F440694

General Info

Members Datasets Scaffolds Average Seq Length
424 221 848 212

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100662229|Ga0070714_1006622292
Length 221
Sequence VIHVNRLPTLVRQHIAAFRALLVFTVLCGIIYPVVMVGVAQVAFKNQADGSLVTYNGKVVGSSLLCQEFVDAKGNPLPQYFQPRPSNASSSSVKNDYGCDANYSGAANLGPNNTTLLKTVQQLQQQIAAFDHVKVSQIPPDAVTSSGSGLDPDISPQYAAIQVNRVAAARQLPVSQVQALVSKYTQGRNLGFLGEPRVNVLNLNIALDELPGQAKYAQAGA

Samples

Sample ID Description Type Environment
1 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
44 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
45 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
63 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
71 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
73 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
75 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
114 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
115 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
116 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
117 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
118 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
119 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
120 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
121 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
122 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
123 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
124 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
125 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
126 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
127 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
128 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
129 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
130 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
131 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
132 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
133 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
134 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
135 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
136 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
137 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
138 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
139 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
140 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
141 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
142 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
143 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
144 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
145 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
146 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
147 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
148 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
149 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
150 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
151 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
152 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
153 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
154 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
155 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
156 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
157 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
158 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
159 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
160 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
161 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
162 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
163 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
164 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
165 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
166 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
167 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
168 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
169 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
170 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
171 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
172 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
173 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
174 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
175 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
176 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
177 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
178 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
179 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
180 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
181 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
182 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
