F440754

General Info

Members Datasets Scaffolds Average Seq Length
424 188 376 296

Family's Representative Sequence

Representative Sequence 3300013306|Ga0163162_10571060|Ga0163162_105710602
Length 274
Sequence MPAFSQPAGKVVEQETVSSTILGRSVHYTVYLPADYDISQRSYPVVYLLHGFTDDNTGWLQFGEINRYADKAIADGTIPPMIIIMPNADSSWYINSYDGKENYEDFFIKELMPFVEKKYRIKAGVAGLSMGGYGTLIYALKYPQLFAAAAPLSAGIFTSDELKAMPDNNYANVLARVFGSNLKGDARLTDQWYANSVLDIVAKESTDSLKRVRYWIDCGDDDFLTNANCLLHIALVTKHVPHEFRMRDGAHNWTYWRTGITDALQFIGDSFHQK

Samples

Sample ID Description Type Environment
1 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
2 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
3 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
4 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
5 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
6 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
7 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
8 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
9 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
10 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
11 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
12 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
13 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
14 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
90 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
91 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
92 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
132 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
133 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
134 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
135 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
136 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
137 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
138 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
139 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
140 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
141 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
142 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
143 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
144 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
145 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
146 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
147 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
148 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
149 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
150 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
151 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
152 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
153 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
154 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
155 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
156 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
157 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
158 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
159 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
160 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
161 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
162 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
163 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
164 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
165 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
166 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
167 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
168 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
169 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
170 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
171 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
172 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
173 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
174 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
175 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
176 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
177 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
179 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
180 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
181 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
182 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
183 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
184 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
185 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
186 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
187 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
188 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.64
Metatranscriptomes 0
Isolates 2.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.01
Nodule 0
Rhizoplane 0.47
Rhizosphere 91.04
Stem 0
Stem Tuber 0
Unclassified 4.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1003395 3300001904 Bacteria 2767
2 JGI24739J22299_10033345 3300001989 Bacteria 1762
3 JGI24739J22299_10050340 3300001989 Bacteria 1348
4 JGI24737J22298_10000796 3300001990 Bacteria 11186
5 JGI24735J21928_10000008 3300002067 Bacteria 319819
6 JGI25162J39368_1000183 3300002737 Bacteria 67086
7 rootH1_10027967 3300003316 Unclassified 1684
8 rootH1_10032600 3300003316 Bacteria 7369
9 rootL2_10088930 3300003322 Bacteria 1385
10 rootL2_10104135 3300003322 Bacteria 9618
11 rootL2_10192222 3300003322 Bacteria 1676
12 JGI25160J50197_1002234 3300003354 Bacteria 9095
13 Ga0065714_10067958 3300005288 Bacteria 5068
14 Ga0065707_10010946 3300005295 Bacteria 3158
15 Ga0070676_10001416 3300005328 Bacteria 12103
16 Ga0070676_10073821 3300005328 Unclassified 2053
17 Ga0070676_10150702 3300005328 Bacteria 1488
18 Ga0070676_10363012 3300005328 Bacteria 998
19 Ga0070683_100017296 3300005329 Bacteria 6371
20 Ga0070690_100012007 3300005330 Bacteria 5083
21 Ga0070690_100040567 3300005330 Unclassified 2944
22 Ga0070690_100073318 3300005330 Bacteria 2227
23 Ga0070670_100085975 3300005331 Bacteria 2702
24 Ga0070670_100356791 3300005331 Unclassified 1285
25 Ga0070677_10043497 3300005333 Bacteria 1784
26 Ga0068869_100139178 3300005334 Bacteria 1873
27 Ga0068869_100158106 3300005334 Bacteria 1763
28 Ga0068869_100426704 3300005334 Unclassified 1095
29 Ga0070666_10013801 3300005335 Bacteria 5133
30 Ga0070666_10058911 3300005335 Unclassified 2597
31 Ga0070682_100006801 3300005337 Bacteria 6419
32 Ga0068868_100023984 3300005338 Unclassified 4624
33 Ga0068868_100070021 3300005338 Bacteria 2796
34 Ga0068868_100115824 3300005338 Bacteria 2182
35 Ga0070689_100088208 3300005340 Unclassified 2441
36 Ga0070689_100111768 3300005340 Unclassified 2174
37 Ga0070661_100011266 3300005344 Bacteria 6229
38 Ga0070668_100078612 3300005347 Bacteria 2580
39 Ga0070669_100031635 3300005353 Bacteria 3822
40 Ga0070669_100033239 3300005353 Bacteria 3730
41 Ga0070675_100157454 3300005354 Bacteria 1951
42 Ga0070671_100066144 3300005355 Bacteria 3012
43 Ga0070671_100503443 3300005355 Bacteria 1042
44 Ga0070674_100002319 3300005356 Bacteria 10514
45 Ga0070673_100109244 3300005364 Bacteria 2291
46 Ga0070673_100127155 3300005364 Unclassified 2134
47 Ga0070688_100030061 3300005365 Bacteria 3257
48 Ga0070688_100041268 3300005365 Bacteria 2832
49 Ga0070688_100046543 3300005365 Bacteria 2687
50 Ga0070659_100062710 3300005366 Bacteria 2939
51 Ga0070667_100520964 3300005367 Unclassified 1091
52 Ga0070700_100014173 3300005441 Bacteria 4499
53 Ga0070678_100041496 3300005456 Bacteria 3262
54 Ga0070662_100018711 3300005457 Bacteria 4691
55 Ga0070662_100037247 3300005457 Bacteria 3448
56 Ga0070662_100055114 3300005457 Bacteria 2884
57 Ga0070662_100334978 3300005457 Unclassified 1237
