F440944

General Info

Members Datasets Scaffolds Average Seq Length
425 217 850 84

Family's Representative Sequence

Representative Sequence 3300005843|Ga0068860_102546362|Ga0068860_1025463621
Length 104
Sequence MQPTSPTSDLRPPRVWHHNGMRTTIDKAGRVVIPASIRERAGLSPGAELEVTEDELGVRLKRVAAGPRLVKVGRRLVARPTVHAESRPAIDIAALVEDERNRWP

Samples

Sample ID Description Type Environment
1 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
128 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
129 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
130 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
131 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
132 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
133 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
134 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
135 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
136 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
137 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
138 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
139 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
140 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
141 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
142 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
143 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
144 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
145 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
146 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
147 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
148 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
149 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
150 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
151 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
152 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
153 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
154 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
155 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
156 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
157 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
158 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
159 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
160 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
161 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
162 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
163 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
164 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
165 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
166 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
167 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
168 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
169 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
170 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
171 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
172 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
173 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
174 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
175 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
176 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
177 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
190 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
191 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
192 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
193 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
194 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
195 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
196 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
197 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
198 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
199 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
200 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
201 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
202 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
204 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
205 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
206 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
207 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
208 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
209 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
210 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
211 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
212 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
213 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
214 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
215 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
216 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
217 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.76
Metatranscriptomes 0.24
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.94
Rhizosphere 99.06
Stem 0
Stem Tuber 0
Unclassified 30.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068860_102546362 3300005843 Bacteria 531
2 Ga0065715_10124085 3300005293 Unclassified 2163
3 Ga0070670_100012671 3300005331 Bacteria 7218
4 Ga0070670_100938510 3300005331 Bacteria 785
5 Ga0070677_10093057 3300005333 Bacteria 1315
6 Ga0068869_100028942 3300005334 Bacteria 3875
7 Ga0068869_101481913 3300005334 Unclassified 602
8 Ga0070666_10148567 3300005335 Bacteria 1634
9 Ga0070666_10193064 3300005335 Bacteria 1431
10 Ga0070666_10284204 3300005335 Unclassified 1176
11 Ga0070666_11103133 3300005335 Unclassified 590
12 Ga0068868_100062925 3300005338 Bacteria 2943
13 Ga0070660_100297335 3300005339 Unclassified 1323
14 Ga0070660_100413796 3300005339 Unclassified 1116
15 Ga0070689_100715184 3300005340 Unclassified 875
16 Ga0070687_100150998 3300005343 Bacteria 1364
17 Ga0070661_101051289 3300005344 Unclassified 677
18 Ga0070692_10281505 3300005345 Bacteria 1008
19 Ga0070668_100440938 3300005347 Unclassified 1118
20 Ga0070669_100045300 3300005353 Bacteria 3205
21 Ga0070669_101729449 3300005353 Unclassified 545
22 Ga0070675_100237775 3300005354 Unclassified 1591
23 Ga0070671_100024333 3300005355 Bacteria 4956
24 Ga0070671_100307420 3300005355 Bacteria 1350
25 Ga0070674_100002824 3300005356 Bacteria 9604
26 Ga0070673_100038561 3300005364 Bacteria 3649
27 Ga0070673_100846836 3300005364 Unclassified 846
28 Ga0070673_100990678 3300005364 Unclassified 782
29 Ga0070688_100157694 3300005365 Bacteria 1557
30 Ga0070667_100269278 3300005367 Unclassified 1527
31 Ga0070703_10191323 3300005406 Bacteria 797
32 Ga0070709_10019555 3300005434 Bacteria 3917
33 Ga0070709_10856879 3300005434 Bacteria 716
34 Ga0070713_100170840 3300005436 Bacteria 1948
35 Ga0070701_10028064 3300005438 Bacteria 2764
36 Ga0070701_10172107 3300005438 Bacteria 1262
37 Ga0070705_100232367 3300005440 Bacteria 1284
38 Ga0070705_100675070 3300005440 Bacteria 809
39 Ga0070700_100159592 3300005441 Bacteria 1551
40 Ga0070700_100338771 3300005441 Unclassified 1111
41 Ga0070681_10237317 3300005458 Bacteria 1737
42 Ga0068867_100145835 3300005459 Bacteria 1855
43 Ga0070707_100204803 3300005468 Bacteria 1923
44 Ga0070707_101454130 3300005468 Unclassified 652
45 Ga0070707_101503357 3300005468 Unclassified 640
46 Ga0070698_100000549 3300005471 Bacteria 40084
47 Ga0070698_100326978 3300005471 Bacteria 1464
48 Ga0070698_101287918 3300005471 Unclassified 681
49 Ga0070699_100002456 3300005518 Bacteria 16663
50 Ga0070699_100025347 3300005518 Bacteria 5114
51 Ga0070699_100761358 3300005518 Unclassified 886
52 Ga0070699_101373902 3300005518 Unclassified 648
53 Ga0070699_101970203 3300005518 Bacteria 534
54 Ga0070684_100303961 3300005535 Bacteria 1464
55 Ga0070684_100867626 3300005535 Unclassified 845
56 Ga0070697_100016591 3300005536 Bacteria 5794
57 Ga0070697_100554314 3300005536 Bacteria 1008
58 Ga0070697_100897433 3300005536 Bacteria 786
59 Ga0068853_101823880 3300005539 Bacteria 590
60 Ga0070672_100004683 3300005543 Bacteria 8969
61 Ga0070686_100771984 3300005544 Bacteria 772
62 Ga0070686_100883329 3300005544 Bacteria 726
63 Ga0070695_100000451 3300005545 Bacteria 21392
64 Ga0070695_100029703 3300005545 Plasmid 3398
65 Ga0070695_100037685 3300005545 Bacteria 3048
66 Ga0070695_100055550 3300005545 Bacteria 2552
67 Ga0070695_101544797 3300005545 Bacteria 553
68 Ga0070696_100030608 3300005546 Plasmid 3686
69 Ga0070696_100032253 3300005546 Bacteria 3594
70 Ga0070696_100143452 3300005546 Unclassified 1747
71 Ga0070696_100149486 3300005546 Bacteria 1713
72 Ga0070696_100298424 3300005546 Unclassified 1233
73 Ga0070696_100370458 3300005546 Bacteria 1114
74 Ga0070665_100025154 3300005548 Bacteria 5999
75 Ga0070704_100008310 3300005549 Bacteria 6218
76 Ga0070704_100046923 3300005549 Bacteria 3016
77 Ga0070704_100261288 3300005549 Bacteria 1426
78 Ga0070704_101655979 3300005549 Bacteria 591
79 Ga0070664_100167406 3300005564 Bacteria 1948
80 Ga0070664_100536621 3300005564 Bacteria 1081