183 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
184 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
185 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
186 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
187 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
188 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
189 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
190 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
191 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
192 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
193 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
194 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
195 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
196 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
197 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
198 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
199 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
200 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
201 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
202 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
203 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
204 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
205 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
206 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
207 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
208 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
209 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
210 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
211 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
212 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
213 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
214 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
215 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
216 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
217 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
218 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
219 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
220 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
221 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.82
Metatranscriptomes 1.18
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.54
Rhizosphere 92.92
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070714_100662229 3300005435 Bacteria 1005
2 rootH2_10145482 3300003320 Bacteria 1394
3 Ga0070658_10288371 3300005327 Bacteria 1398
4 Ga0070683_100101539 3300005329 Bacteria 2708
5 Ga0070683_100278705 3300005329 Bacteria 1590
6 Ga0070683_100586726 3300005329 Bacteria 1066
7 Ga0070690_100048587 3300005330 Bacteria 2702
8 Ga0070670_100795461 3300005331 Bacteria 854
9 Ga0070666_10177841 3300005335 Bacteria 1492
10 Ga0070660_100052478 3300005339 Bacteria 3144
11 Ga0070660_100420504 3300005339 Bacteria 1107
12 Ga0070661_100173045 3300005344 Bacteria 1640
13 Ga0070671_100190918 3300005355 Bacteria 1736
14 Ga0070673_100052400 3300005364 Bacteria 3201
15 Ga0070688_100142895 3300005365 Bacteria 1628
16 Ga0070667_100152087 3300005367 Bacteria 2033
17 Ga0070709_10081584 3300005434 Bacteria 2111
18 Ga0070709_10184715 3300005434 Bacteria 1467
19 Ga0070709_10205371 3300005434 Bacteria 1397
20 Ga0070709_10302380 3300005434 Bacteria 1169
21 Ga0070714_100043602 3300005435 Bacteria 3794
22 Ga0070714_100144775 3300005435 Bacteria 2136
23 Ga0070714_100210651 3300005435 Bacteria 1781
24 Ga0070714_100434926 3300005435 Bacteria 1244
25 Ga0070714_100480963 3300005435 Bacteria 1182
26 Ga0070713_100062645 3300005436 Bacteria 3115
27 Ga0070713_100138334 3300005436 Bacteria 2155
28 Ga0070713_100219471 3300005436 Bacteria 1724
29 Ga0070713_100316372 3300005436 Bacteria 1440
30 Ga0070713_100496252 3300005436 Bacteria 1151
31 Ga0070713_100537900 3300005436 Bacteria 1105
32 Ga0070713_100773331 3300005436 Bacteria 919
33 Ga0070710_10014133 3300005437 Bacteria 4012
34 Ga0070710_10020391 3300005437 Bacteria 3438
35 Ga0070710_10035946 3300005437 Bacteria 2705
36 Ga0070710_10299203 3300005437 Bacteria 1050
37 Ga0070710_10490235 3300005437 Bacteria 839
38 Ga0070711_100047909 3300005439 Bacteria 2919
39 Ga0070711_100049529 3300005439 Bacteria 2877
40 Ga0070711_100256301 3300005439 Bacteria 1374
41 Ga0070711_100278899 3300005439 Bacteria 1321
42 Ga0070711_100725132 3300005439 Bacteria 838
43 Ga0070705_100287737 3300005440 Bacteria 1172
44 Ga0070708_100178506 3300005445 Bacteria 1984
45 Ga0070708_100233678 3300005445 Bacteria 1725
46 Ga0070708_100858912 3300005445 Bacteria 852
47 Ga0070663_100182799 3300005455 Bacteria 1628
48 Ga0070663_100205467 3300005455 Bacteria 1539
49 Ga0070678_100224013 3300005456 Bacteria 1564
50 Ga0070681_10126397 3300005458 Bacteria 2489
51 Ga0070706_100027776 3300005467 Bacteria 5204
52 Ga0070706_100048274 3300005467 Bacteria 3929
