F440508

General Info

Members Datasets Scaffolds Average Seq Length
423 236 846 98

Family's Representative Sequence

Representative Sequence 3300009148|Ga0105243_10011348|Ga0105243_100113483
Length 117
Sequence LDTYVRDILRVLMNPKGVLMSPKFGVLALLEAKPGKGDDLGKFLEAGRELAVAEPATVTWYAFKISDTQYGIFDTFDDEEGRQAHLGGQIPAALGEVAEELLAKAPDIRTVDVSAVK

Samples

Sample ID Description Type Environment
1 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
52 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
135 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
139 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
140 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
141 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
142 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
143 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
144 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
145 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
146 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
147 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
148 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
149 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
150 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
151 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
152 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
153 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
154 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
155 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
156 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
157 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
158 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
159 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
160 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
161 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
162 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
163 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
164 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
165 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
166 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
167 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
168 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
169 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
170 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
171 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
172 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
173 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
174 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
175 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
176 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
177 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
178 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
179 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
180 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
181 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
182 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
183 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
184 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
185 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
186 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
187 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
188 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
189 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
190 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
191 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
192 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
193 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
194 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
195 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
196 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
197 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
198 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
199 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
200 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
201 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
202 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
203 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
204 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
205 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
206 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
207 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
208 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
209 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
210 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
211 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
212 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
213 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
214 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
215 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
216 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
217 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
218 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
219 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
220 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
221 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
222 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
223 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
224 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
225 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
226 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
227 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
228 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
229 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
230 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
231 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
232 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
233 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
234 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
235 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
236 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.53
Metatranscriptomes 0.47
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.71
Nodule 0
Rhizoplane 15.6
Rhizosphere 82.74
Stem 0
Stem Tuber 0
Unclassified 13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105243_10011348 3300009148 Bacteria 6743
2 JGI24752J21851_1065715 3300001976 Unclassified 505
3 JGI25407J50210_10031202 3300003373 Bacteria 1380
4 JGI25405J52794_10010661 3300003911 Unclassified 1751
5 Ga0070676_10912039 3300005328 Unclassified 655
6 Ga0070683_100526176 3300005329 Bacteria 1130
7 Ga0070670_100985244 3300005331 Unclassified 766
8 Ga0068869_101786581 3300005334 Bacteria 550
9 Ga0070666_10086095 3300005335 Bacteria 2153
10 Ga0070682_100046778 3300005337 Bacteria 2687
11 Ga0070682_101376166 3300005337 Bacteria 602
12 Ga0068868_101993474 3300005338 Bacteria 551
