | 2644726427 | 2643221732 | Bacteria | 5756404 |
| 273 | 2644738560 | 2643221735 | Bacteria | 3676263 |
| 274 | 2651531092 | 2648501850 | Bacteria | 3975476 |
| 275 | 2672338701 | 2671180330 | Bacteria | 5521719 |
| 276 | 2673818112 | 2671180694 | Bacteria | 7506943 |
| 277 | 2674421569 | 2671180844 | Bacteria | 4164150 |
| 278 | 2685153345 | 2684622632 | Bacteria | 5380049 |
| 279 | 2686998788 | 2684623153 | Bacteria | 3878815 |
| 280 | 2687500080 | 2687453109 | Bacteria | 3860091 |
| 281 | 2695629448 | 2695420354 | Bacteria | 3922431 |
| 282 | 2698319843 | 2695420987 | Bacteria | 6152737 |
| 283 | 2705997258 | 2703719227 | Bacteria | 5631989 |
| 284 | 2717914860 | 2716884898 | Bacteria | 3928789 |
| 285 | 2721508507 | 2718218445 | Bacteria | 5113413 |
| 286 | 2728532150 | 2728368933 | Bacteria | 7044283 |
| 287 | 2738813599 | 2738541295 | Bacteria | 5730091 |
| 288 | 2738839172 | 2738541299 | Bacteria | 4020721 |
| 289 | 2739156852 | 2738541358 | Bacteria | 5932299 |
| 290 | 2739209398 | 2738543006 | Bacteria | 5904091 |
| 291 | 2739232324 | 2738543010 | Bacteria | 5583595 |
| 292 | 2745170069 | 2744054657 | Bacteria | 5016802 |
| 293 | 2791211821 | 2788500588 | Bacteria | 4584915 |
| 294 | 2793185140 | 2791355222 | Bacteria | 5898266 |
| 295 | 2808870766 | 2808606364 | Bacteria | 4465927 |
| 296 | 2809053832 | 2808606399 | Bacteria | 4021018 |
| 297 | 2812313970 | 2811994870 | Bacteria | 3776934 |
| 298 | 2816865375 | 2816332186 | Bacteria | 5331395 |
| 299 | 2817482076 | 2816332295 | Bacteria | 4352468 |
| 300 | 2817620441 | 2816332336 | Bacteria | 5207640 |
| 301 | 2819567414 | 2818991441 | Bacteria | 5062707 |
| 302 | 2819583685 | 2818991443 | Bacteria | 6598732 |
| 303 | 2819626633 | 2818991451 | Bacteria | 4697364 |
| 304 | 2819674858 | 2818991459 | Bacteria | 8736032 |
| 305 | 2819711011 | 2818991465 | Bacteria | 5388835 |
| 306 | 2819722992 | 2818991468 | Bacteria | 3723169 |
| 307 | 2821117353 | 2821111986 | Bacteria | 6894338 |
| 308 | 2823530022 | 2823526263 | Bacteria | 3765752 |
| 309 | 2842687553 | 2842682962 | Bacteria | 5589973 |
| 310 | 2842886428 | 2842882022 | Bacteria | 6158489 |
| 311 | 2849142964 | 2849139964 | Bacteria | 5613304 |
| 312 | 2852674201 | 2852673933 | Bacteria | 3347676 |
| 313 | 2857458011 | 2857453340 | Bacteria | 8090534 |
| 314 | 2857461888 | 2857460504 | Bacteria | 5194327 |
| 315 | 2857469227 | 2857465823 | Bacteria | 6772595 |
| 316 | 2857475977 | 2857472729 | Bacteria | 6568124 |
| 317 | 2857583163 | 2857581216 | Bacteria | 5522813 |
| 318 | 2857595389 | 2857591370 | Bacteria | 6569758 |
| 319 | 2857609132 | 2857604169 | Bacteria | 5111450 |
| 320 | 2857610331 | 2857609550 | Bacteria | 3753890 |
| 321 | 2860841510 | 2860837431 | Bacteria | 4202080 |
| 322 | 2864735604 | 2864733723 | Bacteria | 6770668 |
| 323 | 2865001291 | 2864997549 | Bacteria | 5139696 |