53 Ga0070706_100051366 3300005467 Bacteria 3805
54 Ga0070706_100157194 3300005467 Bacteria 2122
55 Ga0070707_100026608 3300005468 Bacteria 5495
56 Ga0070707_100039270 3300005468 Bacteria 4523
57 Ga0070707_100044987 3300005468 Bacteria 4226
58 Ga0070707_100271504 3300005468 Bacteria 1649
59 Ga0070707_100433662 3300005468 Bacteria 1274
60 Ga0070707_100950377 3300005468 Bacteria 824
61 Ga0070698_100009238 3300005471 Bacteria 10577
62 Ga0070698_100050855 3300005471 Bacteria 4222
63 Ga0070698_100108259 3300005471 Bacteria 2746
64 Ga0070698_100182894 3300005471 Bacteria 2034
65 Ga0070698_100838900 3300005471 Bacteria 864
66 Ga0070699_100053781 3300005518 Bacteria 3484
67 Ga0070699_100109615 3300005518 Bacteria 2423
68 Ga0070699_100214238 3300005518 Bacteria 1715
69 Ga0070699_100229185 3300005518 Bacteria 1656
70 Ga0070699_100322534 3300005518 Bacteria 1388
71 Ga0070684_100061091 3300005535 Bacteria 3297
72 Ga0070697_100042255 3300005536 Bacteria 3689
73 Ga0070697_100088697 3300005536 Bacteria 2555
74 Ga0070697_100343321 3300005536 Bacteria 1289
75 Ga0068853_100088166 3300005539 Bacteria 2723
76 Ga0070696_100636500 3300005546 Bacteria 863
77 Ga0070693_100012966 3300005547 Bacteria 4234
78 Ga0070665_100431053 3300005548 Bacteria 1327
79 Ga0070665_100699524 3300005548 Bacteria 1027
80 Ga0068855_100004069 3300005563 Bacteria 17845
81 Ga0070664_100019794 3300005564 Bacteria 5539
82 Ga0070664_100604762 3300005564 Bacteria 1017
83 Ga0068857_100658704 3300005577 Bacteria 993
84 Ga0068854_100070516 3300005578 Bacteria 2554
85 Ga0068856_100885790 3300005614 Bacteria 911
86 Ga0068852_100009411 3300005616 Bacteria 7257
87 Ga0068852_100518863 3300005616 Bacteria 1189
88 Ga0068864_100042113 3300005618 Bacteria 3907
89 Ga0068864_100265608 3300005618 Bacteria 1597
90 Ga0068866_10178749 3300005718 Bacteria 1252
91 Ga0068861_100258611 3300005719 Bacteria 1489
92 Ga0068863_100538125 3300005841 Bacteria 1152
93 Ga0081540_1000037 3300005983 Bacteria 139165
94 Ga0070717_10120350 3300006028 Bacteria 2248
95 Ga0070717_10224096 3300006028 Bacteria 1653
96 Ga0070717_10243555 3300006028 Bacteria 1586
97 Ga0070717_10249601 3300006028 Bacteria 1567
98 Ga0070717_10463966 3300006028 Bacteria 1142
99 Ga0070715_10012325 3300006163 Bacteria 3108
100 Ga0070712_100061643 3300006175 Bacteria 2650
101 Ga0070712_100184633 3300006175 Bacteria 1627
102 Ga0070712_100189472 3300006175 Bacteria 1608
103 Ga0070712_100297399 3300006175 Bacteria 1305
104 Ga0070712_100471224 3300006175 Bacteria 1048
105 Ga0070712_100536536 3300006175 Bacteria 984
106 Ga0070712_100997890 3300006175 Bacteria 724
107 Ga0097621_100139824 3300006237 Bacteria 2068
108 Ga0075433_10101064 3300006852 Bacteria 2553
109 Ga0075434_100036477 3300006871 Bacteria 4863
110 Ga0075436_100495052 3300006914 Bacteria 894
111 Ga0075435_100049154 3300007076 Bacteria 3390
112 Ga0105240_10033937 3300009093 Bacteria 6589
113 Ga0105245_11495056 3300009098 Bacteria 726
114 Ga0105247_10297334 3300009101 Bacteria 1119
115 Ga0114129_10351845 3300009147 Bacteria 1951
116 Ga0105241_10056968 3300009174 Bacteria 2997
117 Ga0105241_10184903 3300009174 Bacteria 1731
118 Ga0105248_10068662 3300009177 Bacteria 3979
119 Ga0105237_10444206 3300009545 Bacteria 1303
120 Ga0105237_10611844 3300009545 Bacteria 1096
121 Ga0105238_10008091 3300009551 Bacteria 10515
122 Ga0105249_10348613 3300009553 Bacteria 1499
123 Ga0105239_10420707 3300010375 Bacteria 1513
124 Ga0105239_11122510 3300010375 Bacteria 905
125 Ga0157373_10097446 3300013100 Bacteria 2070
126 Ga0157371_10107097 3300013102 Bacteria 1984
127 Ga0157370_10039008 3300013104 Bacteria 4593
128 Ga0157369_10099341 3300013105 Bacteria 3103
129 Ga0157369_10499971 3300013105 Bacteria 1258
130 Ga0157374_10084161 3300013296 Bacteria 3023
131 Ga0157378_10213566 3300013297 Bacteria 1830
132 Ga0157378_10624982 3300013297 Bacteria 1090
133 Ga0163162_11590112 3300013306 Bacteria 746
134 Ga0157375_10906735 3300013308 Bacteria 1025
135 Ga0157377_10224880 3300014745 Bacteria 1203
136 Ga0206353_10624823 3300020082 Bacteria 1522
137 Ga0213875_10000296 3300021388 Bacteria 48024
138 Ga0224712_10008672 3300022467 Bacteria 3027
139 Ga0224712_10056625 3300022467 Bacteria 1546
140 Ga0224712_10059312 3300022467 Bacteria 1519
141 Ga0224572_1016151 3300024225 Bacteria 1432
142 Ga0207653_10007858 3300025885 Bacteria 3324
143 Ga0207692_10044728 3300025898 Bacteria 2211
144 Ga0207692_10050479 3300025898 Bacteria 2104
145 Ga0207692_10074837 3300025898 Bacteria 1795
146 Ga0207692_10176657 3300025898 Bacteria 1241
147 Ga0207692_10311223 3300025898 Bacteria 961
148 Ga0207692_10320609 3300025898 Bacteria 948
149 Ga0207688_10167126 3300025901 Bacteria 1307
150 Ga0207680_10365515 3300025903 Bacteria 1015
151 Ga0207647_10003995 3300025904 Bacteria 10996
152 Ga0207685_10086895 3300025905 Bacteria 1308
153 Ga0207699_10015250 3300025906 Bacteria 3987