13 Ga0070660_101696046 3300005339 Bacteria 538
14 Ga0070687_101444914 3300005343 Bacteria 515
15 Ga0070692_10311259 3300005345 Bacteria 965
16 Ga0070692_10352198 3300005345 Bacteria 915
17 Ga0070668_100052730 3300005347 Bacteria 3136
18 Ga0070668_100082644 3300005347 Unclassified 2519
19 Ga0070669_100159508 3300005353 Bacteria 1752
20 Ga0070671_100080133 3300005355 Bacteria 2730
21 Ga0070674_100602019 3300005356 Unclassified 929
22 Ga0070674_100832387 3300005356 Bacteria 799
23 Ga0070659_100015713 3300005366 Bacteria 5671
24 Ga0070659_100780602 3300005366 Bacteria 830
25 Ga0070714_100498564 3300005435 Bacteria 1161
26 Ga0070713_100012984 3300005436 Bacteria 6132
27 Ga0070710_10015139 3300005437 Bacteria 3897
28 Ga0070711_100014694 3300005439 Bacteria 4938
29 Ga0070711_100322748 3300005439 Bacteria 1234
30 Ga0070700_100643248 3300005441 Bacteria 836
31 Ga0070694_100100190 3300005444 Bacteria 2049
32 Ga0070663_100011480 3300005455 Bacteria 5564
33 Ga0070678_100198809 3300005456 Bacteria 1653
34 Ga0070678_101599082 3300005456 Bacteria 612
35 Ga0070662_100069516 3300005457 Bacteria 2592
36 Ga0070662_100181348 3300005457 Unclassified 1660
37 Ga0070681_10129559 3300005458 Bacteria 2455
38 Ga0068867_100208233 3300005459 Bacteria 1569
39 Ga0068867_100240915 3300005459 Unclassified 1467
40 Ga0070679_100861976 3300005530 Bacteria 849
41 Ga0068853_100326480 3300005539 Unclassified 1423
42 Ga0070686_100969647 3300005544 Bacteria 696
43 Ga0070695_100693914 3300005545 Bacteria 807
44 Ga0070665_100249890 3300005548 Bacteria 1774
45 Ga0070704_100276922 3300005549 Unclassified 1388
46 Ga0068855_100488628 3300005563 Unclassified 1339
47 Ga0068854_101140998 3300005578 Archaea 696
48 Ga0068856_100239148 3300005614 Bacteria 1831
49 Ga0068856_100716012 3300005614 Bacteria 1021
50 Ga0070702_100020156 3300005615 Bacteria 3488
51 Ga0070702_100365984 3300005615 Bacteria 1020
52 Ga0070702_101350635 3300005615 Bacteria 581
53 Ga0068852_100362367 3300005616 Bacteria 1418
54 Ga0068859_101028712 3300005617 Bacteria 905
55 Ga0068864_100197264 3300005618 Bacteria 1848
56 Ga0068866_10019600 3300005718 Bacteria 3084
57 Ga0068861_100878161 3300005719 Unclassified 847
58 Ga0068861_101301808 3300005719 Bacteria 707
59 Ga0068863_100022899 3300005841 Bacteria 5970
60 Ga0068863_101878438 3300005841 Bacteria 609
61 Ga0068858_100042468 3300005842 Bacteria 4216
62 Ga0068860_100149126 3300005843 Bacteria 2251
63 Ga0068860_100379666 3300005843 Bacteria 1395
64 Ga0068862_100717477 3300005844 Unclassified 970
65 Ga0081455_10003006 3300005937 Bacteria 19674
66 Ga0081455_10012147 3300005937 Bacteria 8605
67 Ga0081455_10016221 3300005937 Bacteria 7200
68 Ga0081455_10019441 3300005937 Bacteria 6426
69 Ga0081538_10000133 3300005981 Bacteria 77001
70 Ga0081540_1058278 3300005983 Bacteria 1861
71 Ga0070717_11314082 3300006028 Bacteria 657
72 Ga0075432_10000279 3300006058 Bacteria 14164
73 Ga0075432_10000591 3300006058 Bacteria 10975
74 Ga0070712_100019961 3300006175 Bacteria 4381
75 Ga0070712_100332851 3300006175 Bacteria 1238
76 Ga0075427_10059632 3300006194 Unclassified 667
77 Ga0097621_100013731 3300006237 Bacteria 6047
78 Ga0097621_100946493 3300006237 Bacteria 804
79 Ga0075370_10061183 3300006353 Bacteria 2145
80 Ga0075428_100002244 3300006844 Bacteria 20928
81 Ga0075428_100147448 3300006844 Bacteria 2557
82 Ga0075428_100354356 3300006844 Bacteria 1575
83 Ga0075430_100328149 3300006846 Unclassified 1265
84 Ga0075431_100062909 3300006847 Bacteria 3829
85 Ga0075433_10002217 3300006852 Bacteria 14739