81 Ga0070664_102094072 3300005564 Bacteria 537
82 Ga0068854_100950708 3300005578 Bacteria 758
83 Ga0068856_100086547 3300005614 Bacteria 3114
84 Ga0070702_100252858 3300005615 Unclassified 1195
85 Ga0070702_100286843 3300005615 Bacteria 1132
86 Ga0070702_100354405 3300005615 Bacteria 1035
87 Ga0068852_100061196 3300005616 Bacteria 3271
88 Ga0068859_100222857 3300005617 Bacteria 1974
89 Ga0068859_100449478 3300005617 Unclassified 1385
90 Ga0068859_101803267 3300005617 Bacteria 676
91 Ga0068859_102217955 3300005617 Unclassified 606
92 Ga0068864_100002895 3300005618 Bacteria 14184
93 Ga0068864_100025702 3300005618 Bacteria 4962
94 Ga0068864_100179099 3300005618 Bacteria 1937
95 Ga0068866_10016325 3300005718 Bacteria 3318
96 Ga0068866_10034046 3300005718 Bacteria 2478
97 Ga0068851_10080801 3300005834 Unclassified 1697
98 Ga0068851_10336491 3300005834 Unclassified 875
99 Ga0068870_10547859 3300005840 Bacteria 778
100 Ga0068863_101898127 3300005841 Bacteria 606
101 Ga0068858_100018182 3300005842 Bacteria 6583
102 Ga0068860_100025269 3300005843 Bacteria 5732
103 Ga0068860_100252858 3300005843 Bacteria 1717
104 Ga0068860_100938551 3300005843 Unclassified 882
105 Ga0068862_100075090 3300005844 Bacteria 2923
106 Ga0068862_100097141 3300005844 Bacteria 2571
107 Ga0068862_100323350 3300005844 Bacteria 1424
108 Ga0068862_100679089 3300005844 Bacteria 996
109 Ga0068862_101822091 3300005844 Bacteria 618
110 Ga0081455_10045128 3300005937 Bacteria 3837
111 Ga0081539_10008089 3300005985 Bacteria 9303
112 Ga0070717_11205421 3300006028 Bacteria 689
113 Ga0097621_100003748 3300006237 Bacteria 10531
114 Ga0068871_100010556 3300006358 Bacteria 6746
115 Ga0068871_101300548 3300006358 Bacteria 684
116 Ga0075428_100010406 3300006844 Bacteria 10329
117 Ga0075428_101299120 3300006844 Bacteria 765
118 Ga0075433_10000708 3300006852 Bacteria 22771
119 Ga0075433_10244626 3300006852 Unclassified 1592
120 Ga0075433_10341918 3300006852 Bacteria 1323
121 Ga0075433_11582058 3300006852 Bacteria 565
122 Ga0075433_11633855 3300006852 Bacteria 555
123 Ga0075434_100002442 3300006871 Bacteria 16355
124 Ga0075434_100154501 3300006871 Bacteria 2314
125 Ga0075434_101910465 3300006871 Bacteria 599
126 Ga0075434_102361943 3300006871 Unclassified 534
127 Ga0075429_100454392 3300006880 Bacteria 1122
128 Ga0068865_100002511 3300006881 Bacteria 10856
129 Ga0068865_100458771 3300006881 Unclassified 1055
130 Ga0068865_100731456 3300006881 Bacteria 848
131 Ga0075436_100273143 3300006914 Bacteria 1207
132 Ga0075436_100429333 3300006914 Bacteria 960
133 Ga0097620_100222852 3300006931 Bacteria 1974
134 Ga0097620_100449439 3300006931 Unclassified 1385
135 Ga0097620_101803476 3300006931 Bacteria 676
136 Ga0097620_102217321 3300006931 Unclassified 606
137 Ga0075435_100002619 3300007076 Bacteria 11989
138 Ga0075435_100060445 3300007076 Bacteria 3072
139 Ga0075435_100126196 3300007076 Bacteria 2139
140 Ga0075435_100627080 3300007076 Unclassified 933
141 Ga0075435_101208717 3300007076 Bacteria 661
142 Ga0105240_11089497 3300009093 Bacteria 850
143 Ga0111539_10048145 3300009094 Bacteria 5091
144 Ga0111539_10542543 3300009094 Bacteria 1355
145 Ga0111539_11338207 3300009094 Unclassified 831
146 Ga0111539_12260085 3300009094 Bacteria 631
147 Ga0105245_10021384 3300009098 Bacteria 5674
148 Ga0105245_10031303 3300009098 Bacteria 4708
149 Ga0105247_10001119 3300009101 Bacteria 19989
150 Ga0114129_10006554 3300009147 Bacteria 16521
151 Ga0114129_10009633 3300009147 Bacteria 13783
152 Ga0114129_10014145 3300009147 Bacteria 11369
153 Ga0114129_10079264 3300009147 Bacteria 4567
154 Ga0114129_10254133 3300009147 Unclassified 2358
155 Ga0114129_10916121 3300009147 Bacteria 1110
156 Ga0114129_11166495 3300009147 Bacteria 961
157 Ga0105243_10119848 3300009148 Bacteria 2216
158 Ga0105243_10408024 3300009148 Bacteria 1264
159 Ga0105243_11801723 3300009148 Bacteria 643
160 Ga0105243_12531651 3300009148 Unclassified 552
161 Ga0105243_13005513 3300009148 Unclassified 511
162 Ga0105241_10057507 3300009174 Bacteria 2984
163 Ga0105242_10013752 3300009176 Bacteria 6263
164 Ga0105242_10151230 3300009176 Bacteria 2024
165 Ga0105242_10416947 3300009176 Unclassified 1257
166 Ga0105248_10002081 3300009177 Bacteria 22128
167 Ga0105248_12145362 3300009177 Bacteria 636
168 Ga0105248_12703206 3300009177 Unclassified 566
169 Ga0105248_12708390 3300009177 Bacteria 565
170 Ga0105248_13036367 3300009177 Unclassified 534
171 Ga0105238_10151051 3300009551 Bacteria 2298
172 Ga0105238_11362602 3300009551 Unclassified 736