| 324 | 2877772375 | 2877768649 | Bacteria | 3957164 |
| 325 | 2880173224 | 2880169592 | Bacteria | 3900066 |
| 326 | 2881646069 | 2881644220 | Bacteria | 5302661 |
| 327 | 2885533034 | 2885526491 | Bacteria | 7164189 |
| 328 | 2888580573 | 2888578766 | Bacteria | 6743310 |
| 329 | 2889047625 | 2889042446 | Bacteria | 7618936 |
| 330 | 2889050773 | 2889049205 | Bacteria | 7524325 |
| 331 | 2889300501 | 2889295896 | Bacteria | 4704906 |
| 332 | 2898908495 | 2898907183 | Bacteria | 4067722 |
| 333 | 2904116608 | 2904113452 | Bacteria | 7796941 |
| 334 | 2904162426 | 2904162308 | Bacteria | 7086713 |
| 335 | 2904495583 | 2904490793 | Bacteria | 7046938 |
| 336 | 2904528841 | 2904524088 | Bacteria | 5887454 |
| 337 | 2904561819 | 2904560550 | Bacteria | 4029838 |
| 338 | 2904608956 | 2904606771 | Bacteria | 4684500 |
| 339 | 2904759379 | 2904755435 | Bacteria | 7986759 |
| 340 | 2908667255 | 2908665501 | Bacteria | 3678115 |
| 341 | 2915603303 | 2915597211 | Bacteria | 6475886 |
| 342 | 2915610179 | 2915606848 | Bacteria | 6032732 |
| 343 | 2916976226 | 2916971899 | Bacteria | 4250608 |
| 344 | 2919094729 | 2919093281 | Bacteria | 3660974 |
| 345 | 2919148471 | 2919143609 | Bacteria | 6219228 |
| 346 | 2919164532 | 2919160200 | Bacteria | 6929020 |
| 347 | 2919416126 | 2919414237 | Bacteria | 5429133 |
| 348 | 2919418150 | 2919414237 | Bacteria | 5429133 |
| 349 | 2919428599 | 2919425241 | Bacteria | 8055701 |
| 350 | 2919521760 | 2919517244 | Bacteria | 5858162 |
| 351 | 2919724890 | 2919720352 | Bacteria | 5986006 |
| 352 | 2919727293 | 2919726948 | Bacteria | 3696050 |
| 353 | 2925328839 | 2925326138 | Bacteria | 9652120 |
| 354 | 2928098183 | 2928093941 | Bacteria | 5965005 |
| 355 | 2928510843 | 2928510474 | Bacteria | 4815308 |
| 356 | 2929007617 | 2929004312 | Bacteria | 5678476 |
| 357 | 2929188381 | 2929183550 | Bacteria | 6377511 |
| 358 | 2929211113 | 2929206907 | Bacteria | 5918291 |
| 359 | 2929239055 | 2929233124 | Bacteria | 5948380 |
| 360 | 2931384676 | 2931384279 | Bacteria | 7299545 |
| 361 | 2938652873 | 2938649242 | Bacteria | 7118381 |
| 362 | 2938923280 | 2938917290 | Bacteria | 5914775 |
| 363 | 2939597791 | 2939593269 | Bacteria | 4798695 |
| 364 | 2939683949 | 2939679117 | Bacteria | 6921672 |
| 365 | 2945996668 | 2945991243 | Bacteria | 7008369 |
| 366 | 2946059346 | 2946053406 | Bacteria | 6978655 |
| 367 | 2947432149 | 2947426588 | Bacteria | 5357194 |
| 368 | 2954776567 | 2954773129 | Bacteria | 3741715 |
| 369 | 2956902317 | 2956897341 | Bacteria | 5447711 |
| 370 | 2960321410 | 2960319331 | Bacteria | 5502575 |
| 371 | 2960378356 | 2960375949 | Bacteria | 5361395 |
| 372 | 2962294748 | 2962290636 | Bacteria | 4072939 |
| 373 | 2964375460 | 2964375228 | Bacteria | 4909004 |
| 374 | 2965766674 | 2965761152 | Bacteria | 5806513 |
| 375 | 2968563657 | 2968558590 | Bacteria | 6956864 |