58 Ga0070685_10177177 3300005466 Bacteria 1370
59 Ga0070698_100003211 3300005471 Bacteria 18007
60 Ga0070698_100011101 3300005471 Bacteria 9571
61 Ga0070684_100020837 3300005535 Bacteria 5441
62 Ga0070684_100093556 3300005535 Bacteria 2676
63 Ga0070684_100212668 3300005535 Bacteria 1762
64 Ga0070684_100233086 3300005535 Bacteria 1681
65 Ga0068853_100001327 3300005539 Bacteria 17802
66 Ga0068853_100245727 3300005539 Bacteria 1641
67 Ga0068853_100548214 3300005539 Bacteria 1095
68 Ga0070672_100159452 3300005543 Bacteria 1871
69 Ga0070672_100181346 3300005543 Bacteria 1755
70 Ga0070695_100369799 3300005545 Bacteria 1079
71 Ga0070665_100000008 3300005548 Bacteria 606341
72 Ga0068855_100016939 3300005563 Bacteria 8764
73 Ga0068855_100122909 3300005563 Bacteria 2970
74 Ga0070664_100000360 3300005564 Bacteria 33570
75 Ga0070664_100028393 3300005564 Bacteria 4653
76 Ga0070664_100059063 3300005564 Unclassified 3263
77 Ga0070664_100324465 3300005564 Unclassified 1396
78 Ga0068857_100000323 3300005577 Bacteria 32881
79 Ga0068857_100024671 3300005577 Bacteria 5295
80 Ga0068857_100092625 3300005577 Bacteria 2706
81 Ga0068854_100110978 3300005578 Bacteria 2069
82 Ga0068852_100000631 3300005616 Bacteria 23016
83 Ga0068852_100129854 3300005616 Bacteria 2319
84 Ga0068859_100143503 3300005617 Bacteria 2461
85 Ga0068859_100498056 3300005617 Bacteria 1313
86 Ga0068864_100014750 3300005618 Bacteria 6492
87 Ga0068864_100083653 3300005618 Bacteria 2803
88 Ga0068861_100057617 3300005719 Bacteria 2968
89 Ga0068861_100064190 3300005719 Bacteria 2824
90 Ga0068861_100638380 3300005719 Bacteria 982
91 Ga0068870_10002834 3300005840 Bacteria 7302
92 Ga0068863_100147360 3300005841 Unclassified 2252
93 Ga0068863_100215328 3300005841 Unclassified 1850
94 Ga0068863_100434481 3300005841 Unclassified 1287
95 Ga0068863_100549116 3300005841 Bacteria 1141
96 Ga0068858_100199840 3300005842 Bacteria 1890
97 Ga0068858_100287849 3300005842 Unclassified 1566
98 Ga0068860_100000029 3300005843 Bacteria 259192
99 Ga0068860_100008584 3300005843 Bacteria 10185
100 Ga0068860_100011846 3300005843 Bacteria 8596
101 Ga0068860_100016954 3300005843 Bacteria 7100
102 Ga0068862_100008081 3300005844 Bacteria 8709
103 Ga0068862_100029200 3300005844 Bacteria 4646
104 Ga0068862_100048714 3300005844 Bacteria 3618
105 Ga0068862_100364979 3300005844 Unclassified 1343
106 Ga0075366_10158555 3300006195 Bacteria 1371
107 Ga0097621_100198411 3300006237 Unclassified 1741
108 Ga0068871_100424087 3300006358 Bacteria 1188
109 Ga0075429_100389043 3300006880 Bacteria 1221
110 Ga0068865_100047269 3300006881 Bacteria 2956
111 Ga0068865_100284085 3300006881 Unclassified 1318
112 Ga0097620_100143491 3300006931 Bacteria 2461
113 Ga0097620_100498070 3300006931 Bacteria 1313
114 Ga0105240_10003982 3300009093 Bacteria 22790
115 Ga0105240_10014188 3300009093 Bacteria 10882
116 Ga0105240_10127989 3300009093 Bacteria 3049
117 Ga0111539_10017182 3300009094 Bacteria 8955
118 Ga0111539_10031303 3300009094 Bacteria 6463
119 Ga0105241_10030156 3300009174 Bacteria 4052
120 Ga0105241_10040780 3300009174 Bacteria 3505
121 Ga0105241_10100151 3300009174 Bacteria 2302
122 Ga0105241_10251868 3300009174 Bacteria 1497
123 Ga0105242_10040941 3300009176 Bacteria 3735
124 Ga0105242_10071692 3300009176 Bacteria 2876
125 Ga0105242_10389047 3300009176 Bacteria 1298
126 Ga0105248_10160734 3300009177 Bacteria 2534
127 Ga0105248_10859063 3300009177 Unclassified 1024
128 Ga0105237_10003152 3300009545 Bacteria 19845
129 Ga0105237_10008782 3300009545 Bacteria 10901
130 Ga0105237_10033278 3300009545 Bacteria 5222
131 Ga0105237_10052309 3300009545 Bacteria 4100
132 Ga0105237_10116431 3300009545 Bacteria 2666
133 Ga0105237_10691335 3300009545 Unclassified 1027
134 Ga0105249_10057006 3300009553 Bacteria 3578
135 Ga0105249_10336761 3300009553 Bacteria 1524
136 Ga0105249_10357638 3300009553 Unclassified 1481
137 Ga0105249_10359273 3300009553 Bacteria 1477
138 Ga0105249_10592307 3300009553 Unclassified 1163
139 Ga0105239_10000816 3300010375 Bacteria 44236
140 Ga0105239_10003173 3300010375 Bacteria 20361
141 Ga0105239_10011821 3300010375 Bacteria 9742
142 Ga0105239_10034359 3300010375 Bacteria 5567
143 Ga0105239_10286484 3300010375 Bacteria 1855
144 Ga0105239_10451588 3300010375 Bacteria 1458
145 Ga0105239_10602136 3300010375 Bacteria 1253
146 Ga0105246_10001324 3300011119 Bacteria 14568
147 Ga0157373_10042010 3300013100 Bacteria 3269
148 Ga0157371_10007149 3300013102 Bacteria 9066
149 Ga0157371_10054902 3300013102 Bacteria 2828
150 Ga0157370_10347720 3300013104 Bacteria 1367
151 Ga0157369_10126154 3300013105 Bacteria 2713
152 Ga0157369_10214533 3300013105 Bacteria 2016
153 Ga0157369_10380474 3300013105 Bacteria 1465
154 Ga0157369_10464859 3300013105 Unclassified 1310
155 Ga0157374_10024086 3300013296 Bacteria 5452
156 Ga0157374_10034904 3300013296 Unclassified 4599
157 Ga0157374_10264270 3300013296 Bacteria 1696
158 Ga0157378_10007614 3300013297 Bacteria 9453
159 Ga0157378_10078099 3300013297 Bacteria 2985
160 Ga0157378_10086711 3300013297 Bacteria 2838
161 Ga0157378_10239671 3300013297 Bacteria 1732
162 Ga0157378_10287284 3300013297 Bacteria 1587
163 Ga0157378_10353933 3300013297 Bacteria 1435
164 Ga0163162_10002323 3300013306 Bacteria 17844
165 Ga0163162_10002751 3300013306 Bacteria 16697
166 Ga0163162_10004892 3300013306 Bacteria 12916
167 Ga0163162_10005776 3300013306 Bacteria 11971
168 Ga0163162_10013352 3300013306 Bacteria 8020
169 Ga0163162_10112506 3300013306 Bacteria 2821
170 Ga0163162_10145257 3300013306 Bacteria 2488
171 Ga0163162_10571060 3300013306 Bacteria 1258
172 Ga0157372_10002043 3300013307 Bacteria 21955
173 Ga0157372_10008025 3300013307 Bacteria 11228
174 Ga0157372_10170040 3300013307 Bacteria 2521
175 Ga0157372_10397192 3300013307 Bacteria 1607
176 Ga0157375_10005531 3300013308 Bacteria 10994
177 Ga0157375_10024349 3300013308 Bacteria 5601
178 Ga0157375_10031558 3300013308 Bacteria 5011
179 Ga0163163_10002119 3300014325 Bacteria 16744
180 Ga0163163_10163957 3300014325 Unclassified 2268
181 Ga0163163_10203108 3300014325 Bacteria 2030
182 Ga0157380_10010608 3300014326 Bacteria 6629
183 Ga0157377_10005271 3300014745 Bacteria 6057
184 Ga0157379_10189931 3300014968 Bacteria 1856
185 Ga0157379_10328909 3300014968 Bacteria 1396
186 Ga0157376_10067408 3300014969 Bacteria 3027
187 Ga0157376_10332815 3300014969 Unclassified 1447
188 Ga0157376_10524468 3300014969 Bacteria 1168
189 Ga0163161_10008140 3300017792 Bacteria 7249
190 Ga0163161_10084965 3300017792 Bacteria 2334
191 Ga0213876_10000984 3300021384 Bacteria 18715
192 Ga0209437_100089 3300025233 Bacteria 250476
193 Ga0207426_1000023 3300025302 Bacteria 545465
194 Ga0207642_10026833 3300025899 Bacteria 2350
195 Ga0207688_10001993 3300025901 Bacteria 10954
196 Ga0207688_10119481 3300025901 Unclassified 1537
197 Ga0207680_10031000 3300025903 Bacteria 3024
198 Ga0207680_10035993 3300025903 Bacteria 2848
199 Ga0207680_10244969 3300025903 Unclassified 1236
200 Ga0207647_10000054 3300025904 Bacteria 86704
201 Ga0207647_10065100 3300025904 Bacteria 2213
202 Ga0207645_10000198 3300025907 Bacteria 49061
203 Ga0207645_10005936 3300025907 Bacteria 8797
204 Ga0207645_10089309 3300025907 Bacteria 1981
205 Ga0207643_10020638 3300025908 Bacteria 3616
206 Ga0207643_10052566 3300025908 Bacteria 2314
207 Ga0207695_10007439 3300025913 Bacteria 13937
208 Ga0207695_10033063 3300025913 Bacteria 5649
209 Ga0207695_10086416 3300025913 Bacteria 3163
210 Ga0207671_10001778 3300025914 Bacteria 24205
211 Ga0207671_10003802 3300025914 Bacteria 14807
212 Ga0207671_10006180 3300025914 Bacteria 10754
213 Ga0207671_10026334 3300025914 Bacteria 4360
214 Ga0207671_10061140 3300025914 Bacteria 2795
215 Ga0207671_10061682 3300025914 Bacteria 2783
216 Ga0207671_10328320 3300025914 Unclassified 1211