86 Ga0075433_10015727 3300006852 Bacteria 6217
87 Ga0075434_100002374 3300006871 Bacteria 16512
88 Ga0075434_100005827 3300006871 Bacteria 11255
89 Ga0075434_101081174 3300006871 Bacteria 815
90 Ga0075429_100120108 3300006880 Bacteria 2297
91 Ga0075429_100817235 3300006880 Unclassified 816
92 Ga0068865_100045120 3300006881 Bacteria 3020
93 Ga0075436_100011560 3300006914 Bacteria 6055
94 Ga0075436_100839470 3300006914 Bacteria 685
95 Ga0075436_101083968 3300006914 Unclassified 603
96 Ga0097620_101028734 3300006931 Bacteria 905
97 Ga0075435_100005779 3300007076 Bacteria 8688
98 Ga0075435_100007296 3300007076 Bacteria 7871
99 Ga0111539_10013088 3300009094 Bacteria 10377
100 Ga0111539_10023505 3300009094 Bacteria 7573
101 Ga0111539_10741644 3300009094 Unclassified 1143
102 Ga0111539_11682703 3300009094 Bacteria 736
103 Ga0105245_10017210 3300009098 Bacteria 6306
104 Ga0105245_10079422 3300009098 Bacteria 2995
105 Ga0105245_10294963 3300009098 Unclassified 1589
106 Ga0105245_10598300 3300009098 Bacteria 1129
107 Ga0105245_10707912 3300009098 Bacteria 1041
108 Ga0105247_10007294 3300009101 Bacteria 6794
109 Ga0105247_10760205 3300009101 Bacteria 735
110 Ga0105247_11724136 3300009101 Bacteria 519
111 Ga0114129_10006324 3300009147 Bacteria 16796
112 Ga0114129_11550361 3300009147 Unclassified 813
113 Ga0105243_10449769 3300009148 Archaea 1208
114 Ga0105243_10878249 3300009148 Bacteria 890
115 Ga0105243_11819466 3300009148 Bacteria 640
116 Ga0105243_12719094 3300009148 Bacteria 535
117 Ga0105241_10006110 3300009174 Bacteria 8874
118 Ga0105242_10010192 3300009176 Bacteria 7201
119 Ga0105242_10226750 3300009176 Bacteria 1672
120 Ga0105242_11236779 3300009176 Bacteria 768
121 Ga0105242_11824558 3300009176 Bacteria 647
122 Ga0105237_10164231 3300009545 Unclassified 2219
123 Ga0105238_10015465 3300009551 Bacteria 7722
124 Ga0105238_10066862 3300009551 Bacteria 3595
125 Ga0105238_10233174 3300009551 Bacteria 1817
126 Ga0105249_10033750 3300009553 Bacteria 4635
127 Ga0105249_10034893 3300009553 Bacteria 4559
128 Ga0105249_11484269 3300009553 Bacteria 750
129 Ga0105249_13073864 3300009553 Bacteria 536
130 Ga0105249_13461944 3300009553 Bacteria 508
131 Ga0105239_10160992 3300010375 Unclassified 2507
132 Ga0105239_10464160 3300010375 Bacteria 1437
133 Ga0105239_10854689 3300010375 Bacteria 1044
134 Ga0105239_12329314 3300010375 Bacteria 623
135 Ga0105246_10763186 3300011119 Bacteria 854
136 Ga0105246_10846231 3300011119 Bacteria 816
137 Ga0157371_10150128 3300013102 Unclassified 1662
138 Ga0157371_10281838 3300013102 Bacteria 1201
139 Ga0157371_10752695 3300013102 Bacteria 732
140 Ga0157370_11721468 3300013104 Bacteria 563
141 Ga0157369_10558344 3300013105 Bacteria 1183
142 Ga0157369_11356208 3300013105 Bacteria 724
143 Ga0157369_12331653 3300013105 Bacteria 542
144 Ga0157374_10202575 3300013296 Bacteria 1944
145 Ga0157374_11095408 3300013296 Bacteria 817
146 Ga0157374_11505173 3300013296 Bacteria 696
147 Ga0157378_10020003 3300013297 Bacteria 5885
148 Ga0157378_12061652 3300013297 Bacteria 621
149 Ga0163162_10062270 3300013306 Unclassified 3771
150 Ga0163162_10077557 3300013306 Bacteria 3387
151 Ga0163162_10341316 3300013306 Bacteria 1630
152 Ga0163162_10969093 3300013306 Bacteria 961
153 Ga0157372_10084199 3300013307 Bacteria 3604
154 Ga0157372_10294487 3300013307 Bacteria 1887
155 Ga0157372_11154518 3300013307 Bacteria 895
156 Ga0157375_10020063 3300013308 Bacteria 6098
157 Ga0157375_10641496 3300013308 Bacteria 1219
158 Ga0163163_10099019 3300014325 Bacteria 2937
159 Ga0163163_11951158 3300014325 Bacteria 647