| 376 | 2969140671 | 2969136845 | Bacteria | 3923176 |
| 377 | 2969144942 | 2969141011 | Bacteria | 4118468 |
| 378 | 2969768502 | 2969765954 | Bacteria | 4216713 |
| 379 | 2969770852 | 2969770375 | Bacteria | 4271280 |
| 380 | 2971408795 | 2971403814 | Bacteria | 7370929 |
| 381 | 2971413488 | 2971410472 | Bacteria | 8311090 |
| 382 | 2971897066 | 2971893375 | Bacteria | 3929648 |
| 383 | 2977254967 | 2977254563 | Bacteria | 4828420 |
| 384 | 2979089035 | 2979083700 | Bacteria | 5894929 |
| 385 | 2980126820 | 2980125574 | Bacteria | 5567337 |
| 386 | 2980185939 | 2980182181 | Bacteria | 9454109 |
| 387 | 2980496515 | 2980492589 | Bacteria | 4072961 |
| 388 | 2981287584 | 2981284811 | Bacteria | 4641497 |
| 389 | 2981292779 | 2981289755 | Bacteria | 4641509 |
| 390 | 2981983007 | 2981980479 | Bacteria | 4641628 |
| 391 | 2981987917 | 2981985349 | Bacteria | 4641497 |
| 392 | 2988226001 | 2988225383 | Bacteria | 7221625 |
| 393 | 2996637647 | 2996632988 | Bacteria | 6921523 |
| 394 | 3001269721 | 3001267043 | Bacteria | 4823521 |
| 395 | 3001275067 | 3001272096 | Bacteria | 4729684 |
| 396 | 3001894426 | 3001892409 | Bacteria | 6328293 |
| 397 | 3006826613 | 3006826541 | Bacteria | 4678913 |
| 398 | 3006862505 | 3006858327 | Bacteria | 4317835 |
| 399 | 3006969530 | 3006969106 | Bacteria | 4739423 |
| 400 | 3006977986 | 3006973921 | Bacteria | 4423788 |
| 401 | 3006978905 | 3006978542 | Bacteria | 5328100 |
| 402 | 3006980421 | 3006978542 | Bacteria | 5328100 |
| 403 | 3006986481 | 3006984091 | Bacteria | 4207523 |
| 404 | 3006990802 | 3006988479 | Bacteria | 4767936 |
| 405 | 8002324341 | 8002317523 | Bacteria | 8051857 |
| 406 | 8022626869 | 8022621104 | Bacteria | 5241040 |
| 407 | 8022632593 | 8022630665 | Bacteria | 3886130 |
| 408 | 8022655563 | 8022653035 | Bacteria | 4035078 |
| 409 | 8022793670 | 8022792930 | Bacteria | 5693794 |
| 410 | 8022894458 | 8022893055 | Bacteria | 5300455 |
| 411 | 8022918430 | 8022914991 | Bacteria | 5584517 |
| 412 | 8022954064 | 8022948649 | Bacteria | 5366783 |
| 413 | 8023441528 | 8023438354 | Bacteria | 5779374 |
| 414 | 8023449049 | 8023444577 | Bacteria | 5661597 |
| 415 | 8046995581 | 8046991243 | Bacteria | 8497463 |
| 416 | 8052175917 | 8052174270 | Bacteria | 3881265 |
| 417 | 8054283823 | 8054280661 | Bacteria | 4232245 |
| 418 | 8054470714 | 8054465665 | Bacteria | 7323556 |
| 419 | 8054797977 | 8054795415 | Bacteria | 9785225 |
| 420 | 8055532408 | 8055531788 | Bacteria | 5249694 |
| 421 | 8055633443 | 8055632911 | Bacteria | 5283357 |
| 422 | 8056535764 | 8056533031 | Bacteria | 8964429 |
| 423 | 8057477368 | 8057473075 | Bacteria | 5892720 |
| 424 | 8057587802 | 8057582654 | Bacteria | 5218944 |
| 425 | 8057636719 | 8057632132 | Bacteria | 4726859 |
| 426 | 8057978064 | 8057977335 | Bacteria | 5694872 |
| 427 | Ga0209371_1024082 | |||
| 428 | JGI25151J46595_10000061 | |||