217 Ga0207649_10238214 3300025920 Unclassified 1305
218 Ga0207649_10242085 3300025920 Unclassified 1295
219 Ga0207681_10091929 3300025923 Bacteria 2168
220 Ga0207681_10472859 3300025923 Bacteria 1023
221 Ga0207650_10093731 3300025925 Bacteria 2299
222 Ga0207650_10336110 3300025925 Unclassified 1240
223 Ga0207659_10377369 3300025926 Unclassified 1182
224 Ga0207659_10382624 3300025926 Bacteria 1174
225 Ga0207644_10092073 3300025931 Bacteria 2261
226 Ga0207644_10202161 3300025931 Unclassified 1568
227 Ga0207644_10251619 3300025931 Bacteria 1410
228 Ga0207690_10050172 3300025932 Bacteria 2785
229 Ga0207690_10210019 3300025932 Bacteria 1483
230 Ga0207706_10011289 3300025933 Bacteria 8141
231 Ga0207706_10014965 3300025933 Bacteria 7024
232 Ga0207706_10077591 3300025933 Bacteria 2921
233 Ga0207706_10087955 3300025933 Unclassified 2732
234 Ga0207670_10031962 3300025936 Bacteria 3379
235 Ga0207691_10020435 3300025940 Bacteria 6259
236 Ga0207691_10036561 3300025940 Bacteria 4551
237 Ga0207691_10062901 3300025940 Bacteria 3366
238 Ga0207689_10001133 3300025942 Bacteria 25688
239 Ga0207689_10003219 3300025942 Bacteria 14956
240 Ga0207689_10004134 3300025942 Bacteria 13188
241 Ga0207689_10018743 3300025942 Bacteria 5837
242 Ga0207689_10021858 3300025942 Bacteria 5380
243 Ga0207689_10253116 3300025942 Bacteria 1456
244 Ga0207689_10413390 3300025942 Unclassified 1125
245 Ga0207661_10010446 3300025944 Bacteria 6683
246 Ga0207661_10092556 3300025944 Bacteria 2520
247 Ga0207679_10000575 3300025945 Bacteria 24610
248 Ga0207679_10029528 3300025945 Bacteria 3818
249 Ga0207679_10154006 3300025945 Unclassified 1875
250 Ga0207667_10017043 3300025949 Bacteria 8195
251 Ga0207667_10063957 3300025949 Bacteria 3843
252 Ga0207651_10008349 3300025960 Bacteria 5589
253 Ga0207651_10124121 3300025960 Bacteria 1964
254 Ga0207712_10206835 3300025961 Unclassified 1560
255 Ga0207668_10246811 3300025972 Bacteria 1448
256 Ga0207640_10157288 3300025981 Bacteria 1677
257 Ga0207658_10490238 3300025986 Unclassified 1093
258 Ga0207677_10078290 3300026023 Unclassified 2360
259 Ga0207677_10085463 3300026023 Bacteria 2277
260 Ga0207639_10005654 3300026041 Bacteria 8459
261 Ga0207639_10138760 3300026041 Unclassified 2023
262 Ga0207639_10504522 3300026041 Bacteria 1106
263 Ga0207678_10103735 3300026067 Unclassified 2427
264 Ga0207641_10290196 3300026088 Bacteria 1542
265 Ga0207648_10004601 3300026089 Bacteria 14145
266 Ga0207648_10012208 3300026089 Bacteria 8045
267 Ga0207648_10043409 3300026089 Bacteria 3947
268 Ga0207648_10047763 3300026089 Bacteria 3750
269 Ga0207676_10007795 3300026095 Bacteria 7615
270 Ga0207676_10351616 3300026095 Bacteria 1363
271 Ga0207674_10001817 3300026116 Bacteria 27232
272 Ga0207674_10015441 3300026116 Bacteria 8391
273 Ga0207674_10040221 3300026116 Bacteria 4845
274 Ga0207674_10043093 3300026116 Unclassified 4655
275 Ga0207674_10378151 3300026116 Bacteria 1369
276 Ga0207675_100018687 3300026118 Bacteria 6469
277 Ga0207675_100048495 3300026118 Unclassified 3964
278 Ga0207683_10008601 3300026121 Bacteria 8732
279 Ga0207683_10028608 3300026121 Unclassified 4820
280 Ga0207698_10015583 3300026142 Bacteria 5095
281 Ga0207698_10058347 3300026142 Bacteria 2991
282 Ga0207698_10108469 3300026142 Bacteria 2321
283 Ga0268266_10000016 3300028379 Bacteria 629101
284 Ga0268265_10281662 3300028380 Unclassified 1488
285 Ga0268264_10000072 3300028381 Bacteria 260791
286 Ga0268264_10003369 3300028381 Bacteria 13813
287 Ga0268264_10007535 3300028381 Bacteria 9080
288 Ga0268264_10029822 3300028381 Bacteria 4471
289 Ga0268264_10047596 3300028381 Bacteria 3565
290 Ga0268264_10110068 3300028381 Bacteria 2411
291 Ga0268264_10353214 3300028381 Unclassified 1400
292 Ga0268264_10392207 3300028381 Bacteria 1332
293 Ga0307515_10000039 3300028794 Bacteria 323229
294 Ga0307515_10001879 3300028794 Bacteria 46722
295 Ga0307515_10007245 3300028794 Bacteria 21963
296 Ga0265327_10010552 3300031251 Bacteria 6474
297 Ga0307507_10000032 3300033179 Bacteria 194155
298 Ga0307510_10181849 3300033180 Bacteria 1664
299 Ga0373955_0051056 3300035172 Bacteria 2252
300 Ga0373937_0025425 3300036401 Bacteria 5344
301 Ga0451853_3379980 3300041512 Bacteria 1564
302 Ga0439442_002905 3300042002 Bacteria 3376
303 Ga0439445_0055334 3300042004 Unclassified 1077
304 Ga0453684_0228405 3300044712 Bacteria 2150
305 Ga0466968_0030879 3300044735 Bacteria 2221
306 Ga0495592_0071715 3300046454 Bacteria 2521
307 Ga0495629_0215769 3300046459 Bacteria 1324
308 Ga0495638_0076515 3300046460 Bacteria 2039
309 Ga0495651_0090469 3300046462 Bacteria 2296
310 Ga0495650_0000119 3300046471 Bacteria 185719
311 Ga0495650_0033089 3300046471 Bacteria 2305
312 Ga0495585_0000173 3300046492 Bacteria 69500
313 Ga0495585_0001496 3300046492 Bacteria 18225
314 Ga0495585_0003557 3300046492 Bacteria 10458
315 Ga0495583_0010045 3300046506 Bacteria 5576
316 Ga0495606_0000008 3300046507 Bacteria 321373
317 Ga0495606_0059804 3300046507 Bacteria 2443
318 Ga0495606_0098214 3300046507 Bacteria 1787
319 Ga0495606_0127834 3300046507 Bacteria 1514
320 Ga0495608_0077612 3300046511 Bacteria 2162
321 Ga0495610_0002038 3300046512 Bacteria 17252
322 Ga0495616_0036331 3300046513 Bacteria 2542
323 Ga0495616_0045978 3300046513 Bacteria 2206
324 Ga0495618_0107221 3300046514 Bacteria 1789
325 Ga0495628_0226731 3300046516 Bacteria 1402
326 Ga0495637_0013908 3300046520 Bacteria 3810
327 Ga0495648_0007737 3300046524 Bacteria 8555
328 Ga0495648_0036946 3300046524 Bacteria 3144
329 Ga0495648_0045783 3300046524 Bacteria 2718
330 Ga0495652_0137921 3300046529 Bacteria 1922
331 Ga0495609_0009807 3300046538 Bacteria 4619
332 Ga0495609_0019718 3300046538 Bacteria 3118
333 Ga0495645_0130217 3300046543 Unclassified 1764
334 Ga0495633_0000032 3300046558 Bacteria 193765
335 Ga0495633_0022405 3300046558 Bacteria 3144
336 Ga0495668_0000667 3300046616 Bacteria 41283
337 Ga0495611_0121189 3300046648 Bacteria 1219
338 Ga0495625_0000017 3300046660 Bacteria 299728
339 Ga0495625_0000535 3300046660 Bacteria 55840
340 Ga0495625_0000742 3300046660 Bacteria 45511
341 Ga0495625_0016995 3300046660 Bacteria 5705
342 Ga0495625_0051952 3300046660 Bacteria 2936
343 Ga0495625_0105526 3300046660 Bacteria 1930
344 Ga0495661_0008137 3300046665 Bacteria 7266
345 Ga0495599_0130649 3300046678 Bacteria 1560
346 Ga0495658_0005519 3300046683 Bacteria 6218
347 Ga0495613_0245780 3300046689 Bacteria 1250
348 Ga0495649_0000121 3300046694 Bacteria 68443
349 Ga0495600_0148937 3300046809 Bacteria 1516
350 Ga0495660_0011892 3300046810 Bacteria 5049
351 Ga0495687_000004 3300047443 Bacteria 779298
352 Ga0495687_022492 3300047443 Bacteria 3025
353 Ga0495687_035225 3300047443 Bacteria 2254
354 Ga0495679_059385 3300047446 Bacteria 1125
355 Ga0495684_0262574 3300047471 Bacteria 1252
356 Ga0495686_0001124 3300047472 Bacteria 31635
357 Ga0495686_0018957 3300047472 Bacteria 4605
358 Ga0495686_0056501 3300047472 Bacteria 2452
359 Ga0495614_0004858 3300048089 Bacteria 6068
360 Ga0495678_025156 3300049459 Bacteria 2561
361 Ga0501043_0085360 3300049579 Bacteria 2481
362 Ga0501257_006977 3300049686 Bacteria 2516
363 Ga0501259_001418 3300049688 Bacteria 3985
364 Ga0501266_001347 3300049763 Bacteria 3133
365 nmdc:mga0k408_150266_c1 3300050493 Bacteria 1387
366 nmdc:mga08y16_245341_c1 3300050511 Bacteria 1851
367 nmdc:mga08y16_40624_c1 3300050511 Unclassified 4874
368 Ga0495619_0050991 3300053085 Bacteria 2734
369 Ga0500614_021324 3300053123 Bacteria 1502
370 Ga0500614_036053 3300053123 Bacteria 1235
371 Ga0500618_000040 3300053125 Bacteria 112548
372 Ga0500618_017425 3300053125 Bacteria 1787
373 Ga0500618_037639 3300053125 Bacteria 1118
374 Ga0500642_0052782 3300053130 Bacteria 1801
375 Ga0500616_0046204 3300053153 Bacteria 2316
376 Ga0500622_0002434 3300053156 Bacteria 13443