160 Ga0157380_10216525 3300014326 Bacteria 1710
161 Ga0157377_10382289 3300014745 Bacteria 954
162 Ga0157377_10610237 3300014745 Unclassified 780
163 Ga0157379_10021935 3300014968 Bacteria 5658
164 Ga0157379_10251236 3300014968 Bacteria 1605
165 Ga0157376_10239687 3300014969 Bacteria 1689
166 Ga0157376_10528057 3300014969 Bacteria 1164
167 Ga0157376_10946047 3300014969 Bacteria 882
168 Ga0157376_11063503 3300014969 Unclassified 834
169 Ga0163161_10040709 3300017792 Bacteria 3338
170 Ga0206351_10034985 3300020077 Bacteria 635
171 Ga0224712_10061207 3300022467 Bacteria 1500
172 Ga0207642_10015097 3300025899 Bacteria 2868
173 Ga0207688_10014073 3300025901 Bacteria 4350
174 Ga0207688_10056316 3300025901 Bacteria 2208
175 Ga0207647_10296921 3300025904 Bacteria 920
176 Ga0207671_10387715 3300025914 Bacteria 1110
177 Ga0207693_10001527 3300025915 Bacteria 20443
178 Ga0207693_10555506 3300025915 Bacteria 895
179 Ga0207693_11248886 3300025915 Bacteria 558
180 Ga0207663_10245465 3300025916 Unclassified 1315
181 Ga0207663_10887971 3300025916 Bacteria 712
182 Ga0207662_11233544 3300025918 Bacteria 531
183 Ga0207652_11178828 3300025921 Bacteria 667
184 Ga0207681_10546784 3300025923 Bacteria 953
185 Ga0207681_10891316 3300025923 Unclassified 745
186 Ga0207694_10817119 3300025924 Bacteria 787
187 Ga0207694_10891168 3300025924 Bacteria 752
188 Ga0207687_10164398 3300025927 Bacteria 1706
189 Ga0207687_11042928 3300025927 Unclassified 702
190 Ga0207687_11964887 3300025927 Bacteria 500
191 Ga0207700_10092157 3300025928 Bacteria 2395
192 Ga0207664_10360976 3300025929 Bacteria 1287
193 Ga0207664_10427791 3300025929 Bacteria 1180
194 Ga0207644_10030914 3300025931 Bacteria 3728
195 Ga0207690_10028385 3300025932 Unclassified 3547
196 Ga0207706_10051525 3300025933 Bacteria 3634
197 Ga0207706_10144976 3300025933 Bacteria 2089
198 Ga0207686_10161432 3300025934 Unclassified 1571
199 Ga0207686_10186579 3300025934 Unclassified 1475
200 Ga0207686_10418907 3300025934 Unclassified 1024
201 Ga0207686_10575898 3300025934 Bacteria 883
202 Ga0207709_10005138 3300025935 Bacteria 7469
203 Ga0207709_10081327 3300025935 Bacteria 2088
204 Ga0207709_10271527 3300025935 Bacteria 1248
205 Ga0207669_10284246 3300025937 Bacteria 1249
206 Ga0207669_10464910 3300025937 Bacteria 1005
207 Ga0207704_10029690 3300025938 Bacteria 3054
208 Ga0207704_10093902 3300025938 Bacteria 1979
209 Ga0207704_10149853 3300025938 Unclassified 1644
210 Ga0207711_10111980 3300025941 Bacteria 2428
211 Ga0207711_10861971 3300025941 Bacteria 843
212 Ga0207689_10159843 3300025942 Bacteria 1856
213 Ga0207661_10308003 3300025944 Unclassified 1421
214 Ga0207679_10378726 3300025945 Bacteria 1240
215 Ga0207667_10406610 3300025949 Unclassified 1386
216 Ga0207712_10120163 3300025961 Bacteria 1987
217 Ga0207712_10269266 3300025961 Bacteria 1385
218 Ga0207668_10230682 3300025972 Unclassified 1492
219 Ga0207668_10405136 3300025972 Bacteria 1154
220 Ga0207640_10050650 3300025981 Bacteria 2696
221 Ga0207677_11647346 3300026023 Bacteria 594
222 Ga0207677_12032836 3300026023 Bacteria 534
223 Ga0207678_10025303 3300026067 Bacteria 5182
224 Ga0207678_10761197 3300026067 Bacteria 854
225 Ga0207678_11378428 3300026067 Bacteria 623
226 Ga0207678_11537505 3300026067 Bacteria 587
227 Ga0207708_10287623 3300026075 Unclassified 1333
228 Ga0207702_10027752 3300026078 Bacteria 4703
229 Ga0207702_11128725 3300026078 Bacteria 778
230 Ga0207702_11521202 3300026078 Bacteria 663
231 Ga0207641_10224242 3300026088 Bacteria 1744