| 429 | JGI25151J46595_10001316 | |||
| 430 | JGI25151J46595_10004024 | |||
| 431 | JGI25151J46595_10008736 | |||
| 432 | JGI25151J46595_10015451 | |||
| 433 | JGI25151J46595_10015657 | |||
| 434 | JGI25151J46595_10018208 | |||
| 435 | JGI25151J46595_10070962 | |||
| 436 | rootH1_10000350 | |||
| 437 | rootH2_10040044 | |||
| 438 | rootL2_10010890 | |||
| 439 | rootH1_10183510 | |||
| 440 | Ga0006562J51391_1001581 | |||
| 441 | Ga0006562J51391_1001959 | |||
| 442 | Ga0006562J51391_1001961 | |||
| 443 | Ga0055538_1000106 | |||
| 444 | Ga0055532_1002024 | |||
| 445 | Ga0055532_1003369 | |||
| 446 | Ga0055535_1006158 | |||
| 447 | Ga0055536_1010972 | |||
| 448 | Ga0055528_1002504 | |||
| 449 | Ga0055541_1001865 | |||
| 450 | Ga0055541_1003500 | |||
| 451 | Ga0065704_10114119 | |||
| 452 | Ga0070670_100098574 | |||
| 453 | Ga0070689_100429603 | |||
| 454 | Ga0070669_100264746 | |||
| 455 | Ga0070675_100054705 | |||
| 456 | Ga0070675_100210521 | |||
| 457 | Ga0070667_100204933 | |||
| 458 | Ga0070711_100141946 | |||
| 459 | Ga0070672_100320446 | |||
| 460 | Ga0070665_100141816 | |||
| 461 | Ga0068855_100005335 | |||
| 462 | Ga0068864_100118113 | |||
| 463 | Ga0068863_100065960 | |||
| 464 | Ga0105251_10007503 | |||
| 465 | Ga0105251_10014974 | |||
| 466 | Ga0105251_10038056 | |||
| 467 | Ga0105251_10047872 | |||
| 468 | Ga0105244_10011253 | |||
| 469 | Ga0105244_10018107 | |||
| 470 | Ga0105244_10018459 | |||
| 471 | Ga0105244_10022243 | |||
| 472 | Ga0105244_10074618 | |||
| 473 | Ga0105244_10229889 | |||
| 474 | Ga0105250_10004149 | |||
| 475 | Ga0105250_10012762 | |||
| 476 | Ga0105250_10040276 | |||
| 477 | Ga0105245_10049070 | |||
| 478 | Ga0105247_10029585 | |||
| 479 | Ga0114129_11327764 | |||
| 480 | Ga0105243_10091198 | |||
| 481 | Ga0105242_10005936 | |||
| 482 | Ga0105238_10188352 | |||
| 483 | Ga0105249_10295291 | |||
| 484 | Ga0105239_10288992 | |||
| 485 | Ga0105246_10003894 | |||
| 486 | Ga0105246_10025089 | |||
| 487 | Ga0157371_10216349 | |||
| 488 | Ga0157374_10001546 | |||
| 489 | Ga0157374_10387157 | |||
| 490 | Ga0157378_10002187 | |||
| 491 | Ga0157377_10001433 | |||
| 492 | Ga0157376_10019662 | |||
| 493 | Ga0209784_100051 | |||
| 494 | Ga0209784_100092 | |||
| 495 | Ga0209566_100130 | |||
| 496 | Ga0209566_100319 | |||
| 497 | Ga0209566_100363 | |||
| 498 | Ga0209147_100045 | |||
| 499 | Ga0209147_101279 | |||
| 500 | Ga0209147_101772 | |||
| 501 | Ga0209147_102685 | |||
| 502 | Ga0209437_100703 | |||
| 503 | Ga0209258_103931 | |||
| 504 | Ga0209673_1004297 | |||
| 505 | Ga0209673_1007022 | |||
| 506 | Ga0209130_1000355 | |||
| 507 | Ga0209130_1022437 | |||
| 508 | Ga0209130_1036888 | |||
| 509 | Ga0209676_1000784 | |||
| 510 | Ga0209676_1009176 | |||
| 511 | Ga0209676_1012411 | |||
| 512 | Ga0209676_1032485 | |||
| 513 | Ga0209025_1000011 | |||
| 514 | Ga0209025_1000331 | |||
| 515 | Ga0209025_1001330 | |||