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013296 Ga0157374_10264270 Ga0157374_102642701 265
2 3300009174 Ga0105241_10100151 Ga0105241_101001512 272
3 3300009176 Ga0105242_10389047 Ga0105242_103890472 272
4 3300011119 Ga0105246_10001324 Ga0105246_100013245 272
5 3300013297 Ga0157378_10239671 Ga0157378_102396712 272
6 3300014325 Ga0163163_10203108 Ga0163163_102031082 272
7 3300046514 Ga0495618_0107221 Ga0495618_0107221_21_839 272
8 3300013306 Ga0163162_10571060 Ga0163162_105710602 273
9 3300005840 Ga0068870_10002834 Ga0068870_100028349 276
10 3300026041 Ga0207639_10138760 Ga0207639_101387602 277
11 3300046459 Ga0495629_0215769 Ga0495629_0215769_444_1286 277
12 3300005841 Ga0068863_100549116 Ga0068863_1005491161 279
13 3300009093 Ga0105240_10003982 Ga0105240_100039822 282
14 3300009174 Ga0105241_10030156 Ga0105241_100301561 282
15 3300009174 Ga0105241_10251868 Ga0105241_102518682 282
16 3300010375 Ga0105239_10602136 Ga0105239_106021361 282
17 3300025913 Ga0207695_10007439 Ga0207695_1000743910 282
18 3300046538 Ga0495609_0019718 Ga0495609_0019718_2247_3095 282
19 3300046543 Ga0495645_0130217 Ga0495645_0130217_116_967 282
20 3300044735 Ga0466968_0030879 Ga0466968_0030879_255_1109 283
21 iso_pu_bacteria 2599185184 2599476623 283
22 3300003322 rootL2_10104135 rootL2_1010413510 284
23 3300001990 JGI24737J22298_10000796 JGI24737J22298_100007967 287
24 3300002067 JGI24735J21928_10000008 JGI24735J21928_10000008148 287
25 3300005563 Ga0068855_100016939 Ga0068855_1000169396 287
26 3300005577 Ga0068857_100092625 Ga0068857_1000926253 287
27 3300006195 Ga0075366_10158555 Ga0075366_101585552 287
28 3300025904 Ga0207647_10065100 Ga0207647_100651002 287
29 3300025949 Ga0207667_10017043 Ga0207667_100170436 287
30 3300028794 Ga0307515_10001879 Ga0307515_100018796 287
31 3300046507 Ga0495606_0098214 Ga0495606_0098214_581_1456 288
32 iso_pu_bacteria 2599185184 2599476624 288
33 iso_pu_bacteria 2919437846 2919442724 288
34 iso_pu_bacteria 2919437846 2919442725 288
35 iso_pu_bacteria 2928078545 2928078572 288
36 iso_pu_bacteria 2928078545 2928078573 288
37 iso_pu_bacteria 2928147474 2928151750 288
38 iso_pu_bacteria 2928147474 2928151751 288
39 iso_pu_bacteria 2932082852 2932084364 288
40 iso_pu_bacteria 2932082852 2932084365 288
41 3300003322 rootL2_10192222 rootL2_101922222 289
42 3300005288 Ga0065714_10067958 Ga0065714_100679582 289
43 3300021384 Ga0213876_10000984 Ga0213876_1000098415 289
44 3300028794 Ga0307515_10001879 Ga0307515_100018794 289
45 3300028794 Ga0307515_10007245 Ga0307515_1000724513 289
46 3300033179 Ga0307507_10000032 Ga0307507_10000032156 289
47 3300046462 Ga0495651_0090469 Ga0495651_0090469_302_1186 289
48 3300046492 Ga0495585_0001496 Ga0495585_0001496_17233_18117 289
49 3300046524 Ga0495648_0007737 Ga0495648_0007737_2897_3781 289
50 3300046538 Ga0495609_0009807 Ga0495609_0009807_1820_2704 289
51 3300046558 Ga0495633_0000032 Ga0495633_0000032_65640_66524 289
52 3300046616 Ga0495668_0000667 Ga0495668_0000667_30741_31625 289
53 3300046660 Ga0495625_0000535 Ga0495625_0000535_26331_27215 289
54 3300046660 Ga0495625_0000742 Ga0495625_0000742_33219_34103 289
55 3300046660 Ga0495625_0051952 Ga0495625_0051952_138_1022 289
56 3300046683 Ga0495658_0005519 Ga0495658_0005519_544_1428 289
57 3300048089 Ga0495614_0004858 Ga0495614_0004858_3617_4501 289
58 3300053123 Ga0500614_021324 Ga0500614_021324_575_1459 289
59 3300053125 Ga0500618_000040 Ga0500618_000040_62964_63848 289
60 3300005843 Ga0068860_100016954 Ga0068860_1000169545 290
61 3300009545 Ga0105237_10003152 Ga0105237_1000315212 290
62 3300010375 Ga0105239_10011821 Ga0105239_1001182111 290
63 3300025913 Ga0207695_10086416 Ga0207695_100864164 290
64 3300025914 Ga0207671_10001778 Ga0207671_1000177810 290
65 3300028381 Ga0268264_10029822 Ga0268264_100298222 290
66 3300049579 Ga0501043_0085360 Ga0501043_0085360_816_1700 290
67 3300053125 Ga0500618_000040 Ga0500618_000040_64350_65228 290
68 3300005328 Ga0070676_10150702 Ga0070676_101507022 291
69 3300031251 Ga0265327_10010552 Ga0265327_100105526 291
70 3300042002 Ga0439442_002905 Ga0439442_002905_1978_2865 291
71 3300042004 Ga0439445_0055334 Ga0439445_0055334_165_1052 291
72 3300001989 JGI24739J22299_10033345 JGI24739J22299_100333452 292
73 3300001989 JGI24739J22299_10050340 JGI24739J22299_100503402 292
74 3300001990 JGI24737J22298_10000796 JGI24737J22298_100007966 292
75 3300002067 JGI24735J21928_10000008 JGI24735J21928_10000008149 292
76 3300002737 JGI25162J39368_1000183 JGI25162J39368_100018366 292
77 3300002737 JGI25162J39368_1000183 JGI25162J39368_100018367 292
78 3300003316 rootH1_10027967 rootH1_100279672 292
79 3300003316 rootH1_10032600 rootH1_100326009 292
80 3300003322 rootL2_10088930 rootL2_100889301 292
81 3300003322 rootL2_10104135 rootL2_101041359 292
82 3300003354 JGI25160J50197_1002234 JGI25160J50197_10022342 292
83 3300005295 Ga0065707_10010946 Ga0065707_100109462 292
84 3300005330 Ga0070690_100012007 Ga0070690_1000120076 292
85 3300005331 Ga0070670_100085975 Ga0070670_1000859752 292
86 3300005335 Ga0070666_10058911 Ga0070666_100589113 292
87 3300005353 Ga0070669_100031635 Ga0070669_1000316353 292
88 3300005355 Ga0070671_100066144 Ga0070671_1000661442 292
89 3300005364 Ga0070673_100109244 Ga0070673_1001092442 292
90 3300005365 Ga0070688_100046543 Ga0070688_1000465432 292
91 3300005441 Ga0070700_100014173 Ga0070700_1000141733 292
92 3300005457 Ga0070662_100018711 Ga0070662_1000187111 292
93 3300005457 Ga0070662_100055114 Ga0070662_1000551142 292
94 3300005535 Ga0070684_100093556 Ga0070684_1000935562 292
95 3300005539 Ga0068853_100548214 Ga0068853_1005482141 292
96 3300005543 Ga0070672_100181346 Ga0070672_1001813461 292
97 3300005548 Ga0070665_100000008 Ga0070665_100000008362 292
98 3300005563 Ga0068855_100016939 Ga0068855_1000169397 292
99 3300005563 Ga0068855_100122909 Ga0068855_1001229092 292
100 3300005577 Ga0068857_100092625 Ga0068857_1000926254 292
101 3300005578 Ga0068854_100110978 Ga0068854_1001109783 292
102 3300005616 Ga0068852_100129854 Ga0068852_1001298542 292
103 3300005617 Ga0068859_100143503 Ga0068859_1001435032 292
104 3300005618 Ga0068864_100083653 Ga0068864_1000836532 292
105 3300005719 Ga0068861_100064190 Ga0068861_1000641903 292
106 3300005719 Ga0068861_100638380 Ga0068861_1006383801 292
107 3300005842 Ga0068858_100199840 Ga0068858_1001998401 292
108 3300005843 Ga0068860_100000029 Ga0068860_100000029196 292