232 Ga0207648_10046785 3300026089 Bacteria 3793
233 Ga0207648_10444277 3300026089 Bacteria 1180
234 Ga0207676_11786040 3300026095 Unclassified 613
235 Ga0207675_100023355 3300026118 Bacteria 5751
236 Ga0207675_100112299 3300026118 Bacteria 2572
237 Ga0207683_10263383 3300026121 Bacteria 1574
238 Ga0207683_11617316 3300026121 Bacteria 597
239 Ga0207698_12013527 3300026142 Bacteria 592
240 Ga0207428_10000786 3300027907 Bacteria 35962
241 Ga0207428_10007628 3300027907 Bacteria 9852
242 Ga0268266_10220057 3300028379 Bacteria 1745
243 Ga0268266_10241702 3300028379 Bacteria 1667
244 Ga0268265_12280659 3300028380 Archaea 548
245 Ga0268264_10230629 3300028381 Unclassified 1710
246 Ga0265336_10005472 3300028666 Bacteria 4681
247 Ga0265338_10000745 3300028800 Bacteria 55424
248 Ga0265338_10390379 3300028800 Bacteria 994
249 Ga0265340_10008145 3300031247 Bacteria 5671
250 Ga0373930_0125301 3300034816 Bacteria 629
251 Ga0373949_0189735 3300035090 Bacteria 613
252 Ga0373939_0332946 3300035114 Bacteria 613
253 Ga0373942_0364576 3300035207 Bacteria 513
254 Ga0373927_1069905 3300035695 Bacteria 532
255 Ga0373937_1392400 3300036401 Bacteria 649
256 Ga0395905_0610097 3300037471 Unclassified 993
257 Ga0451835_0668021 3300041492 Bacteria 3586
258 Ga0439450_116636 3300042008 Unclassified 686
259 Ga0439444_0018095 3300042437 Bacteria 1217
260 Ga0439464_0106125 3300042439 Bacteria 857
261 Ga0439460_0054879 3300042461 Unclassified 1203
262 Ga0439440_0103451 3300042993 Unclassified 777
263 Ga0439440_0119836 3300042993 Bacteria 731
264 Ga0495592_0117216 3300046454 Bacteria 1878
265 Ga0495603_0026191 3300046455 Bacteria 3524
266 Ga0495603_0792485 3300046455 Bacteria 541
267 Ga0495629_0080011 3300046459 Bacteria 2282
268 Ga0495629_0474282 3300046459 Bacteria 846
269 Ga0495641_0116170 3300046461 Bacteria 1194
270 Ga0495651_0675358 3300046462 Bacteria 646
271 Ga0495653_0076035 3300046463 Bacteria 2497
272 Ga0495582_0078186 3300046473 Bacteria 1835
273 Ga0495582_0398086 3300046473 Bacteria 794
274 Ga0495639_0334547 3300046475 Bacteria 759
275 Ga0495664_0394581 3300046477 Unclassified 831
276 Ga0495664_0745650 3300046477 Bacteria 577
277 Ga0495594_0167883 3300046499 Bacteria 1248
278 Ga0495607_0452364 3300046501 Bacteria 576
279 Ga0495608_0608652 3300046511 Bacteria 655
280 Ga0495608_0665127 3300046511 Bacteria 622
281 Ga0495608_0820255 3300046511 Unclassified 548
282 Ga0495618_0314046 3300046514 Bacteria 972
283 Ga0495628_0464326 3300046516 Bacteria 918
284 Ga0495630_0802988 3300046517 Bacteria 718
285 Ga0495631_0449451 3300046518 Unclassified 549
286 Ga0495631_0509698 3300046518 Unclassified 513
287 Ga0495637_0222972 3300046520 Bacteria 686
288 Ga0495644_0038648 3300046523 Unclassified 1800
289 Ga0495652_0798051 3300046529 Bacteria 629
290 Ga0495665_0124427 3300046531 Bacteria 1350
291 Ga0495640_0061108 3300046533 Bacteria 2561
292 Ga0495640_0271028 3300046533 Bacteria 1059
293 Ga0495586_0518952 3300046535 Bacteria 688
294 Ga0495598_0282389 3300046537 Bacteria 624
295 Ga0495609_0222596 3300046538 Bacteria 783
296 Ga0495633_0373968 3300046558 Bacteria 645
297 Ga0495667_0049897 3300046559 Bacteria 2763
298 Ga0495667_0295722 3300046559 Bacteria 1026
299 Ga0495667_0776913 3300046559 Bacteria 591
300 Ga0495656_0331985 3300046615 Bacteria 785
301 Ga0495668_0711457 3300046616 Bacteria 556
302 Ga0495611_0318490 3300046648 Bacteria 716
303 Ga0495635_0110662 3300046663 Bacteria 1876
304 Ga0495635_0298991 3300046663 Bacteria 1079
305 Ga0495635_0361765 3300046663 Bacteria 967
306 Ga0495635_0390286 3300046663 Bacteria 926