173 Ga0105238_12953802 3300009551 Unclassified 511
174 Ga0105249_10428874 3300009553 Unclassified 1357
175 Ga0105249_10522614 3300009553 Bacteria 1234
176 Ga0105239_10500896 3300010375 Bacteria 1381
177 Ga0157370_10849916 3300013104 Unclassified 829
178 Ga0157369_10633120 3300013105 Unclassified 1103
179 Ga0157378_10439360 3300013297 Unclassified 1293
180 Ga0157378_11217313 3300013297 Unclassified 793
181 Ga0163162_11127681 3300013306 Unclassified 889
182 Ga0157372_11490153 3300013307 Bacteria 779
183 Ga0157375_11268571 3300013308 Unclassified 865
184 Ga0157375_13009310 3300013308 Bacteria 563
185 Ga0163163_10014771 3300014325 Bacteria 7186
186 Ga0163163_10466907 3300014325 Bacteria 1323
187 Ga0163163_11040152 3300014325 Bacteria 882
188 Ga0163163_11215327 3300014325 Unclassified 816
189 Ga0163163_11654057 3300014325 Unclassified 701
190 Ga0157380_10502785 3300014326 Unclassified 1178
191 Ga0157380_10630061 3300014326 Unclassified 1066
192 Ga0157380_11589611 3300014326 Bacteria 709
193 Ga0157377_10146131 3300014745 Unclassified 1458
194 Ga0157376_10167917 3300014969 Bacteria 1995
195 Ga0206356_10627622 3300020070 Bacteria 1515
196 Ga0207642_10033397 3300025899 Bacteria 2177
197 Ga0207710_10014691 3300025900 Bacteria 3305
198 Ga0207680_10191294 3300025903 Bacteria 1389
199 Ga0207680_10907511 3300025903 Unclassified 631
200 Ga0207680_11247960 3300025903 Unclassified 529
201 Ga0207699_10013522 3300025906 Bacteria 4182
202 Ga0207660_11603046 3300025917 Unclassified 525
203 Ga0207657_10400132 3300025919 Unclassified 1080
204 Ga0207646_10045079 3300025922 Bacteria 3958
205 Ga0207646_11536431 3300025922 Unclassified 576
206 Ga0207694_10947252 3300025924 Unclassified 728
207 Ga0207694_11825029 3300025924 Unclassified 511
208 Ga0207650_10008258 3300025925 Bacteria 7107
209 Ga0207650_10750440 3300025925 Bacteria 826
210 Ga0207659_10213998 3300025926 Bacteria 1546
211 Ga0207687_10065045 3300025927 Bacteria 2589
212 Ga0207687_10712981 3300025927 Unclassified 852
213 Ga0207700_10020049 3300025928 Bacteria 4531
214 Ga0207690_11226541 3300025932 Unclassified 626
215 Ga0207706_10029501 3300025933 Bacteria 4897
216 Ga0207686_10851571 3300025934 Unclassified 733
217 Ga0207686_10996303 3300025934 Unclassified 680
218 Ga0207686_11273120 3300025934 Unclassified 603
219 Ga0207709_10275814 3300025935 Bacteria 1240
220 Ga0207669_10395051 3300025937 Unclassified 1081
221 Ga0207669_10424037 3300025937 Unclassified 1048
222 Ga0207669_10835173 3300025937 Unclassified 766
223 Ga0207704_10173610 3300025938 Bacteria 1549
224 Ga0207704_10188502 3300025938 Bacteria 1498
225 Ga0207704_10684215 3300025938 Bacteria 848
226 Ga0207691_10024959 3300025940 Bacteria 5617
227 Ga0207711_10207529 3300025941 Bacteria 1789
228 Ga0207711_10453387 3300025941 Bacteria 1194
229 Ga0207689_11078277 3300025942 Unclassified 677
230 Ga0207679_10092439 3300025945 Unclassified 2344
231 Ga0207679_10208059 3300025945 Bacteria 1639
232 Ga0207651_10758430 3300025960 Bacteria 858
233 Ga0207712_10086121 3300025961 Unclassified 2301
234 Ga0207712_10437149 3300025961 Bacteria 1107
235 Ga0207712_11100126 3300025961 Unclassified 707
236 Ga0207668_10429153 3300025972 Unclassified 1123
237 Ga0207640_11564512 3300025981 Bacteria 593
238 Ga0207703_10157225 3300026035 Bacteria 1988
239 Ga0207703_10284001 3300026035 Unclassified 1504
240 Ga0207703_12313470 3300026035 Unclassified 513
241 Ga0207639_10184460 3300026041 Unclassified 1777
242 Ga0207708_10129375 3300026075 Bacteria 1973
243 Ga0207708_10201992 3300026075 Unclassified 1586
244 Ga0207641_10620556 3300026088 Unclassified 1060
245 Ga0207648_10403500 3300026089 Unclassified 1239
246 Ga0207676_10006988 3300026095 Bacteria 8001
247 Ga0207676_10510891 3300026095 Bacteria 1142
248 Ga0207676_10514208 3300026095 Bacteria 1139
249 Ga0209971_1035849 3300027682 Bacteria 1193
250 Ga0207428_10001229 3300027907 Bacteria 27466
251 Ga0207428_10668999 3300027907 Bacteria 744
252 Ga0207428_10752303 3300027907 Unclassified 695
253 Ga0268266_10138892 3300028379 Bacteria 2179
254 Ga0268266_11428773 3300028379 Bacteria 667
255 Ga0268265_10435242 3300028380 Unclassified 1221
256 Ga0268265_11190220 3300028380 Bacteria 759
257 Ga0268264_10242618 3300028381 Bacteria 1670
258 Ga0307406_11706367 3300031901 Bacteria 558
259 Ga0307416_102508324 3300032002 Bacteria 614
260 Ga0373926_0049681 3300035083 Unclassified 1511
261 Ga0373944_0106632 3300035089 Bacteria 952
262 Ga0373956_0597621 3300035119 Unclassified 527