| 516 | Ga0209025_1002660 | |||
| 517 | Ga0209025_1002664 | |||
| 518 | Ga0209025_1002858 | |||
| 519 | Ga0209025_1002923 | |||
| 520 | Ga0209025_1004635 | |||
| 521 | Ga0209025_1006516 | |||
| 522 | Ga0209025_1006559 | |||
| 523 | Ga0209025_1006594 | |||
| 524 | Ga0209025_1016849 | |||
| 525 | Ga0209025_1017464 | |||
| 526 | Ga0209025_1031114 | |||
| 527 | Ga0207426_1005201 | |||
| 528 | Ga0207696_1005887 | |||
| 529 | Ga0207696_1008730 | |||
| 530 | Ga0207696_1017053 | |||
| 531 | Ga0207696_1026072 | |||
| 532 | Ga0207655_1001008 | |||
| 533 | Ga0207655_1011718 | |||
| 534 | Ga0207655_1018802 | |||
| 535 | Ga0207655_1034930 | |||
| 536 | Ga0207655_1042933 | |||
| 537 | Ga0207713_1001728 | |||
| 538 | Ga0207713_1004589 | |||
| 539 | Ga0207713_1120568 | |||
| 540 | Ga0207685_10077708 | |||
| 541 | Ga0207681_10017266 | |||
| 542 | Ga0207650_10048376 | |||
| 543 | Ga0207686_10030256 | |||
| 544 | Ga0207709_10020716 | |||
| 545 | Ga0207665_10200371 | |||
| 546 | Ga0207691_10292253 | |||
| 547 | Ga0207667_10001175 | |||
| 548 | Ga0207641_10029802 | |||
| 549 | Ga0268266_10229694 | |||
| 550 | Ga0237817_10046 | |||
| 551 | Ga0237817_10084 | |||
| 552 | Ga0268256_1027324 | |||
| 553 | Ga0307408_100026135 | |||
| 554 | Ga0307407_10180823 | |||
| 555 | Ga0307416_100126107 | |||
| 556 | Ga0307416_100127392 | |||
| 557 | Ga0395899_0013860 | |||
| 558 | Ga0395899_0060153 | |||
| 559 | Ga0395899_0498242 | |||
| 560 | Ga0237819_00023 | |||
| 561 | Ga0237819_02748 | |||
| 562 | Ga0439439_0001727 | |||
| 563 | Ga0439433_0012022 | |||
| 564 | Ga0439449_0011028 | |||
| 565 | Ga0450903_021389 | |||
| 566 | Ga0466969_0002580 | |||
| 567 | Ga0466966_0046106 | |||
| 568 | Ga0466961_0054842 | |||
| 569 | Ga0466959_0003973 | |||
| 570 | Ga0451576_0235514 | |||
| 571 | Ga0466967_0000081 | |||
| 572 | Ga0466967_1058737 | |||
| 573 | Ga0495627_048531 | |||
| 574 | Ga0495603_0027784 | |||
| 575 | Ga0495590_0074077 | |||
| 576 | Ga0495606_0092143 | |||
| 577 | Ga0495661_0022465 | |||
| 578 | Ga0495661_0123793 | |||
| 579 | Ga0495661_0141067 | |||
| 580 | Ga0495670_0123194 | |||
| 581 | Ga0495670_0197126 | |||
| 582 | Ga0495589_0062243 | |||
| 583 | Ga0495589_0229467 | |||
| 584 | Ga0495660_0067302 | |||
| 585 | Ga0495660_0111123 | |||
| 586 | Ga0495683_0069876 | |||
| 587 | Ga0496100_0000595 | |||
| 588 | Ga0496100_0001375 | |||
| 589 | Ga0496101_0000506 | |||
| 590 | Ga0496101_0000959 | |||
| 591 | Ga0496101_0126650 | |||
| 592 | Ga0496102_0003257 | |||
| 593 | Ga0496102_0022236 | |||
| 594 | Ga0496103_0000741 | |||
| 595 | Ga0496103_0019707 | |||
| 596 | Ga0496104_0001102 | |||
| 597 | Ga0496104_0001346 | |||
| 598 | Ga0496105_0004994 | |||
| 599 | Ga0496105_0009758 | |||
| 600 | Ga0496106_0008997 | |||
| 601 | Ga0496107_0000306 | |||
| 602 | Ga0496107_0000471 | |||
| 603 | Ga0496108_0002954 | |||
| 604 | Ga0496108_0046358 | |||
| 605 | Ga0496109_0001301 | |||