154 Ga0207699_10102437 3300025906 Bacteria 1819
155 Ga0207699_10173729 3300025906 Bacteria 1443
156 Ga0207699_10220213 3300025906 Bacteria 1295
157 Ga0207699_10269395 3300025906 Bacteria 1180
158 Ga0207699_10456736 3300025906 Bacteria 917
159 Ga0207645_10070295 3300025907 Bacteria 2239
160 Ga0207643_10097971 3300025908 Bacteria 1716
161 Ga0207684_10034202 3300025910 Bacteria 4319
162 Ga0207684_10035028 3300025910 Bacteria 4263
163 Ga0207684_10037405 3300025910 Bacteria 4118
164 Ga0207684_10144782 3300025910 Bacteria 2044
165 Ga0207684_10180125 3300025910 Bacteria 1822
166 Ga0207707_10111715 3300025912 Bacteria 2389
167 Ga0207695_10011072 3300025913 Bacteria 10955
168 Ga0207671_10001775 3300025914 Bacteria 24235
169 Ga0207693_10116169 3300025915 Bacteria 2101
170 Ga0207693_10207803 3300025915 Bacteria 1539
171 Ga0207693_10284887 3300025915 Bacteria 1295
172 Ga0207693_10366404 3300025915 Bacteria 1127
173 Ga0207693_10452582 3300025915 Bacteria 1003
174 Ga0207663_10799173 3300025916 Bacteria 751
175 Ga0207660_10351363 3300025917 Bacteria 1181
176 Ga0207662_10001633 3300025918 Bacteria 10970
177 Ga0207657_10067117 3300025919 Bacteria 3051
178 Ga0207649_10319491 3300025920 Bacteria 1140
179 Ga0207646_10013955 3300025922 Bacteria 7657
180 Ga0207646_10053788 3300025922 Bacteria 3601
181 Ga0207646_10064571 3300025922 Bacteria 3268
182 Ga0207646_10318896 3300025922 Bacteria 1404
183 Ga0207646_10339564 3300025922 Bacteria 1357
184 Ga0207646_10430099 3300025922 Bacteria 1191
185 Ga0207694_10001875 3300025924 Bacteria 17434
186 Ga0207700_10016104 3300025928 Bacteria 4957
187 Ga0207700_10045907 3300025928 Bacteria 3227
188 Ga0207700_10102105 3300025928 Bacteria 2289
189 Ga0207700_10115052 3300025928 Bacteria 2171
190 Ga0207664_10010756 3300025929 Bacteria 6473
191 Ga0207664_10016673 3300025929 Bacteria 5365
192 Ga0207664_10017042 3300025929 Bacteria 5313
193 Ga0207664_10085215 3300025929 Bacteria 2578
194 Ga0207664_10331571 3300025929 Bacteria 1344
195 Ga0207664_10406046 3300025929 Bacteria 1212
196 Ga0207664_10430593 3300025929 Bacteria 1176
197 Ga0207664_10622736 3300025929 Bacteria 970
198 Ga0207664_10662717 3300025929 Bacteria 938
199 Ga0207686_10302912 3300025934 Bacteria 1187
200 Ga0207665_10038800 3300025939 Bacteria 3174
201 Ga0207665_10212938 3300025939 Bacteria 1413
202 Ga0207711_10398704 3300025941 Bacteria 1278
203 Ga0207689_10005063 3300025942 Bacteria 11881
204 Ga0207679_10460317 3300025945 Bacteria 1129
205 Ga0207667_10106952 3300025949 Bacteria 2885
206 Ga0207667_10110646 3300025949 Bacteria 2833
207 Ga0207651_10331763 3300025960 Bacteria 1275
208 Ga0207640_10076675 3300025981 Bacteria 2270
209 Ga0207703_10410483 3300026035 Bacteria 1258
210 Ga0207678_10009985 3300026067 Bacteria 8329
211 Ga0207678_10075383 3300026067 Bacteria 2890
212 Ga0207678_10096518 3300026067 Bacteria 2526
213 Ga0207674_10064485 3300026116 Bacteria 3695
214 Ga0207674_10157698 3300026116 Bacteria 2224
215 Ga0207675_100036983 3300026118 Bacteria 4554
216 Ga0207683_10003132 3300026121 Bacteria 14449
217 Ga0207698_10004610 3300026142 Bacteria 8421
218 Ga0268266_10413258 3300028379 Bacteria 1277
219 Ga0265337_1010356 3300028556 Bacteria 3270
220 Ga0265326_10022423 3300028558 Bacteria 1808
221 Ga0265319_1010161 3300028563 Bacteria 3946
222 Ga0265334_10005189 3300028573 Bacteria 5707
223 Ga0265336_10007464 3300028666 Bacteria 3885
224 Ga0265338_10003278 3300028800 Bacteria 22963
225 Ga0265338_10007170 3300028800 Bacteria 13959
226 Ga0265338_10013043 3300028800 Bacteria 9424
227 Ga0265766_1004159 3300030863 Bacteria 872
228 Ga0265332_10015887 3300031238 Bacteria 3321
229 Ga0265314_10013123 3300031711 Bacteria 6712
230 Ga0265342_10001095 3300031712 Bacteria 26056
231 Ga0316215_1003733 3300033544 Bacteria 1457
232 Ga0316214_1000454 3300033545 Bacteria 4165
233 Ga0316212_1019569 3300033547 Bacteria 950
234 Ga0373958_0002255 3300034819 Bacteria 2685
235 Ga0373926_0009322 3300035083 Bacteria 3278
236 Ga0373934_0101064 3300035086 Bacteria 1166
237 Ga0373944_0000460 3300035089 Bacteria 9461
238 Ga0373936_0002696 3300035113 Bacteria 6629
239 Ga0373936_0112006 3300035113 Bacteria 1159
240 Ga0373945_0002140 3300035116 Bacteria 6161
241 Ga0373945_0173695 3300035116 Bacteria 884
242 Ga0373953_0232377 3300035117 Bacteria 800
243 Ga0373953_0440117 3300035117 Bacteria 575
244 Ga0373956_0244375 3300035119 Bacteria 853
245 Ga0373960_0039674 3300035121 Bacteria 1355
246 Ga0373943_0000119 3300035170 Bacteria 29368
247 Ga0373943_0140505 3300035170 Bacteria 1300
248 Ga0373946_0001251 3300035171 Bacteria 8788
249 Ga0373946_0224392 3300035171 Bacteria 908
250 Ga0373955_0085912 3300035172 Bacteria 1786
251 Ga0373955_0123860 3300035172 Bacteria 1504
252 Ga0373961_0112795 3300035241 Bacteria 892
253 Ga0373962_0041235 3300035242 Bacteria 1301
254 Ga0373924_0010841 3300035410 Bacteria 3373
255 Ga0373931_0049258 3300035691 Bacteria 2236