263 Ga0373943_0185479 3300035170 Bacteria 1145
264 Ga0373955_0303804 3300035172 Bacteria 962
265 Ga0373955_0726740 3300035172 Unclassified 610
266 Ga0373935_0254078 3300035692 Bacteria 1231
267 Ga0373933_0013664 3300035724 Bacteria 4503
268 Ga0373947_0297092 3300035725 Unclassified 1076
269 Ga0373937_0001867 3300036401 Bacteria 17709
270 Ga0373925_0105516 3300037068 Bacteria 2171
271 Ga0373925_0276741 3300037068 Bacteria 1351
272 Ga0395898_1208906 3300037466 Bacteria 687
273 Ga0395905_1172360 3300037471 Bacteria 672
274 Ga0439453_0074418 3300041408 Bacteria 723
275 Ga0439448_0271100 3300042005 Unclassified 601
276 Ga0450917_016416 3300042120 Bacteria 632
277 Ga0450898_144680 3300042134 Unclassified 518
278 Ga0439435_0003514 3300042436 Bacteria 3271
279 Ga0439435_0026176 3300042436 Bacteria 1551
280 Ga0439444_0072160 3300042437 Bacteria 741
281 Ga0439460_0117018 3300042461 Bacteria 869
282 Ga0451576_0424765 3300045051 Bacteria 1395
283 Ga0466967_0575562 3300045976 Bacteria 1110
284 Ga0495603_0110355 3300046455 Unclassified 1605
285 Ga0495629_0267360 3300046459 Bacteria 1175
286 Ga0495653_0526895 3300046463 Bacteria 734
287 Ga0495584_0101401 3300046491 Bacteria 1455
288 Ga0495628_0875132 3300046516 Unclassified 625
289 Ga0495630_1331618 3300046517 Unclassified 541
290 Ga0495652_0655822 3300046529 Bacteria 710
291 Ga0495586_0153326 3300046535 Bacteria 1297
292 Ga0495609_0118449 3300046538 Bacteria 1140
293 Ga0495621_0019244 3300046539 Bacteria 2228
294 Ga0495621_0030185 3300046539 Unclassified 1852
295 Ga0495621_0052711 3300046539 Unclassified 1459
296 Ga0495597_0073836 3300046542 Bacteria 1466
297 Ga0495597_0277760 3300046542 Bacteria 653
298 Ga0495667_0109900 3300046559 Bacteria 1781
299 Ga0495611_0520002 3300046648 Unclassified 540
300 Ga0495659_0039158 3300046664 Unclassified 1685
301 Ga0495659_0074207 3300046664 Bacteria 1279
302 Ga0495659_0084001 3300046664 Bacteria 1213
303 Ga0495659_0219970 3300046664 Unclassified 784
304 Ga0495659_0252782 3300046664 Unclassified 735
305 Ga0495647_0038016 3300046681 Unclassified 1819
306 Ga0495658_0288792 3300046683 Bacteria 1036
307 Ga0495669_0067750 3300046684 Bacteria 1623
308 Ga0495613_0234096 3300046689 Bacteria 1286
309 Ga0495600_0675261 3300046809 Unclassified 623
310 Ga0495581_0096554 3300047315 Bacteria 1716
311 Ga0495636_0603073 3300047318 Unclassified 537
312 Ga0495674_0492512 3300047319 Bacteria 981
313 Ga0495675_0391213 3300047444 Bacteria 812
314 Ga0496104_0793745 3300048907 Bacteria 853
315 Ga0496112_0932036 3300048915 Bacteria 790
316 Ga0496113_0505518 3300048916 Unclassified 970
317 Ga0496114_0046181 3300048917 Bacteria 3619
318 Ga0501031_0273618 3300049568 Bacteria 1096
319 Ga0501031_0772813 3300049568 Unclassified 616
320 Ga0501032_0256545 3300049569 Bacteria 1134
321 Ga0501032_0373761 3300049569 Bacteria 917
322 Ga0501034_1238937 3300049571 Bacteria 624
323 Ga0501036_0076135 3300049572 Bacteria 2839
324 Ga0501036_0104136 3300049572 Bacteria 2400
325 Ga0501037_1073064 3300049573 Bacteria 522
326 Ga0501039_0133158 3300049575 Bacteria 1951
327 Ga0501039_0187457 3300049575 Unclassified 1627
328 Ga0501040_0049464 3300049576 Bacteria 2874
329 Ga0501040_0370404 3300049576 Bacteria 1027
330 Ga0501040_0716818 3300049576 Unclassified 723
331 Ga0501040_0822792 3300049576 Unclassified 672
332 Ga0501041_0238923 3300049577 Bacteria 1141
333 Ga0501041_0515519 3300049577 Unclassified 761
334 Ga0501042_0135989 3300049578 Bacteria 1772
335 Ga0501042_0256073 3300049578 Bacteria 1263
336 Ga0501042_0319981 3300049578 Unclassified 1121
337 Ga0501042_0389077 3300049578 Bacteria 1010
338 Ga0501043_0522617 3300049579 Unclassified 884
339 Ga0501043_1142319 3300049579 Bacteria 549
340 Ga0501046_0342658 3300049580 Bacteria 1086
341 Ga0501046_0559081 3300049580 Unclassified 815
342 Ga0501048_0930709 3300049582 Unclassified 625
343 Ga0501048_1028737 3300049582 Unclassified 592
344 Ga0501067_0690057 3300049583 Bacteria 574
345 Ga0501069_0717529 3300049585 Unclassified 604
346 Ga0501071_0212144 3300049587 Bacteria 1456
347 Ga0501071_0248123 3300049587 Bacteria 1343
348 Ga0501071_0354181 3300049587 Archaea 1117
349 Ga0501071_0862861 3300049587 Bacteria 698
350 Ga0501072_0016396 3300049588 Bacteria 5687
351 Ga0501072_0057064 3300049588 Unclassified 3077
352 Ga0501072_0178195 3300049588 Bacteria 1695
353 Ga0501073_0480657 3300049589 Bacteria 859
354 Ga0501074_0267000 3300049590 Bacteria 1216
355 Ga0501075_0021597 3300049591 Unclassified 4694
356 Ga0501075_0033728 3300049591 Bacteria 3809