109 3300005843 Ga0068860_100011846 Ga0068860_1000118464 292
110 3300005844 Ga0068862_100008081 Ga0068862_10000808111 292
111 3300005844 Ga0068862_100048714 Ga0068862_1000487144 292
112 3300006358 Ga0068871_100424087 Ga0068871_1004240871 292
113 3300006880 Ga0075429_100389043 Ga0075429_1003890431 292
114 3300006931 Ga0097620_100143491 Ga0097620_1001434912 292
115 3300009093 Ga0105240_10014188 Ga0105240_100141882 292
116 3300009093 Ga0105240_10127989 Ga0105240_101279892 292
117 3300009094 Ga0111539_10017182 Ga0111539_100171828 292
118 3300009094 Ga0111539_10031303 Ga0111539_100313033 292
119 3300009174 Ga0105241_10040780 Ga0105241_100407803 292
120 3300009176 Ga0105242_10040941 Ga0105242_100409412 292
121 3300009545 Ga0105237_10008782 Ga0105237_1000878212 292
122 3300009545 Ga0105237_10033278 Ga0105237_100332782 292
123 3300009545 Ga0105237_10052309 Ga0105237_100523092 292
124 3300009545 Ga0105237_10116431 Ga0105237_101164312 292
125 3300009553 Ga0105249_10057006 Ga0105249_100570062 292
126 3300010375 Ga0105239_10000816 Ga0105239_1000081628 292
127 3300010375 Ga0105239_10000816 Ga0105239_1000081629 292
128 3300010375 Ga0105239_10003173 Ga0105239_100031735 292
129 3300010375 Ga0105239_10034359 Ga0105239_100343594 292
130 3300010375 Ga0105239_10451588 Ga0105239_104515882 292
131 3300013102 Ga0157371_10054902 Ga0157371_100549022 292
132 3300013104 Ga0157370_10347720 Ga0157370_103477201 292
133 3300013105 Ga0157369_10214533 Ga0157369_102145332 292
134 3300013296 Ga0157374_10024086 Ga0157374_100240866 292
135 3300013297 Ga0157378_10078099 Ga0157378_100780995 292
136 3300013297 Ga0157378_10287284 Ga0157378_102872841 292
137 3300013306 Ga0163162_10002323 Ga0163162_100023232 292
138 3300013306 Ga0163162_10005776 Ga0163162_1000577610 292
139 3300013306 Ga0163162_10112506 Ga0163162_101125063 292
140 3300013306 Ga0163162_10145257 Ga0163162_101452572 292
141 3300013307 Ga0157372_10002043 Ga0157372_1000204316 292
142 3300013307 Ga0157372_10002043 Ga0157372_1000204317 292
143 3300013307 Ga0157372_10397192 Ga0157372_103971921 292
144 3300013308 Ga0157375_10005531 Ga0157375_100055314 292
145 3300014326 Ga0157380_10010608 Ga0157380_100106083 292
146 3300014968 Ga0157379_10328909 Ga0157379_103289091 292
147 3300017792 Ga0163161_10008140 Ga0163161_100081406 292
148 3300025233 Ga0209437_100089 Ga0209437_100089128 292
149 3300025233 Ga0209437_100089 Ga0209437_100089129 292
150 3300025302 Ga0207426_1000023 Ga0207426_1000023219 292
151 3300025903 Ga0207680_10035993 Ga0207680_100359933 292
152 3300025904 Ga0207647_10065100 Ga0207647_100651003 292
153 3300025908 Ga0207643_10020638 Ga0207643_100206383 292
154 3300025913 Ga0207695_10033063 Ga0207695_100330639 292
155 3300025914 Ga0207671_10003802 Ga0207671_100038028 292
156 3300025914 Ga0207671_10026334 Ga0207671_100263345 292
157 3300025914 Ga0207671_10061140 Ga0207671_100611402 292
158 3300025923 Ga0207681_10091929 Ga0207681_100919292 292
159 3300025923 Ga0207681_10472859 Ga0207681_104728591 292
160 3300025926 Ga0207659_10382624 Ga0207659_103826242 292
161 3300025931 Ga0207644_10092073 Ga0207644_100920733 292
162 3300025933 Ga0207706_10011289 Ga0207706_100112895 292
163 3300025933 Ga0207706_10077591 Ga0207706_100775913 292
164 3300025936 Ga0207670_10031962 Ga0207670_100319626 292
165 3300025940 Ga0207691_10062901 Ga0207691_100629012 292
166 3300025942 Ga0207689_10253116 Ga0207689_102531162 292
167 3300025949 Ga0207667_10017043 Ga0207667_100170437 292
168 3300025949 Ga0207667_10063957 Ga0207667_100639572 292
169 3300025949 Ga0207667_10063957 Ga0207667_100639573 292
170 3300025960 Ga0207651_10124121 Ga0207651_101241212 292
171 3300025961 Ga0207712_10206835 Ga0207712_102068352 292
172 3300025972 Ga0207668_10246811 Ga0207668_102468112 292
173 3300026041 Ga0207639_10504522 Ga0207639_105045221 292
174 3300026088 Ga0207641_10290196 Ga0207641_102901962 292
175 3300026089 Ga0207648_10047763 Ga0207648_100477631 292
176 3300026095 Ga0207676_10351616 Ga0207676_103516162 292
177 3300026116 Ga0207674_10015441 Ga0207674_100154416 292
178 3300026116 Ga0207674_10040221 Ga0207674_100402214 292
179 3300026118 Ga0207675_100018687 Ga0207675_1000186873 292
180 3300026121 Ga0207683_10028608 Ga0207683_100286084 292
181 3300026142 Ga0207698_10108469 Ga0207698_101084693 292
182 3300028379 Ga0268266_10000016 Ga0268266_10000016360 292
183 3300028381 Ga0268264_10000072 Ga0268264_10000072197 292
184 3300028381 Ga0268264_10047596 Ga0268264_100475962 292
185 3300033179 Ga0307507_10000032 Ga0307507_10000032158 292
186 3300033180 Ga0307510_10181849 Ga0307510_101818492 292
187 3300046460 Ga0495638_0076515 Ga0495638_0076515_1060_1947 292
188 3300046471 Ga0495650_0000119 Ga0495650_0000119_153262_154146 292
189 3300046471 Ga0495650_0000119 Ga0495650_0000119_154211_155098 292
190 3300046471 Ga0495650_0033089 Ga0495650_0033089_1043_1930 292
191 3300046492 Ga0495585_0000173 Ga0495585_0000173_47408_48295 292
192 3300046492 Ga0495585_0000173 Ga0495585_0000173_48362_49246 292
193 3300046492 Ga0495585_0003557 Ga0495585_0003557_483_1370 292
194 3300046506 Ga0495583_0010045 Ga0495583_0010045_2569_3456 292
195 3300046506 Ga0495583_0010045 Ga0495583_0010045_3519_4403 292
196 3300046507 Ga0495606_0000008 Ga0495606_0000008_88816_89703 292
197 3300046507 Ga0495606_0000008 Ga0495606_0000008_89763_90647 292
198 3300046507 Ga0495606_0059804 Ga0495606_0059804_1472_2359 292
199 3300046507 Ga0495606_0127834 Ga0495606_0127834_30_917 292
200 3300046512 Ga0495610_0002038 Ga0495610_0002038_11899_12783 292
201 3300046512 Ga0495610_0002038 Ga0495610_0002038_12845_13732 292
202 3300046513 Ga0495616_0036331 Ga0495616_0036331_1385_2272 292
203 3300046513 Ga0495616_0036331 Ga0495616_0036331_366_1253 292
204 3300046513 Ga0495616_0045978 Ga0495616_0045978_865_1749 292
205 3300046520 Ga0495637_0013908 Ga0495637_0013908_814_1698 292
206 3300046524 Ga0495648_0007737 Ga0495648_0007737_4377_5264 292
207 3300046524 Ga0495648_0036946 Ga0495648_0036946_26_913 292
208 3300046524 Ga0495648_0045783 Ga0495648_0045783_1229_2116 292
209 3300046529 Ga0495652_0137921 Ga0495652_0137921_857_1741 292
210 3300046538 Ga0495609_0009807 Ga0495609_0009807_3281_4168 292
211 3300046538 Ga0495609_0019718 Ga0495609_0019718_1295_2182 292
212 3300046558 Ga0495633_0000032 Ga0495633_0000032_67329_68216 292
213 3300046558 Ga0495633_0022405 Ga0495633_0022405_1501_2385 292