256 Ga0373935_0004249 3300035692 Bacteria 8399
257 Ga0373935_0547620 3300035692 Bacteria 843
258 Ga0373927_0039799 3300035695 Bacteria 3050
259 Ga0373933_0249085 3300035724 Bacteria 1144
260 Ga0373933_0273574 3300035724 Bacteria 1090
261 Ga0373947_0000141 3300035725 Bacteria 37478
262 Ga0373937_0065873 3300036401 Bacteria 3335
263 Ga0373937_0246841 3300036401 Bacteria 1682
264 Ga0373937_0451075 3300036401 Bacteria 1221
265 Ga0373937_0581462 3300036401 Bacteria 1063
266 Ga0373937_0792287 3300036401 Bacteria 895
267 Ga0373937_0876520 3300036401 Bacteria 846
268 Ga0373925_0000133 3300037068 Bacteria 79228
269 Ga0373925_0009227 3300037068 Bacteria 7180
270 Ga0436364_0483766 3300037853 Bacteria 3269
271 Ga0436364_0868672 3300037853 Bacteria 1116
272 Ga0436364_1006028 3300037853 Bacteria 867
273 Ga0436364_1014034 3300037853 Bacteria 63349
274 Ga0436360_0107144 3300039438 Bacteria 795
275 Ga0436363_0365555 3300039450 Bacteria 1927
276 Ga0436363_0984378 3300039450 Bacteria 817
277 Ga0436362_0980066 3300039453 Bacteria 1079
278 Ga0466969_0008709 3300044656 Bacteria 5380
279 Ga0466969_0060935 3300044656 Bacteria 1834
280 Ga0466963_0591486 3300044694 Bacteria 784
281 Ga0466970_0036662 3300044765 Bacteria 2598
282 Ga0466970_0078387 3300044765 Bacteria 1782
283 Ga0466959_0478985 3300045049 Bacteria 842
284 Ga0466958_0213320 3300045836 Bacteria 1231
285 Ga0466967_0146623 3300045976 Bacteria 2202
286 Ga0466967_0969142 3300045976 Bacteria 846
287 Ga0466967_1673732 3300045976 Bacteria 634
288 Ga0495592_0037448 3300046454 Bacteria 3652
289 Ga0495603_0081355 3300046455 Bacteria 1898
290 Ga0495629_0164747 3300046459 Bacteria 1539
291 Ga0495641_0047703 3300046461 Bacteria 1965
292 Ga0495641_0056042 3300046461 Bacteria 1787
293 Ga0495651_0042489 3300046462 Bacteria 3529
294 Ga0495651_0098168 3300046462 Bacteria 2186
295 Ga0495651_0174486 3300046462 Bacteria 1527
296 Ga0495651_0227046 3300046462 Bacteria 1288
297 Ga0495651_0284562 3300046462 Bacteria 1115
298 Ga0495651_0400390 3300046462 Bacteria 896
299 Ga0495653_0010244 3300046463 Bacteria 7669
300 Ga0495653_0163111 3300046463 Bacteria 1545
301 Ga0495653_0241124 3300046463 Bacteria 1205
302 Ga0495653_0254760 3300046463 Bacteria 1163
303 Ga0495653_0312818 3300046463 Bacteria 1020
304 Ga0495639_0207696 3300046475 Bacteria 960
305 Ga0495664_0005726 3300046477 Bacteria 6842
306 Ga0495664_0150916 3300046477 Bacteria 1409
307 Ga0495608_0018984 3300046511 Bacteria 4738
308 Ga0495608_0025388 3300046511 Bacteria 4045
309 Ga0495608_0235198 3300046511 Bacteria 1146
310 Ga0495618_0189836 3300046514 Bacteria 1303
311 Ga0495618_0338874 3300046514 Bacteria 928
312 Ga0495618_0510723 3300046514 Bacteria 723
313 Ga0495628_0039487 3300046516 Bacteria 3775
314 Ga0495628_0074436 3300046516 Bacteria 2645
315 Ga0495628_0471697 3300046516 Bacteria 909
316 Ga0495630_0077174 3300046517 Bacteria 2511
317 Ga0495630_0417837 3300046517 Bacteria 1027
318 Ga0495666_0137537 3300046526 Bacteria 1140
319 Ga0495652_0004482 3300046529 Bacteria 13335
320 Ga0495652_0208832 3300046529 Bacteria 1476
321 Ga0495652_0255824 3300046529 Bacteria 1295
322 Ga0495652_0344008 3300046529 Bacteria 1070
323 Ga0495665_0049231 3300046531 Bacteria 2234
324 Ga0495640_0256040 3300046533 Bacteria 1095
325 Ga0495640_0312405 3300046533 Bacteria 974
326 Ga0495640_0340683 3300046533 Bacteria 926
327 Ga0495587_0062794 3300046536 Bacteria 2174
328 Ga0495587_0128123 3300046536 Bacteria 1451
329 Ga0495587_0131827 3300046536 Bacteria 1428
330 Ga0495587_0167187 3300046536 Bacteria 1250
331 Ga0495587_0292896 3300046536 Bacteria 911
332 Ga0495645_0057708 3300046543 Bacteria 2817
333 Ga0495645_0081711 3300046543 Bacteria 2318
334 Ga0495645_0140602 3300046543 Bacteria 1684
335 Ga0495645_0646414 3300046543 Bacteria 646
336 Ga0495667_0012304 3300046559 Bacteria 5800
337 Ga0495667_0075398 3300046559 Bacteria 2195
338 Ga0495667_0181603 3300046559 Bacteria 1350
339 Ga0495667_0200817 3300046559 Bacteria 1276
340 Ga0495667_0213955 3300046559 Bacteria 1231
341 Ga0495634_0054144 3300046642 Bacteria 2686
342 Ga0495634_0408161 3300046642 Bacteria 806
343 Ga0495635_0170813 3300046663 Bacteria 1478
344 Ga0495635_0215867 3300046663 Bacteria 1298
345 Ga0495635_0266634 3300046663 Bacteria 1152
346 Ga0495635_0327068 3300046663 Bacteria 1025
347 Ga0495657_0038594 3300046675 Bacteria 3286
348 Ga0495657_0040979 3300046675 Bacteria 3172
349 Ga0495657_0070722 3300046675 Bacteria 2280
350 Ga0495657_0147555 3300046675 Bacteria 1462
351 Ga0495657_0258005 3300046675 Bacteria 1048
352 Ga0495599_0069414 3300046678 Bacteria 2199
353 Ga0495599_0141184 3300046678 Bacteria 1494
354 Ga0495599_0164524 3300046678 Bacteria 1370
355 Ga0495599_0249913 3300046678 Bacteria 1079
356 Ga0495599_0253417 3300046678 Bacteria 1071
357 Ga0495623_0068913 3300046679 Bacteria 2205
358 Ga0495646_0263843 3300046680 Bacteria 919
359 Ga0495647_0168878 3300046681 Bacteria 946