357 Ga0501075_0178487 3300049591 Unclassified 1620
358 Ga0501075_1070578 3300049591 Unclassified 612
359 Ga0501076_0012837 3300049592 Bacteria 6269
360 Ga0501076_0013409 3300049592 Bacteria 6146
361 Ga0501076_0016436 3300049592 Bacteria 5611
362 Ga0501076_0037302 3300049592 Bacteria 3811
363 Ga0501076_1030780 3300049592 Bacteria 678
364 Ga0501077_0002664 3300049593 Bacteria 10705
365 Ga0501077_0732782 3300049593 Bacteria 635
366 Ga0501079_0019472 3300049741 Bacteria 5184
367 Ga0501079_0037325 3300049741 Bacteria 3745
368 Ga0501079_0058574 3300049741 Bacteria 2972
369 Ga0501079_0180195 3300049741 Bacteria 1648
370 Ga0501079_0528617 3300049741 Bacteria 927
371 Ga0501080_0134847 3300049742 Unclassified 2285
372 Ga0501080_1398012 3300049742 Bacteria 597
373 Ga0501080_1889908 3300049742 Bacteria 500
374 Ga0501081_0102626 3300049743 Bacteria 2023
375 Ga0501081_0731778 3300049743 Bacteria 743
376 Ga0501083_0119010 3300049744 Bacteria 1733
377 Ga0501083_0126962 3300049744 Bacteria 1672
378 Ga0501083_0625333 3300049744 Unclassified 700
379 Ga0501035_0857664 3300049822 Bacteria 722
380 Ga0501035_1387993 3300049822 Bacteria 539
381 Ga0501045_0009966 3300049824 Bacteria 6647
382 Ga0501045_0020563 3300049824 Bacteria 4717
383 Ga0501045_0088206 3300049824 Bacteria 2291
384 nmdc:mga05p37_1554319_c1 3300050507 Bacteria 655
385 nmdc:mga05p37_1742_c1 3300050507 Bacteria 25391
386 nmdc:mga05p37_281460_c1 3300050507 Unclassified 1983
387 nmdc:mga05p37_285399_c1 3300050507 Bacteria 1967
388 nmdc:mga05p37_403192_c1 3300050507 Bacteria 1596
389 nmdc:mga05p37_46581_c1 3300050507 Bacteria 5331
390 nmdc:mga05p37_498264_c1 3300050507 Unclassified 1399
391 nmdc:mga05p37_637709_c1 3300050507 Bacteria 1196
392 nmdc:mga05p37_94222_c1 3300050507 Bacteria 3690
393 nmdc:mga09592_276469_c1 3300050508 Bacteria 1457
394 nmdc:mga0qj67_214004_c1 3300050509 Bacteria 1565
395 nmdc:mga06r32_208599_c1 3300050510 Bacteria 1942
396 nmdc:mga08y16_2008386_c1 3300050511 Bacteria 527
397 nmdc:mga08y16_600_c1 3300050511 Bacteria 33622
398 nmdc:mga08y16_67410_c1 3300050511 Bacteria 3733
399 nmdc:mga0n895_77896_c1 3300050512 Unclassified 3298
400 nmdc:mga0rr50_132778_c1 3300050513 Bacteria 1995
401 nmdc:mga0rr50_139670_c1 3300050513 Bacteria 1948
402 nmdc:mga0rr50_7629_c1 3300050513 Bacteria 6689
403 nmdc:mga0rr50_764554_c1 3300050513 Unclassified 824
404 nmdc:mga08x19_294400_c1 3300050514 Bacteria 1127
405 nmdc:mga08x19_586443_c1 3300050514 Bacteria 790
406 nmdc:mga0a205_175750_c1 3300050515 Unclassified 2037
407 nmdc:mga0a205_3683_c1 3300050515 Bacteria 13719
408 nmdc:mga0a205_382002_c1 3300050515 Bacteria 1274
409 nmdc:mga0a205_422882_c1 3300050515 Bacteria 1194
410 nmdc:mga0a205_96316_c1 3300050515 Bacteria 2858
411 Ga0495601_0140041 3300053077 Bacteria 1578
412 Ga0495619_0095248 3300053085 Bacteria 2020
413 Ga0495619_0275537 3300053085 Bacteria 1166
414 Ga0501084_0012166 3300054114 Bacteria 7123
415 Ga0501084_0061088 3300054114 Bacteria 3155
416 Ga0501084_1514661 3300054114 Unclassified 561
417 Ga0501082_0026892 3300060353 Bacteria 4957
418 Ga0501082_0031494 3300060353 Bacteria 4574
419 Ga0501082_0444821 3300060353 Unclassified 1132
420 Ga0501082_0725375 3300060353 Unclassified 870
421 Ga0501082_1546266 3300060353 Bacteria 579
422 Ga0530510_0059122 3300061734 Bacteria 2773
423 Ga0530510_0191982 3300061734 Bacteria 1516
424 Ga0530510_0581655 3300061734 Bacteria 851
425 Ga0530510_0593734 3300061734 Bacteria 842
426 Ga0068860_102546362
427 Ga0065715_10124085
428 Ga0070670_100012671
429 Ga0070670_100938510
430 Ga0070677_10093057
431 Ga0068869_100028942
432 Ga0068869_101481913
433 Ga0070666_10148567
434 Ga0070666_10193064
435 Ga0070666_10284204
436 Ga0070666_11103133
437 Ga0068868_100062925
438 Ga0070660_100297335
439 Ga0070660_100413796
440 Ga0070689_100715184
441 Ga0070687_100150998
442 Ga0070661_101051289
443 Ga0070692_10281505
444 Ga0070668_100440938
445 Ga0070669_100045300
446 Ga0070669_101729449
447 Ga0070675_100237775
448 Ga0070671_100024333
449 Ga0070671_100307420
450 Ga0070674_100002824
451 Ga0070673_100038561
452 Ga0070673_100846836
453 Ga0070673_100990678
454 Ga0070688_100157694
455 Ga0070667_100269278
456 Ga0070703_10191323
457 Ga0070709_10019555
458 Ga0070709_10856879
459 Ga0070713_100170840
460 Ga0070701_10028064
461 Ga0070701_10172107
462 Ga0070705_100232367
463 Ga0070705_100675070
464 Ga0070700_100159592
465 Ga0070700_100338771
466 Ga0070681_10237317
467 Ga0068867_100145835
468 Ga0070707_100204803
469 Ga0070707_101454130
470 Ga0070707_101503357