| 606 | Ga0496109_0001532 | |||
| 607 | Ga0496110_0001021 | |||
| 608 | Ga0496110_0002559 | |||
| 609 | Ga0496110_0072656 | |||
| 610 | Ga0496111_0000702 | |||
| 611 | Ga0496111_0001455 | |||
| 612 | Ga0496111_0002682 | |||
| 613 | Ga0496112_0000548 | |||
| 614 | Ga0496112_0005699 | |||
| 615 | Ga0496113_0001054 | |||
| 616 | Ga0496113_0072975 | |||
| 617 | Ga0496116_0000782 | |||
| 618 | Ga0496116_0001854 | |||
| 619 | Ga0496116_0018155 | |||
| 620 | Ga0496116_0024794 | |||
| 621 | Ga0496116_0172792 | |||
| 622 | Ga0496116_0179859 | |||
| 623 | Ga0496117_0023767 | |||
| 624 | Ga0496117_0050995 | |||
| 625 | Ga0496118_0071259 | |||
| 626 | Ga0496118_0364446 | |||
| 627 | Ga0496119_0002406 | |||
| 628 | Ga0496119_0002498 | |||
| 629 | Ga0496119_0017774 | |||
| 630 | Ga0496120_0000212 | |||
| 631 | Ga0496121_0132258 | |||
| 632 | Ga0496122_0002204 | |||
| 633 | Ga0496122_0005811 | |||
| 634 | Ga0496122_0008160 | |||
| 635 | Ga0496122_0015508 | |||
| 636 | Ga0496122_0016083 | |||
| 637 | Ga0496122_0040062 | |||
| 638 | Ga0496122_0065888 | |||
| 639 | Ga0496123_0004407 | |||
| 640 | Ga0496123_0065897 | |||
| 641 | Ga0496124_0000170 | |||
| 642 | Ga0496124_0000998 | |||
| 643 | Ga0496124_0039112 | |||
| 644 | Ga0496124_0052629 | |||
| 645 | Ga0496125_0000620 | |||
| 646 | Ga0496125_0022744 | |||
| 647 | Ga0496125_0360791 | |||
| 648 | Ga0496126_0002583 | |||
| 649 | Ga0496126_0003050 | |||
| 650 | Ga0496126_0031727 | |||
| 651 | Ga0496126_0091826 | |||
| 652 | Ga0496126_0314851 | |||
| 653 | Ga0501344_03586 | |||
| 654 | Ga0501305_006849 | |||
| 655 | Ga0501305_023795 | |||
| 656 | Ga0501312_036858 | |||
| 657 | Ga0501315_009996 | |||
| 658 | Ga0501315_024623 | |||
| 659 | Ga0501316_021557 | |||
| 660 | Ga0501316_023393 | |||
| 661 | Ga0501317_004117 | |||
| 662 | Ga0501317_016051 | |||
| 663 | Ga0501317_019113 | |||
| 664 | Ga0501318_022845 | |||
| 665 | Ga0501320_018887 | |||
| 666 | Ga0501321_012567 | |||
| 667 | Ga0501326_03874 | |||
| 668 | Ga0501334_05782 | |||
| 669 | Ga0501335_009140 | |||
| 670 | Ga0501337_005193 | |||
| 671 | Ga0501208_037019 | |||
| 672 | Ga0501217_005344 | |||
| 673 | Ga0501217_013735 | |||
| 674 | Ga0501234_014562 | |||
| 675 | 2511180221 | |||
| 676 | 2511701491 | |||
| 677 | 2512635564 | |||
| 678 | 2512730639 | |||
| 679 | 2524191849 | |||
| 680 | 2540608693 | |||
| 681 | 2545557795 | |||
| 682 | 2550903784 | |||
| 683 | 2555468647 | |||
| 684 | 2563928553 | |||
| 685 | 2571532043 | |||
| 686 | 2578932185 | |||
| 687 | 2587745326 | |||
| 688 | 2595319580 | |||
| 689 | 2600199953 | |||
| 690 | 2600402287 | |||
| 691 | 2601640729 | |||
| 692 | 2631983341 | |||
| 693 | 2643740919 | |||
| 694 | 2644428126 | |||
| 695 | 2644702507 | |||
| 696 | 2644715137 | |||
| 697 | 2644720488 | |||
| 698 | 2644726427 | |||
| 699 | 2644738560 | |||
| 700 | 2651531092 | |||
| 701 | 2672338701 | |||