214 3300046616 Ga0495668_0000667 Ga0495668_0000667_29268_30155 292
215 3300046648 Ga0495611_0121189 Ga0495611_0121189_102_989 292
216 3300046660 Ga0495625_0000017 Ga0495625_0000017_247909_248793 292
217 3300046660 Ga0495625_0000017 Ga0495625_0000017_248843_249730 292
218 3300046660 Ga0495625_0000742 Ga0495625_0000742_31736_32623 292
219 3300046660 Ga0495625_0016995 Ga0495625_0016995_3914_4804 292
220 3300046660 Ga0495625_0105526 Ga0495625_0105526_34_921 292
221 3300046665 Ga0495661_0008137 Ga0495661_0008137_3283_4167 292
222 3300046665 Ga0495661_0008137 Ga0495661_0008137_4230_5117 292
223 3300046683 Ga0495658_0005519 Ga0495658_0005519_2024_2911 292
224 3300046694 Ga0495649_0000121 Ga0495649_0000121_16634_17518 292
225 3300046694 Ga0495649_0000121 Ga0495649_0000121_17568_18455 292
226 3300046809 Ga0495600_0148937 Ga0495600_0148937_508_1395 292
227 3300046810 Ga0495660_0011892 Ga0495660_0011892_2919_3806 292
228 3300046810 Ga0495660_0011892 Ga0495660_0011892_3930_4817 292
229 3300047443 Ga0495687_000004 Ga0495687_000004_489228_490118 292
230 3300047443 Ga0495687_022492 Ga0495687_022492_1946_2833 292
231 3300047443 Ga0495687_035225 Ga0495687_035225_885_1775 292
232 3300047446 Ga0495679_059385 Ga0495679_059385_230_1114 292
233 3300047472 Ga0495686_0001124 Ga0495686_0001124_20705_21592 292
234 3300047472 Ga0495686_0018957 Ga0495686_0018957_1761_2648 292
235 3300047472 Ga0495686_0018957 Ga0495686_0018957_2733_3620 292
236 3300047472 Ga0495686_0056501 Ga0495686_0056501_950_1837 292
237 3300048089 Ga0495614_0004858 Ga0495614_0004858_2142_3029 292
238 3300049459 Ga0495678_025156 Ga0495678_025156_1332_2219 292
239 3300049459 Ga0495678_025156 Ga0495678_025156_313_1200 292
240 3300050493 nmdc:mga0k408_150266_c1 nmdc:mga0k408_150266_c1_17_904 292
241 3300050511 nmdc:mga08y16_245341_c1 nmdc:mga08y16_245341_c1_160_1050 292
242 3300050511 nmdc:mga08y16_40624_c1 nmdc:mga08y16_40624_c1_1828_2712 292
243 3300053123 Ga0500614_036053 Ga0500614_036053_49_936 292
244 3300053125 Ga0500618_017425 Ga0500618_017425_195_1079 292
245 3300053125 Ga0500618_037639 Ga0500618_037639_152_1039 292
246 3300053130 Ga0500642_0052782 Ga0500642_0052782_397_1284 292
247 3300053153 Ga0500616_0046204 Ga0500616_0046204_1017_1904 292
248 3300053156 Ga0500622_0002434 Ga0500622_0002434_10552_11439 292
249 3300001904 JGI24736J21556_1003395 JGI24736J21556_10033952 293
250 3300005328 Ga0070676_10001416 Ga0070676_100014166 293
251 3300005328 Ga0070676_10073821 Ga0070676_100738212 293
252 3300005328 Ga0070676_10363012 Ga0070676_103630121 293
253 3300005329 Ga0070683_100017296 Ga0070683_1000172968 293
254 3300005330 Ga0070690_100040567 Ga0070690_1000405673 293
255 3300005330 Ga0070690_100073318 Ga0070690_1000733181 293
256 3300005331 Ga0070670_100356791 Ga0070670_1003567911 293
257 3300005333 Ga0070677_10043497 Ga0070677_100434972 293
258 3300005334 Ga0068869_100139178 Ga0068869_1001391782 293
259 3300005334 Ga0068869_100158106 Ga0068869_1001581061 293
260 3300005334 Ga0068869_100426704 Ga0068869_1004267041 293
261 3300005335 Ga0070666_10013801 Ga0070666_100138012 293
262 3300005337 Ga0070682_100006801 Ga0070682_1000068016 293
263 3300005338 Ga0068868_100023984 Ga0068868_1000239845 293
264 3300005338 Ga0068868_100070021 Ga0068868_1000700212 293
265 3300005338 Ga0068868_100115824 Ga0068868_1001158242 293
266 3300005340 Ga0070689_100088208 Ga0070689_1000882082 293
267 3300005340 Ga0070689_100111768 Ga0070689_1001117683 293
268 3300005344 Ga0070661_100011266 Ga0070661_1000112666 293
269 3300005347 Ga0070668_100078612 Ga0070668_1000786122 293
270 3300005353 Ga0070669_100033239 Ga0070669_1000332392 293
271 3300005354 Ga0070675_100157454 Ga0070675_1001574542 293
272 3300005355 Ga0070671_100503443 Ga0070671_1005034431 293
273 3300005356 Ga0070674_100002319 Ga0070674_1000023194 293
274 3300005364 Ga0070673_100127155 Ga0070673_1001271552 293
275 3300005365 Ga0070688_100030061 Ga0070688_1000300612 293
276 3300005365 Ga0070688_100041268 Ga0070688_1000412684 293
277 3300005366 Ga0070659_100062710 Ga0070659_1000627104 293
278 3300005367 Ga0070667_100520964 Ga0070667_1005209641 293
279 3300005456 Ga0070678_100041496 Ga0070678_1000414962 293
280 3300005457 Ga0070662_100037247 Ga0070662_1000372471 293
281 3300005457 Ga0070662_100334978 Ga0070662_1003349782 293
282 3300005466 Ga0070685_10177177 Ga0070685_101771772 293
283 3300005471 Ga0070698_100003211 Ga0070698_10000321113 293
284 3300005471 Ga0070698_100011101 Ga0070698_1000111019 293
285 3300005535 Ga0070684_100020837 Ga0070684_1000208373 293
286 3300005535 Ga0070684_100212668 Ga0070684_1002126682 293
287 3300005535 Ga0070684_100233086 Ga0070684_1002330862 293
288 3300005539 Ga0068853_100001327 Ga0068853_1000013271 293
289 3300005539 Ga0068853_100245727 Ga0068853_1002457271 293
290 3300005543 Ga0070672_100159452 Ga0070672_1001594522 293
291 3300005545 Ga0070695_100369799 Ga0070695_1003697991 293
292 3300005564 Ga0070664_100000360 Ga0070664_10000036015 293
293 3300005564 Ga0070664_100028393 Ga0070664_1000283932 293
294 3300005564 Ga0070664_100059063 Ga0070664_1000590634 293
295 3300005564 Ga0070664_100324465 Ga0070664_1003244652 293
296 3300005577 Ga0068857_100000323 Ga0068857_10000032312 293
297 3300005577 Ga0068857_100024671 Ga0068857_1000246717 293
298 3300005616 Ga0068852_100000631 Ga0068852_10000063119 293
299 3300005617 Ga0068859_100498056 Ga0068859_1004980562 293
300 3300005618 Ga0068864_100014750 Ga0068864_1000147504 293
301 3300005719 Ga0068861_100057617 Ga0068861_1000576173 293
302 3300005841 Ga0068863_100147360 Ga0068863_1001473602 293
303 3300005841 Ga0068863_100215328 Ga0068863_1002153282 293
304 3300005841 Ga0068863_100434481 Ga0068863_1004344812 293
305 3300005842 Ga0068858_100287849 Ga0068858_1002878491 293
306 3300005843 Ga0068860_100008584 Ga0068860_1000085844 293
307 3300005844 Ga0068862_100029200 Ga0068862_1000292002 293
308 3300005844 Ga0068862_100364979 Ga0068862_1003649791 293
309 3300006237 Ga0097621_100198411 Ga0097621_1001984112 293
310 3300006881 Ga0068865_100047269 Ga0068865_1000472692 293
311 3300006881 Ga0068865_100284085 Ga0068865_1002840852 293
312 3300006931 Ga0097620_100498070 Ga0097620_1004980701 293
313 3300009176 Ga0105242_10071692 Ga0105242_100716923 293
314 3300009177 Ga0105248_10160734 Ga0105248_101607343 293
315 3300009177 Ga0105248_10859063 Ga0105248_108590631 293
316 3300009545 Ga0105237_10008782 Ga0105237_1000878211 293