471 Ga0070698_100000549
472 Ga0070698_100326978
473 Ga0070698_101287918
474 Ga0070699_100002456
475 Ga0070699_100025347
476 Ga0070699_100761358
477 Ga0070699_101373902
478 Ga0070699_101970203
479 Ga0070684_100303961
480 Ga0070684_100867626
481 Ga0070697_100016591
482 Ga0070697_100554314
483 Ga0070697_100897433
484 Ga0068853_101823880
485 Ga0070672_100004683
486 Ga0070686_100771984
487 Ga0070686_100883329
488 Ga0070695_100000451
489 Ga0070695_100029703
490 Ga0070695_100037685
491 Ga0070695_100055550
492 Ga0070695_101544797
493 Ga0070696_100030608
494 Ga0070696_100032253
495 Ga0070696_100143452
496 Ga0070696_100149486
497 Ga0070696_100298424
498 Ga0070696_100370458
499 Ga0070665_100025154
500 Ga0070704_100008310
501 Ga0070704_100046923
502 Ga0070704_100261288
503 Ga0070704_101655979
504 Ga0070664_100167406
505 Ga0070664_100536621
506 Ga0070664_102094072
507 Ga0068854_100950708
508 Ga0068856_100086547
509 Ga0070702_100252858
510 Ga0070702_100286843
511 Ga0070702_100354405
512 Ga0068852_100061196
513 Ga0068859_100222857
514 Ga0068859_100449478
515 Ga0068859_101803267
516 Ga0068859_102217955
517 Ga0068864_100002895
518 Ga0068864_100025702
519 Ga0068864_100179099
520 Ga0068866_10016325
521 Ga0068866_10034046
522 Ga0068851_10080801
523 Ga0068851_10336491
524 Ga0068870_10547859
525 Ga0068863_101898127
526 Ga0068858_100018182
527 Ga0068860_100025269
528 Ga0068860_100252858
529 Ga0068860_100938551
530 Ga0068862_100075090
531 Ga0068862_100097141
532 Ga0068862_100323350
533 Ga0068862_100679089
534 Ga0068862_101822091
535 Ga0081455_10045128
536 Ga0081539_10008089
537 Ga0070717_11205421
538 Ga0097621_100003748
539 Ga0068871_100010556
540 Ga0068871_101300548
541 Ga0075428_100010406
542 Ga0075428_101299120
543 Ga0075433_10000708
544 Ga0075433_10244626
545 Ga0075433_10341918
546 Ga0075433_11582058
547 Ga0075433_11633855
548 Ga0075434_100002442
549 Ga0075434_100154501
550 Ga0075434_101910465
551 Ga0075434_102361943
552 Ga0075429_100454392
553 Ga0068865_100002511
554 Ga0068865_100458771
555 Ga0068865_100731456
556 Ga0075436_100273143
557 Ga0075436_100429333
558 Ga0097620_100222852
559 Ga0097620_100449439
560 Ga0097620_101803476
561 Ga0097620_102217321
562 Ga0075435_100002619
563 Ga0075435_100060445
564 Ga0075435_100126196
565 Ga0075435_100627080
566 Ga0075435_101208717
567 Ga0105240_11089497
568 Ga0111539_10048145
569 Ga0111539_10542543
570 Ga0111539_11338207
571 Ga0111539_12260085
572 Ga0105245_10021384
573 Ga0105245_10031303
574 Ga0105247_10001119
575 Ga0114129_10006554
576 Ga0114129_10009633
577 Ga0114129_10014145
578 Ga0114129_10079264
579 Ga0114129_10254133
580 Ga0114129_10916121
581 Ga0114129_11166495
582 Ga0105243_10119848
583 Ga0105243_10408024
584 Ga0105243_11801723
585 Ga0105243_12531651
586 Ga0105243_13005513
587 Ga0105241_10057507
588 Ga0105242_10013752
589 Ga0105242_10151230
590 Ga0105242_10416947
591 Ga0105248_10002081
592 Ga0105248_12145362
593 Ga0105248_12703206
594 Ga0105248_12708390
595 Ga0105248_13036367
596 Ga0105238_10151051
597 Ga0105238_11362602
598 Ga0105238_12953802
599 Ga0105249_10428874
600 Ga0105249_10522614
601 Ga0105239_10500896
602 Ga0157370_10849916
603 Ga0157369_10633120
604 Ga0157378_10439360
605 Ga0157378_11217313
606 Ga0163162_11127681
607 Ga0157372_11490153
608 Ga0157375_11268571
609 Ga0157375_13009310
610 Ga0163163_10014771
611 Ga0163163_10466907
612 Ga0163163_11040152
613 Ga0163163_11215327
614 Ga0163163_11654057
615 Ga0157380_10502785
616 Ga0157380_10630061
617 Ga0157380_11589611
618 Ga0157377_10146131
619 Ga0157376_10167917
620 Ga0206356_10627622
621 Ga0207642_10033397
622 Ga0207710_10014691
623 Ga0207680_10191294
624 Ga0207680_10907511
625 Ga0207680_11247960
626 Ga0207699_10013522
627 Ga0207660_11603046
628 Ga0207657_10400132
629 Ga0207646_10045079
630 Ga0207646_11536431
631 Ga0207694_10947252
632 Ga0207694_11825029
633 Ga0207650_10008258
634 Ga0207650_10750440
635 Ga0207659_10213998
636 Ga0207687_10065045
637 Ga0207687_10712981
638 Ga0207700_10020049
639 Ga0207690_11226541
640 Ga0207706_10029501
641 Ga0207686_10851571
642 Ga0207686_10996303
643 Ga0207686_11273120
644 Ga0207709_10275814
645 Ga0207669_10395051
646 Ga0207669_10424037
647 Ga0207669_10835173
648 Ga0207704_10173610
649 Ga0207704_10188502
650 Ga0207704_10684215
651 Ga0207691_10024959
652 Ga0207711_10207529
653 Ga0207711_10453387
654 Ga0207689_11078277
655 Ga0207679_10092439
656 Ga0207679_10208059
657 Ga0207651_10758430
658 Ga0207712_10086121
659 Ga0207712_10437149
660 Ga0207712_11100126
661 Ga0207668_10429153