| 702 | 2673818112 | |||
| 703 | 2674421569 | |||
| 704 | 2685153345 | |||
| 705 | 2686998788 | |||
| 706 | 2687500080 | |||
| 707 | 2695629448 | |||
| 708 | 2698319843 | |||
| 709 | 2705997258 | |||
| 710 | 2717914860 | |||
| 711 | 2721508507 | |||
| 712 | 2728532150 | |||
| 713 | 2738813599 | |||
| 714 | 2738839172 | |||
| 715 | 2739156852 | |||
| 716 | 2739209398 | |||
| 717 | 2739232324 | |||
| 718 | 2745170069 | |||
| 719 | 2791211821 | |||
| 720 | 2793185140 | |||
| 721 | 2808870766 | |||
| 722 | 2809053832 | |||
| 723 | 2812313970 | |||
| 724 | 2816865375 | |||
| 725 | 2817482076 | |||
| 726 | 2817620441 | |||
| 727 | 2819567414 | |||
| 728 | 2819583685 | |||
| 729 | 2819626633 | |||
| 730 | 2819674858 | |||
| 731 | 2819711011 | |||
| 732 | 2819722992 | |||
| 733 | 2821117353 | |||
| 734 | 2823530022 | |||
| 735 | 2842687553 | |||
| 736 | 2842886428 | |||
| 737 | 2849142964 | |||
| 738 | 2852674201 | |||
| 739 | 2857458011 | |||
| 740 | 2857461888 | |||
| 741 | 2857469227 | |||
| 742 | 2857475977 | |||
| 743 | 2857583163 | |||
| 744 | 2857595389 | |||
| 745 | 2857609132 | |||
| 746 | 2857610331 | |||
| 747 | 2860841510 | |||
| 748 | 2864735604 | |||
| 749 | 2865001291 | |||
| 750 | 2877772375 | |||
| 751 | 2880173224 | |||
| 752 | 2881646069 | |||
| 753 | 2885533034 | |||
| 754 | 2888580573 | |||
| 755 | 2889047625 | |||
| 756 | 2889050773 | |||
| 757 | 2889300501 | |||
| 758 | 2898908495 | |||
| 759 | 2904116608 | |||
| 760 | 2904162426 | |||
| 761 | 2904495583 | |||
| 762 | 2904528841 | |||
| 763 | 2904561819 | |||
| 764 | 2904608956 | |||
| 765 | 2904759379 | |||
| 766 | 2908667255 | |||
| 767 | 2915603303 | |||
| 768 | 2915610179 | |||
| 769 | 2916976226 | |||
| 770 | 2919094729 | |||
| 771 | 2919148471 | |||
| 772 | 2919164532 | |||
| 773 | 2919416126 | |||
| 774 | 2919418150 | |||
| 775 | 2919428599 | |||
| 776 | 2919521760 | |||
| 777 | 2919724890 | |||
| 778 | 2919727293 | |||
| 779 | 2925328839 | |||
| 780 | 2928098183 | |||
| 781 | 2928510843 | |||
| 782 | 2929007617 | |||
| 783 | 2929188381 | |||
| 784 | 2929211113 | |||
| 785 | 2929239055 | |||
| 786 | 2931384676 | |||
| 787 | 2938652873 | |||
| 788 | 2938923280 | |||
| 789 | 2939597791 | |||
| 790 | 2939683949 | |||
| 791 | 2945996668 | |||
| 792 | 2946059346 | |||
| 793 | 2947432149 | |||
| 794 | 2954776567 | |||
| 795 | 2956902317 | |||
| 796 | 2960321410 | |||
| 797 | 2960378356 | |||
| 798 | 2962294748 | |||
| 799 | 2964375460 | |||
| 800 | 2965766674 | |||
| 801 | 2968563657 | |||
| 802 | 2969140671 | |||
| 803 | 2969144942 | |||
| 804 | 2969768502 | |||
| 805 | 2969770852 | |||
| 806 | 2971408795 | |||
| 807 | 2971413488 | |||
| 808 | 2971897066 | |||
| 809 | 2977254967 | |||
| 810 | 2979089035 | |||
| 811 | 2980126820 | |||
| 812 | 2980185939 | |||
| 813 | 2980496515 | |||
| 814 | 2981287584 | |||
| 815 | 2981292779 | |||
| 816 | 2981983007 | |||