360 Ga0495658_0165172 3300046683 Bacteria 1367
361 Ga0495613_0031072 3300046689 Bacteria 3966
362 Ga0495624_0023759 3300046690 Bacteria 4039
363 Ga0495600_0062077 3300046809 Bacteria 2441
364 Ga0495600_0155684 3300046809 Bacteria 1478
365 Ga0495600_0193208 3300046809 Bacteria 1308
366 Ga0495600_0360704 3300046809 Bacteria 909
367 Ga0495581_0066461 3300047315 Bacteria 2085
368 Ga0495604_0064013 3300047317 Bacteria 2804
369 Ga0495604_0225709 3300047317 Bacteria 1287
370 Ga0495604_0270059 3300047317 Bacteria 1152
371 Ga0495604_0387106 3300047317 Bacteria 923
372 Ga0495604_0406248 3300047317 Bacteria 896
373 Ga0495674_0000739 3300047319 Bacteria 30884
374 Ga0495674_0159101 3300047319 Bacteria 1890
375 Ga0495674_0229010 3300047319 Bacteria 1534
376 Ga0495674_0294639 3300047319 Bacteria 1326
377 Ga0495676_0010020 3300047321 Bacteria 8609
378 Ga0495680_0009755 3300047322 Bacteria 8613
379 Ga0495680_0012804 3300047322 Bacteria 7353
380 Ga0495680_0015991 3300047322 Bacteria 6455
381 Ga0495680_0034924 3300047322 Bacteria 4055
382 Ga0495680_0050158 3300047322 Bacteria 3264
383 Ga0495675_0077428 3300047444 Bacteria 2095
384 Ga0495684_0003670 3300047471 Bacteria 11965
385 Ga0495684_0085946 3300047471 Bacteria 2385
386 Ga0495684_0257037 3300047471 Bacteria 1268
387 Ga0495684_0276065 3300047471 Bacteria 1214
388 Ga0495684_0295227 3300047471 Bacteria 1165
389 Ga0495684_0453388 3300047471 Bacteria 891
390 Ga0495593_0131827 3300047673 Bacteria 1268
391 Ga0495602_0202774 3300048088 Bacteria 1512
392 Ga0495602_0284926 3300048088 Bacteria 1215
393 Ga0495614_0109095 3300048089 Bacteria 1214
394 Ga0496102_0742334 3300048905 Bacteria 904
395 Ga0496103_0101393 3300048906 Bacteria 1822
396 Ga0496104_0129331 3300048907 Bacteria 2425
397 Ga0496105_0036193 3300048908 Bacteria 4065
398 Ga0496105_0496963 3300048908 Bacteria 958
399 Ga0496107_0164040 3300048910 Bacteria 1647
400 Ga0496108_0041187 3300048911 Bacteria 3854
401 Ga0496109_0055635 3300048912 Bacteria 3609
402 Ga0496109_0391582 3300048912 Bacteria 1313
403 Ga0496109_0519456 3300048912 Bacteria 1124
404 Ga0496110_0250540 3300048913 Bacteria 1612
405 Ga0496111_0294393 3300048914 Bacteria 1203
406 Ga0496111_0975343 3300048914 Bacteria 608
407 Ga0496112_0904819 3300048915 Bacteria 804
408 Ga0496115_0467908 3300048918 Bacteria 1016
409 Ga0496118_0162535 3300048921 Bacteria 1378
410 Ga0496119_0097562 3300048922 Bacteria 1656
411 Ga0496126_0380032 3300048929 Bacteria 1150
412 Ga0496126_0639549 3300048929 Bacteria 834
413 Ga0501071_0225587 3300049587 Bacteria 1411
414 Ga0501045_0815544 3300049824 Bacteria 687
415 nmdc:mga05p37_544349_c1 3300050507 Bacteria 1323
416 nmdc:mga0n895_34668_c1 3300050512 Bacteria 4861
417 nmdc:mga0rr50_319893_c1 3300050513 Bacteria 1301
418 nmdc:mga08x19_339541_c1 3300050514 Bacteria 1047
419 nmdc:mga0a205_75438_c1 3300050515 Bacteria 3258
420 Ga0495601_0250733 3300053077 Bacteria 1156
421 Ga0495619_0197587 3300053085 Bacteria 1392
422 Ga0495619_0380323 3300053085 Bacteria 976
423 Ga0495619_0676410 3300053085 Bacteria 703
424 Ga0501082_1084946 3300060353 Bacteria 700
425 Ga0070714_100662229
426 rootH2_10145482
427 Ga0070658_10288371
428 Ga0070683_100101539
429 Ga0070683_100278705
430 Ga0070683_100586726
431 Ga0070690_100048587
432 Ga0070670_100795461
433 Ga0070666_10177841
434 Ga0070660_100052478
435 Ga0070660_100420504
436 Ga0070661_100173045
437 Ga0070671_100190918
438 Ga0070673_100052400
439 Ga0070688_100142895
440 Ga0070667_100152087
441 Ga0070709_10081584
442 Ga0070709_10184715
443 Ga0070709_10205371
444 Ga0070709_10302380
445 Ga0070714_100043602
446 Ga0070714_100144775
447 Ga0070714_100210651
448 Ga0070714_100434926
449 Ga0070714_100480963
450 Ga0070713_100062645
451 Ga0070713_100138334
452 Ga0070713_100219471
453 Ga0070713_100316372
454 Ga0070713_100496252
455 Ga0070713_100537900
456 Ga0070713_100773331
457 Ga0070710_10014133
458 Ga0070710_10020391
459 Ga0070710_10035946
460 Ga0070710_10299203
461 Ga0070710_10490235
462 Ga0070711_100047909
463 Ga0070711_100049529
464 Ga0070711_100256301
465 Ga0070711_100278899
466 Ga0070711_100725132
467 Ga0070705_100287737
468 Ga0070708_100178506
469 Ga0070708_100233678
470 Ga0070708_100858912
471 Ga0070663_100182799
472 Ga0070663_100205467
473 Ga0070678_100224013
474 Ga0070681_10126397
475 Ga0070706_100027776
476 Ga0070706_100048274
477 Ga0070706_100051366
478 Ga0070706_100157194
479 Ga0070707_100026608
480 Ga0070707_100039270
481 Ga0070707_100044987
482 Ga0070707_100271504
483 Ga0070707_100433662
484 Ga0070707_100950377
485 Ga0070698_100009238
486 Ga0070698_100050855
487 Ga0070698_100108259
488 Ga0070698_100182894
489 Ga0070698_100838900
490 Ga0070699_100053781
491 Ga0070699_100109615
492 Ga0070699_100214238
493 Ga0070699_100229185
494 Ga0070699_100322534
495 Ga0070684_100061091
496 Ga0070697_100042255
497 Ga0070697_100088697
498 Ga0070697_100343321