662 Ga0207640_11564512
663 Ga0207703_10157225
664 Ga0207703_10284001
665 Ga0207703_12313470
666 Ga0207639_10184460
667 Ga0207708_10129375
668 Ga0207708_10201992
669 Ga0207641_10620556
670 Ga0207648_10403500
671 Ga0207676_10006988
672 Ga0207676_10510891
673 Ga0207676_10514208
674 Ga0209971_1035849
675 Ga0207428_10001229
676 Ga0207428_10668999
677 Ga0207428_10752303
678 Ga0268266_10138892
679 Ga0268266_11428773
680 Ga0268265_10435242
681 Ga0268265_11190220
682 Ga0268264_10242618
683 Ga0307406_11706367
684 Ga0307416_102508324
685 Ga0373926_0049681
686 Ga0373944_0106632
687 Ga0373956_0597621
688 Ga0373943_0185479
689 Ga0373955_0303804
690 Ga0373955_0726740
691 Ga0373935_0254078
692 Ga0373933_0013664
693 Ga0373947_0297092
694 Ga0373937_0001867
695 Ga0373925_0105516
696 Ga0373925_0276741
697 Ga0395898_1208906
698 Ga0395905_1172360
699 Ga0439453_0074418
700 Ga0439448_0271100
701 Ga0450917_016416
702 Ga0450898_144680
703 Ga0439435_0003514
704 Ga0439435_0026176
705 Ga0439444_0072160
706 Ga0439460_0117018
707 Ga0451576_0424765
708 Ga0466967_0575562
709 Ga0495603_0110355
710 Ga0495629_0267360
711 Ga0495653_0526895
712 Ga0495584_0101401
713 Ga0495628_0875132
714 Ga0495630_1331618
715 Ga0495652_0655822
716 Ga0495586_0153326
717 Ga0495609_0118449
718 Ga0495621_0019244
719 Ga0495621_0030185
720 Ga0495621_0052711
721 Ga0495597_0073836
722 Ga0495597_0277760
723 Ga0495667_0109900
724 Ga0495611_0520002
725 Ga0495659_0039158
726 Ga0495659_0074207
727 Ga0495659_0084001
728 Ga0495659_0219970
729 Ga0495659_0252782
730 Ga0495647_0038016
731 Ga0495658_0288792
732 Ga0495669_0067750
733 Ga0495613_0234096
734 Ga0495600_0675261
735 Ga0495581_0096554
736 Ga0495636_0603073
737 Ga0495674_0492512
738 Ga0495675_0391213
739 Ga0496104_0793745
740 Ga0496112_0932036
741 Ga0496113_0505518
742 Ga0496114_0046181
743 Ga0501031_0273618
744 Ga0501031_0772813
745 Ga0501032_0256545
746 Ga0501032_0373761
747 Ga0501034_1238937
748 Ga0501036_0076135
749 Ga0501036_0104136
750 Ga0501037_1073064
751 Ga0501039_0133158
752 Ga0501039_0187457
753 Ga0501040_0049464
754 Ga0501040_0370404
755 Ga0501040_0716818
756 Ga0501040_0822792
757 Ga0501041_0238923
758 Ga0501041_0515519
759 Ga0501042_0135989
760 Ga0501042_0256073
761 Ga0501042_0319981
762 Ga0501042_0389077
763 Ga0501043_0522617
764 Ga0501043_1142319
765 Ga0501046_0342658
766 Ga0501046_0559081
767 Ga0501048_0930709
768 Ga0501048_1028737
769 Ga0501067_0690057
770 Ga0501069_0717529
771 Ga0501071_0212144
772 Ga0501071_0248123
773 Ga0501071_0354181
774 Ga0501071_0862861
775 Ga0501072_0016396
776 Ga0501072_0057064
777 Ga0501072_0178195
778 Ga0501073_0480657
779 Ga0501074_0267000
780 Ga0501075_0021597
781 Ga0501075_0033728
782 Ga0501075_0178487
783 Ga0501075_1070578
784 Ga0501076_0012837
785 Ga0501076_0013409
786 Ga0501076_0016436
787 Ga0501076_0037302
788 Ga0501076_1030780
789 Ga0501077_0002664
790 Ga0501077_0732782
791 Ga0501079_0019472
792 Ga0501079_0037325
793 Ga0501079_0058574
794 Ga0501079_0180195
795 Ga0501079_0528617
796 Ga0501080_0134847
797 Ga0501080_1398012
798 Ga0501080_1889908
799 Ga0501081_0102626
800 Ga0501081_0731778
801 Ga0501083_0119010
802 Ga0501083_0126962
803 Ga0501083_0625333
804 Ga0501035_0857664
805 Ga0501035_1387993
806 Ga0501045_0009966
807 Ga0501045_0020563
808 Ga0501045_0088206
809 nmdc:mga05p37_1554319_c1
810 nmdc:mga05p37_1742_c1
811 nmdc:mga05p37_281460_c1
812 nmdc:mga05p37_285399_c1
813 nmdc:mga05p37_403192_c1
814 nmdc:mga05p37_46581_c1
815 nmdc:mga05p37_498264_c1
816 nmdc:mga05p37_637709_c1
817 nmdc:mga05p37_94222_c1
818 nmdc:mga09592_276469_c1
819 nmdc:mga0qj67_214004_c1
820 nmdc:mga06r32_208599_c1
821 nmdc:mga08y16_2008386_c1
822 nmdc:mga08y16_600_c1
823 nmdc:mga08y16_67410_c1
824 nmdc:mga0n895_77896_c1
825 nmdc:mga0rr50_132778_c1
826 nmdc:mga0rr50_139670_c1
827 nmdc:mga0rr50_7629_c1
828 nmdc:mga0rr50_764554_c1
829 nmdc:mga08x19_294400_c1
830 nmdc:mga08x19_586443_c1
831 nmdc:mga0a205_175750_c1
832 nmdc:mga0a205_3683_c1
833 nmdc:mga0a205_382002_c1
834 nmdc:mga0a205_422882_c1
835 nmdc:mga0a205_96316_c1
836 Ga0495601_0140041
837 Ga0495619_0095248
838 Ga0495619_0275537
839 Ga0501084_0012166
840 Ga0501084_0061088
841 Ga0501084_1514661
842 Ga0501082_0026892
843 Ga0501082_0031494
844 Ga0501082_0444821
845 Ga0501082_0725375
846 Ga0501082_1546266
847 Ga0530510_0059122
848 Ga0530510_0191982
849 Ga0530510_0581655
850 Ga0530510_0593734

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04014

MazE_antitoxin

Antidote-toxin recognition MazE, bacterial antitoxin

22

67

0.86

Map