| 817 | 2981987917 | |||
| 818 | 2988226001 | |||
| 819 | 2996637647 | |||
| 820 | 3001269721 | |||
| 821 | 3001275067 | |||
| 822 | 3001894426 | |||
| 823 | 3006826613 | |||
| 824 | 3006862505 | |||
| 825 | 3006969530 | |||
| 826 | 3006977986 | |||
| 827 | 3006978905 | |||
| 828 | 3006980421 | |||
| 829 | 3006986481 | |||
| 830 | 3006990802 | |||
| 831 | 8002324341 | |||
| 832 | 8022626869 | |||
| 833 | 8022632593 | |||
| 834 | 8022655563 | |||
| 835 | 8022793670 | |||
| 836 | 8022894458 | |||
| 837 | 8022918430 | |||
| 838 | 8022954064 | |||
| 839 | 8023441528 | |||
| 840 | 8023449049 | |||
| 841 | 8046995581 | |||
| 842 | 8052175917 | |||
| 843 | 8054283823 | |||
| 844 | 8054470714 | |||
| 845 | 8054797977 | |||
| 846 | 8055532408 | |||
| 847 | 8055633443 | |||
| 848 | 8056535764 | |||
| 849 | 8057477368 | |||
| 850 | 8057587802 | |||
| 851 | 8057636719 | |||
| 852 | 8057978064 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5t2k-assembly1.cif.gz_B | geobacillus stearothermophilus hemq with manganese-coproporphyrin iii | 0.9907 | 9 | 256 |
| 5loq-assembly1.cif.gz_C | structure of coproheme bound hemq from listeria monocytogenes | 0.9905 | 9 | 256 |
| 5t2k-assembly1.cif.gz_E | geobacillus stearothermophilus hemq with manganese-coproporphyrin iii | 0.9901 | 9 | 256 |
| 6fxj-assembly1.cif.gz_B | structure of coproheme decarboxylase from listeria monocytogenes in complex with iron coproporphyrin iii | 0.9894 | 9 | 256 |
| 5loq-assembly1.cif.gz_E | structure of coproheme bound hemq from listeria monocytogenes | 0.9891 | 12 | 256 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5loqB02 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Apc35880; domain 1 | 0.9922 | 147 | 256 | 3.30.70.1030 |
| af_Q2G0J1_1_118_3.30.70.1030 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Apc35880; domain 1 | 0.992 | 9 | 122 | 3.30.70.1030 |
| 5loqE01 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Apc35880; domain 1 | 0.9854 | 12 | 144 | 3.30.70.1030 |
| 5loqB02 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Apc35880; domain 1 | 0.9746 | 147 | 256 | 3.30.70.1030 |
| 5loqE01 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Apc35880; domain 1 | 0.9699 | 12 | 144 | 3.30.70.1030 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5C8MQY7-F1-model_v4 | Heme-dependent peroxidase | 0.9945 | 146 | 256 |
GO:0004601
GO:0020037 GO:0046872 |
| AF-A0A2S6DJ08-F1-model_v4 | deleted | 0.993 | 54 | 216 |
|
| AF-W4QCL1-F1-model_v4 | Hemoprotein HemQ | 0.993 | 176 | 255 |
GO:0016491
GO:0020037 GO:0046872 |
| AF-A0A7M2QR76-F1-model_v4 | Coproheme decarboxylase (Coproheme III oxidative decarboxylase) (Hydrogen peroxide-dependent heme synthase) | 0.9913 | 9 | 256 |
GO:0004601
GO:0006783 GO:0020037 GO:0046872 |
| AF-A0A3A0UU01-F1-model_v4 | Heme-dependent peroxidase | 0.9913 | 163 | 256 |
GO:0004601
GO:0020037 GO:0046872 |