499 Ga0068853_100088166
500 Ga0070696_100636500
501 Ga0070693_100012966
502 Ga0070665_100431053
503 Ga0070665_100699524
504 Ga0068855_100004069
505 Ga0070664_100019794
506 Ga0070664_100604762
507 Ga0068857_100658704
508 Ga0068854_100070516
509 Ga0068856_100885790
510 Ga0068852_100009411
511 Ga0068852_100518863
512 Ga0068864_100042113
513 Ga0068864_100265608
514 Ga0068866_10178749
515 Ga0068861_100258611
516 Ga0068863_100538125
517 Ga0081540_1000037
518 Ga0070717_10120350
519 Ga0070717_10224096
520 Ga0070717_10243555
521 Ga0070717_10249601
522 Ga0070717_10463966
523 Ga0070715_10012325
524 Ga0070712_100061643
525 Ga0070712_100184633
526 Ga0070712_100189472
527 Ga0070712_100297399
528 Ga0070712_100471224
529 Ga0070712_100536536
530 Ga0070712_100997890
531 Ga0097621_100139824
532 Ga0075433_10101064
533 Ga0075434_100036477
534 Ga0075436_100495052
535 Ga0075435_100049154
536 Ga0105240_10033937
537 Ga0105245_11495056
538 Ga0105247_10297334
539 Ga0114129_10351845
540 Ga0105241_10056968
541 Ga0105241_10184903
542 Ga0105248_10068662
543 Ga0105237_10444206
544 Ga0105237_10611844
545 Ga0105238_10008091
546 Ga0105249_10348613
547 Ga0105239_10420707
548 Ga0105239_11122510
549 Ga0157373_10097446
550 Ga0157371_10107097
551 Ga0157370_10039008
552 Ga0157369_10099341
553 Ga0157369_10499971
554 Ga0157374_10084161
555 Ga0157378_10213566
556 Ga0157378_10624982
557 Ga0163162_11590112
558 Ga0157375_10906735
559 Ga0157377_10224880
560 Ga0206353_10624823
561 Ga0213875_10000296
562 Ga0224712_10008672
563 Ga0224712_10056625
564 Ga0224712_10059312
565 Ga0224572_1016151
566 Ga0207653_10007858
567 Ga0207692_10044728
568 Ga0207692_10050479
569 Ga0207692_10074837
570 Ga0207692_10176657
571 Ga0207692_10311223
572 Ga0207692_10320609
573 Ga0207688_10167126
574 Ga0207680_10365515
575 Ga0207647_10003995
576 Ga0207685_10086895
577 Ga0207699_10015250
578 Ga0207699_10102437
579 Ga0207699_10173729
580 Ga0207699_10220213
581 Ga0207699_10269395
582 Ga0207699_10456736
583 Ga0207645_10070295
584 Ga0207643_10097971
585 Ga0207684_10034202
586 Ga0207684_10035028
587 Ga0207684_10037405
588 Ga0207684_10144782
589 Ga0207684_10180125
590 Ga0207707_10111715
591 Ga0207695_10011072
592 Ga0207671_10001775
593 Ga0207693_10116169
594 Ga0207693_10207803
595 Ga0207693_10284887
596 Ga0207693_10366404
597 Ga0207693_10452582
598 Ga0207663_10799173
599 Ga0207660_10351363
600 Ga0207662_10001633
601 Ga0207657_10067117
602 Ga0207649_10319491
603 Ga0207646_10013955
604 Ga0207646_10053788
605 Ga0207646_10064571
606 Ga0207646_10318896
607 Ga0207646_10339564
608 Ga0207646_10430099
609 Ga0207694_10001875
610 Ga0207700_10016104
611 Ga0207700_10045907
612 Ga0207700_10102105
613 Ga0207700_10115052
614 Ga0207664_10010756
615 Ga0207664_10016673
616 Ga0207664_10017042
617 Ga0207664_10085215
618 Ga0207664_10331571
619 Ga0207664_10406046
620 Ga0207664_10430593
621 Ga0207664_10622736
622 Ga0207664_10662717
623 Ga0207686_10302912
624 Ga0207665_10038800
625 Ga0207665_10212938
626 Ga0207711_10398704
627 Ga0207689_10005063
628 Ga0207679_10460317
629 Ga0207667_10106952
630 Ga0207667_10110646
631 Ga0207651_10331763
632 Ga0207640_10076675
633 Ga0207703_10410483
634 Ga0207678_10009985
635 Ga0207678_10075383
636 Ga0207678_10096518
637 Ga0207674_10064485
638 Ga0207674_10157698
639 Ga0207675_100036983
640 Ga0207683_10003132
641 Ga0207698_10004610
642 Ga0268266_10413258
643 Ga0265337_1010356
644 Ga0265326_10022423
645 Ga0265319_1010161
646 Ga0265334_10005189
647 Ga0265336_10007464
648 Ga0265338_10003278
649 Ga0265338_10007170
650 Ga0265338_10013043
651 Ga0265766_1004159
652 Ga0265332_10015887
653 Ga0265314_10013123
654 Ga0265342_10001095
655 Ga0316215_1003733
656 Ga0316214_1000454
657 Ga0316212_1019569
658 Ga0373958_0002255
659 Ga0373926_0009322
660 Ga0373934_0101064
661 Ga0373944_0000460
662 Ga0373936_0002696
663 Ga0373936_0112006
664 Ga0373945_0002140
665 Ga0373945_0173695
666 Ga0373953_0232377
667 Ga0373953_0440117
668 Ga0373956_0244375
669 Ga0373960_0039674
670 Ga0373943_0000119
671 Ga0373943_0140505
672 Ga0373946_0001251
673 Ga0373946_0224392
674 Ga0373955_0085912
675 Ga0373955_0123860
676 Ga0373961_0112795
677 Ga0373962_0041235
678 Ga0373924_0010841
679 Ga0373931_0049258
680 Ga0373935_0004249
681 Ga0373935_0547620
682 Ga0373927_0039799
683 Ga0373933_0249085
684 Ga0373933_0273574
685 Ga0373947_0000141
686 Ga0373937_0065873
687 Ga0373937_0246841
688 Ga0373937_0451075
689 Ga0373937_0581462
690 Ga0373937_0792287
691 Ga0373937_0876520
692 Ga0373925_0000133
693 Ga0373925_0009227
694 Ga0436364_0483766
695 Ga0436364_0868672
696 Ga0436364_1006028
697 Ga0436364_1014034
698 Ga0436360_0107144
699 Ga0436363_0365555
700 Ga0436363_0984378
701 Ga0436362_0980066
702 Ga0466969_0008709
703 Ga0466969_0060935
704 Ga0466963_0591486
705 Ga0466970_0036662
706 Ga0466970_0078387
707 Ga0466959_0478985
708 Ga0466958_0213320
709 Ga0466967_0146623
710 Ga0466967_0969142
711 Ga0466967_1673732