317 3300009545 Ga0105237_10033278 Ga0105237_100332781 293
318 3300009545 Ga0105237_10691335 Ga0105237_106913351 293
319 3300009553 Ga0105249_10336761 Ga0105249_103367611 293
320 3300009553 Ga0105249_10357638 Ga0105249_103576381 293
321 3300009553 Ga0105249_10359273 Ga0105249_103592732 293
322 3300009553 Ga0105249_10592307 Ga0105249_105923071 293
323 3300010375 Ga0105239_10286484 Ga0105239_102864841 293
324 3300013100 Ga0157373_10042010 Ga0157373_100420105 293
325 3300013102 Ga0157371_10007149 Ga0157371_100071493 293
326 3300013105 Ga0157369_10126154 Ga0157369_101261542 293
327 3300013105 Ga0157369_10380474 Ga0157369_103804741 293
328 3300013105 Ga0157369_10464859 Ga0157369_104648592 293
329 3300013296 Ga0157374_10034904 Ga0157374_100349045 293
330 3300013297 Ga0157378_10007614 Ga0157378_100076148 293
331 3300013297 Ga0157378_10086711 Ga0157378_100867113 293
332 3300013297 Ga0157378_10353933 Ga0157378_103539332 293
333 3300013306 Ga0163162_10002751 Ga0163162_100027519 293
334 3300013306 Ga0163162_10004892 Ga0163162_1000489210 293
335 3300013306 Ga0163162_10013352 Ga0163162_100133525 293
336 3300013307 Ga0157372_10008025 Ga0157372_100080255 293
337 3300013307 Ga0157372_10170040 Ga0157372_101700404 293
338 3300013308 Ga0157375_10024349 Ga0157375_100243493 293
339 3300013308 Ga0157375_10031558 Ga0157375_100315582 293
340 3300014325 Ga0163163_10002119 Ga0163163_1000211912 293
341 3300014325 Ga0163163_10163957 Ga0163163_101639572 293
342 3300014745 Ga0157377_10005271 Ga0157377_100052713 293
343 3300014968 Ga0157379_10189931 Ga0157379_101899312 293
344 3300014969 Ga0157376_10067408 Ga0157376_100674082 293
345 3300014969 Ga0157376_10332815 Ga0157376_103328152 293
346 3300014969 Ga0157376_10524468 Ga0157376_105244682 293
347 3300017792 Ga0163161_10084965 Ga0163161_100849652 293
348 3300025899 Ga0207642_10026833 Ga0207642_100268332 293
349 3300025901 Ga0207688_10001993 Ga0207688_100019932 293
350 3300025901 Ga0207688_10119481 Ga0207688_101194811 293
351 3300025903 Ga0207680_10031000 Ga0207680_100310003 293
352 3300025903 Ga0207680_10244969 Ga0207680_102449691 293
353 3300025904 Ga0207647_10000054 Ga0207647_1000005419 293
354 3300025907 Ga0207645_10000198 Ga0207645_1000019821 293
355 3300025907 Ga0207645_10005936 Ga0207645_100059367 293
356 3300025907 Ga0207645_10089309 Ga0207645_100893092 293
357 3300025908 Ga0207643_10052566 Ga0207643_100525662 293
358 3300025914 Ga0207671_10003802 Ga0207671_100038029 293
359 3300025914 Ga0207671_10006180 Ga0207671_1000618013 293
360 3300025914 Ga0207671_10061682 Ga0207671_100616824 293
361 3300025914 Ga0207671_10328320 Ga0207671_103283202 293
362 3300025920 Ga0207649_10238214 Ga0207649_102382142 293
363 3300025920 Ga0207649_10242085 Ga0207649_102420852 293
364 3300025925 Ga0207650_10093731 Ga0207650_100937312 293
365 3300025925 Ga0207650_10336110 Ga0207650_103361101 293
366 3300025926 Ga0207659_10377369 Ga0207659_103773691 293
367 3300025931 Ga0207644_10202161 Ga0207644_102021612 293
368 3300025931 Ga0207644_10251619 Ga0207644_102516192 293
369 3300025932 Ga0207690_10050172 Ga0207690_100501724 293
370 3300025932 Ga0207690_10210019 Ga0207690_102100192 293
371 3300025933 Ga0207706_10014965 Ga0207706_100149658 293
372 3300025933 Ga0207706_10087955 Ga0207706_100879551 293
373 3300025940 Ga0207691_10020435 Ga0207691_100204352 293
374 3300025940 Ga0207691_10036561 Ga0207691_100365612 293
375 3300025942 Ga0207689_10001133 Ga0207689_100011332 293
376 3300025942 Ga0207689_10003219 Ga0207689_100032192 293
377 3300025942 Ga0207689_10004134 Ga0207689_100041345 293
378 3300025942 Ga0207689_10018743 Ga0207689_100187434 293
379 3300025942 Ga0207689_10021858 Ga0207689_100218583 293
380 3300025942 Ga0207689_10413390 Ga0207689_104133902 293
381 3300025944 Ga0207661_10010446 Ga0207661_100104466 293
382 3300025944 Ga0207661_10092556 Ga0207661_100925564 293
383 3300025945 Ga0207679_10000575 Ga0207679_1000057517 293
384 3300025945 Ga0207679_10029528 Ga0207679_100295281 293
385 3300025945 Ga0207679_10154006 Ga0207679_101540061 293
386 3300025960 Ga0207651_10008349 Ga0207651_100083494 293
387 3300025981 Ga0207640_10157288 Ga0207640_101572881 293
388 3300025986 Ga0207658_10490238 Ga0207658_104902381 293
389 3300026023 Ga0207677_10078290 Ga0207677_100782901 293
390 3300026023 Ga0207677_10085463 Ga0207677_100854632 293
391 3300026041 Ga0207639_10005654 Ga0207639_100056549 293
392 3300026067 Ga0207678_10103735 Ga0207678_101037353 293
393 3300026089 Ga0207648_10004601 Ga0207648_100046015 293
394 3300026089 Ga0207648_10012208 Ga0207648_100122087 293
395 3300026089 Ga0207648_10043409 Ga0207648_100434094 293
396 3300026095 Ga0207676_10007795 Ga0207676_100077957 293
397 3300026116 Ga0207674_10001817 Ga0207674_1000181712 293
398 3300026116 Ga0207674_10043093 Ga0207674_100430935 293
399 3300026116 Ga0207674_10378151 Ga0207674_103781512 293
400 3300026118 Ga0207675_100048495 Ga0207675_1000484953 293
401 3300026121 Ga0207683_10008601 Ga0207683_100086015 293
402 3300026142 Ga0207698_10015583 Ga0207698_100155832 293
403 3300026142 Ga0207698_10058347 Ga0207698_100583474 293
404 3300028380 Ga0268265_10281662 Ga0268265_102816622 293
405 3300028381 Ga0268264_10003369 Ga0268264_100033699 293
406 3300028381 Ga0268264_10007535 Ga0268264_100075352 293
407 3300028381 Ga0268264_10110068 Ga0268264_101100683 293
408 3300028381 Ga0268264_10353214 Ga0268264_103532141 293
409 3300028381 Ga0268264_10392207 Ga0268264_103922071 293
410 3300028794 Ga0307515_10000039 Ga0307515_1000003937 293
411 3300035172 Ga0373955_0051056 Ga0373955_0051056_1139_2029 293
412 3300036401 Ga0373937_0025425 Ga0373937_0025425_3959_4849 293
413 3300041512 Ga0451853_3379980 Ga0451853_3379980_154_1044 293
414 3300044712 Ga0453684_0228405 Ga0453684_0228405_682_1566 293
415 3300046454 Ga0495592_0071715 Ga0495592_0071715_40_930 293
416 3300046511 Ga0495608_0077612 Ga0495608_0077612_323_1213 293
417 3300046516 Ga0495628_0226731 Ga0495628_0226731_364_1254 293
418 3300046678 Ga0495599_0130649 Ga0495599_0130649_44_934 293
419 3300046689 Ga0495613_0245780 Ga0495613_0245780_128_1084 293
420 3300047471 Ga0495684_0262574 Ga0495684_0262574_270_1160 293
421 3300049686 Ga0501257_006977 Ga0501257_006977_260_1150 293
422 3300049688 Ga0501259_001418 Ga0501259_001418_3072_3962 293
423 3300049763 Ga0501266_001347 Ga0501266_001347_1276_2166 293
424 3300053085 Ga0495619_0050991 Ga0495619_0050991_440_1330 293

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00756

Esterase

Putative esterase

19

267

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
4rgy-assembly1.cif.gz_B-2 structural and functional analysis of a low-temperature-active alkaline esterase from south china sea marine sediment microbial metagenomic library 0.8901 23 287
5vol-assembly2.cif.gz_H bacint_04212 ferulic acid esterase 0.883 22 289
7xrv-assembly1.cif.gz_H bacteroides thetaiotaomicron ferulic acid esterase - s150a (bt_4077-s150a) complex with trans-methylferulate 0.8815 21 293
5vol-assembly2.cif.gz_G bacint_04212 ferulic acid esterase 0.8811 22 289
2uz0-assembly1.cif.gz_D the crystal crystal structure of the esta protein, a virulence factor esta protein from streptococcus pneumonia 0.8809 20 286
ID Description Score Start End Superfamily
4rgyB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8901 23 287 3.40.50.1820
4rgyB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8794 23 287 3.40.50.1820
af_O33364_74_300_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8699 30 287 3.40.50.1820
2uz0B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8693 21 286 3.40.50.1820
af_Q2FUY3_1_252_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8625 24 286 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A3M1UVF3-F1-model_v4 Esterase family protein 0.9943 33 292 GO:0016747
AF-I0K3K7-F1-model_v4 Putative esterase 0.9891 33 292 GO:0016747
AF-A0A2N7Q9H4-F1-model_v4 Esterase 0.9879 18 292 GO:0016747
AF-A0A350D5B6-F1-model_v4 Esterase 0.9851 66 292 GO:0016747
AF-A0A251WLH7-F1-model_v4 Esterase 0.9844 32 293 GO:0016747

Feature Viewer

pLDDT pTM Quality
93.4 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map