712 Ga0495592_0037448
713 Ga0495603_0081355
714 Ga0495629_0164747
715 Ga0495641_0047703
716 Ga0495641_0056042
717 Ga0495651_0042489
718 Ga0495651_0098168
719 Ga0495651_0174486
720 Ga0495651_0227046
721 Ga0495651_0284562
722 Ga0495651_0400390
723 Ga0495653_0010244
724 Ga0495653_0163111
725 Ga0495653_0241124
726 Ga0495653_0254760
727 Ga0495653_0312818
728 Ga0495639_0207696
729 Ga0495664_0005726
730 Ga0495664_0150916
731 Ga0495608_0018984
732 Ga0495608_0025388
733 Ga0495608_0235198
734 Ga0495618_0189836
735 Ga0495618_0338874
736 Ga0495618_0510723
737 Ga0495628_0039487
738 Ga0495628_0074436
739 Ga0495628_0471697
740 Ga0495630_0077174
741 Ga0495630_0417837
742 Ga0495666_0137537
743 Ga0495652_0004482
744 Ga0495652_0208832
745 Ga0495652_0255824
746 Ga0495652_0344008
747 Ga0495665_0049231
748 Ga0495640_0256040
749 Ga0495640_0312405
750 Ga0495640_0340683
751 Ga0495587_0062794
752 Ga0495587_0128123
753 Ga0495587_0131827
754 Ga0495587_0167187
755 Ga0495587_0292896
756 Ga0495645_0057708
757 Ga0495645_0081711
758 Ga0495645_0140602
759 Ga0495645_0646414
760 Ga0495667_0012304
761 Ga0495667_0075398
762 Ga0495667_0181603
763 Ga0495667_0200817
764 Ga0495667_0213955
765 Ga0495634_0054144
766 Ga0495634_0408161
767 Ga0495635_0170813
768 Ga0495635_0215867
769 Ga0495635_0266634
770 Ga0495635_0327068
771 Ga0495657_0038594
772 Ga0495657_0040979
773 Ga0495657_0070722
774 Ga0495657_0147555
775 Ga0495657_0258005
776 Ga0495599_0069414
777 Ga0495599_0141184
778 Ga0495599_0164524
779 Ga0495599_0249913
780 Ga0495599_0253417
781 Ga0495623_0068913
782 Ga0495646_0263843
783 Ga0495647_0168878
784 Ga0495658_0165172
785 Ga0495613_0031072
786 Ga0495624_0023759
787 Ga0495600_0062077
788 Ga0495600_0155684
789 Ga0495600_0193208
790 Ga0495600_0360704
791 Ga0495581_0066461
792 Ga0495604_0064013
793 Ga0495604_0225709
794 Ga0495604_0270059
795 Ga0495604_0387106
796 Ga0495604_0406248
797 Ga0495674_0000739
798 Ga0495674_0159101
799 Ga0495674_0229010
800 Ga0495674_0294639
801 Ga0495676_0010020
802 Ga0495680_0009755
803 Ga0495680_0012804
804 Ga0495680_0015991
805 Ga0495680_0034924
806 Ga0495680_0050158
807 Ga0495675_0077428
808 Ga0495684_0003670
809 Ga0495684_0085946
810 Ga0495684_0257037
811 Ga0495684_0276065
812 Ga0495684_0295227
813 Ga0495684_0453388
814 Ga0495593_0131827
815 Ga0495602_0202774
816 Ga0495602_0284926
817 Ga0495614_0109095
818 Ga0496102_0742334
819 Ga0496103_0101393
820 Ga0496104_0129331
821 Ga0496105_0036193
822 Ga0496105_0496963
823 Ga0496107_0164040
824 Ga0496108_0041187
825 Ga0496109_0055635
826 Ga0496109_0391582
827 Ga0496109_0519456
828 Ga0496110_0250540
829 Ga0496111_0294393
830 Ga0496111_0975343
831 Ga0496112_0904819
832 Ga0496115_0467908
833 Ga0496118_0162535
834 Ga0496119_0097562
835 Ga0496126_0380032
836 Ga0496126_0639549
837 Ga0501071_0225587
838 Ga0501045_0815544
839 nmdc:mga05p37_544349_c1
840 nmdc:mga0n895_34668_c1
841 nmdc:mga0rr50_319893_c1
842 nmdc:mga08x19_339541_c1
843 nmdc:mga0a205_75438_c1
844 Ga0495601_0250733
845 Ga0495619_0197587
846 Ga0495619_0380323
847 Ga0495619_0676410
848 Ga0501082_1084946

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02669

KdpC

K+-transporting ATPase, c chain

14

209

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bh2-assembly1.cif.gz_C cryo-em structure of kdpfabc in e2pi state with bef3 and k+ 0.7093 13 208
6hra-assembly1.cif.gz_C cryo-em structure of the kdpfabc complex in an e1 outward-facing state (state 1) 0.7002 13 208
6hra-assembly1.cif.gz_C cryo-em structure of the kdpfabc complex in an e1 outward-facing state (state 1) 0.6915 13 208
7bh2-assembly1.cif.gz_C cryo-em structure of kdpfabc in e2pi state with bef3 and k+ 0.6907 13 208
3h0d-assembly1.cif.gz_B crystal structure of ctsr in complex with a 26bp dna duplex 0.5253 147 208
ID Description Score Start End Superfamily
2flzA00 Alpha Beta;2-Layer Sandwich;Macrophage Migration Inhibitory Factor;Macrophage Migration Inhibitory Factor 0.646 153 171 3.30.429.10
af_F4IFN6_1472_1848_3.90.1600.10 Alpha Beta;Alpha-Beta Complex;Palm domain of DNA polymerase;B family DNA polymerase, palm domain 0.5398 111 169 3.90.1600.10
5i44J00 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.5246 159 207 1.10.1660.10
af_O94424_188_254_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.5223 159 194 1.10.10.10
af_Q9VFT7_637_714_1.10.238.10 Mainly Alpha;Orthogonal Bundle;Recoverin; domain 1;EF-hand 0.4995 112 199 1.10.238.10
ID Description Score Start End GO Terms
AF-A0A8B3G858-F1-model_v4 deleted 0.9814 150 205
AF-A0A658NX10-F1-model_v4 Potassium-transporting ATPase subunit C 0.9421 145 205 GO:0005524
GO:0005886
GO:0008556
AF-A0A4Q6CGJ9-F1-model_v4 deleted 0.9394 150 206
AF-A0A3M3AR04-F1-model_v4 Potassium-transporting ATPase C chain 0.9376 140 205 GO:0005524
GO:0005886
GO:0008556
AF-A0A846ZH78-F1-model_v4 Potassium-transporting ATPase subunit C 0.9327 147 206 GO:0005524
GO:0005886
GO:0008556

Map