307 Ga0495635_0822220 3300046663 Bacteria 598
308 Ga0495659_0179445 3300046664 Bacteria 862
309 Ga0495588_0478487 3300046674 Bacteria 653
310 Ga0495657_0130962 3300046675 Bacteria 1571
311 Ga0495657_0593174 3300046675 Bacteria 641
312 Ga0495658_0300601 3300046683 Bacteria 1015
313 Ga0495624_0666958 3300046690 Bacteria 618
314 Ga0495670_0067324 3300046691 Bacteria 1808
315 Ga0495600_0266341 3300046809 Bacteria 1088
316 Ga0495600_0567274 3300046809 Bacteria 692
317 Ga0495581_0036920 3300047315 Bacteria 2827
318 Ga0495636_0412185 3300047318 Bacteria 645
319 Ga0495674_0319214 3300047319 Bacteria 1266
320 Ga0495680_0109103 3300047322 Bacteria 2053
321 Ga0495675_0081054 3300047444 Bacteria 2044
322 Ga0495675_0832759 3300047444 Bacteria 509
323 Ga0495593_0057886 3300047673 Bacteria 2034
324 Ga0495615_0043591 3300048090 Bacteria 1130
325 Ga0496100_0040488 3300048903 Bacteria 2965
326 Ga0496100_0972291 3300048903 Bacteria 668
327 Ga0496102_0600064 3300048905 Bacteria 1024
328 Ga0496102_0888160 3300048905 Bacteria 813
329 Ga0496102_1011753 3300048905 Bacteria 751
330 Ga0496103_0661334 3300048906 Bacteria 663
331 Ga0496104_0094594 3300048907 Bacteria 2859
332 Ga0496104_0133278 3300048907 Bacteria 2387
333 Ga0496104_0206049 3300048907 Bacteria 1878
334 Ga0496104_0330201 3300048907 Bacteria 1438
335 Ga0496104_0877032 3300048907 Bacteria 802
336 Ga0496104_0882847 3300048907 Bacteria 799
337 Ga0496104_0982759 3300048907 Bacteria 748
338 Ga0496104_1276217 3300048907 Bacteria 638
339 Ga0496105_0008327 3300048908 Bacteria 8058
340 Ga0496105_0035903 3300048908 Bacteria 4082
341 Ga0496105_0610084 3300048908 Bacteria 846
342 Ga0496105_0624468 3300048908 Bacteria 834
343 Ga0496106_0286727 3300048909 Bacteria 1320
344 Ga0496107_0009220 3300048910 Bacteria 6838
345 Ga0496107_0056658 3300048910 Bacteria 2832
346 Ga0496107_0339638 3300048910 Bacteria 1117
347 Ga0496108_0025012 3300048911 Bacteria 4919
348 Ga0496108_0046954 3300048911 Bacteria 3609
349 Ga0496108_0223414 3300048911 Bacteria 1636
350 Ga0496108_0431232 3300048911 Bacteria 1151
351 Ga0496109_0009997 3300048912 Bacteria 8100
352 Ga0496109_0019922 3300048912 Bacteria 5921
353 Ga0496109_0050584 3300048912 Bacteria 3784
354 Ga0496109_0101359 3300048912 Bacteria 2672
355 Ga0496109_0254007 3300048912 Bacteria 1655
356 Ga0496109_0345570 3300048912 Bacteria 1405
357 Ga0496110_0074364 3300048913 Bacteria 3017
358 Ga0496110_0183562 3300048913 Bacteria 1900
359 Ga0496110_0227113 3300048913 Bacteria 1698
360 Ga0496110_0431818 3300048913 Bacteria 1200
361 Ga0496110_0459084 3300048913 Bacteria 1161
362 Ga0496110_0614639 3300048913 Bacteria 985
363 Ga0496111_0108682 3300048914 Bacteria 2042
364 Ga0496111_0131882 3300048914 Bacteria 1849
365 Ga0496111_0641638 3300048914 Bacteria 775
366 Ga0496112_0028728 3300048915 Bacteria 5372
367 Ga0496112_0117798 3300048915 Bacteria 2626
368 Ga0496112_0128297 3300048915 Bacteria 2507
369 Ga0496112_0339432 3300048915 Bacteria 1446
370 Ga0496113_0023155 3300048916 Bacteria 4402
371 Ga0496113_0068885 3300048916 Bacteria 2686
372 Ga0496113_0155818 3300048916 Bacteria 1804
373 Ga0496113_0211431 3300048916 Bacteria 1544
374 Ga0496113_0526230 3300048916 Bacteria 949
375 Ga0496114_0002594 3300048917 Bacteria 13799
376 Ga0496114_0050501 3300048917 Bacteria 3462
377 Ga0496114_0083100 3300048917 Bacteria 2709
378 Ga0496114_0104112 3300048917 Bacteria 2426
379 Ga0496114_0179124 3300048917 Bacteria 1850
380 Ga0496114_0340372 3300048917 Bacteria 1326
381 Ga0496114_0735667 3300048917 Bacteria 863
382 Ga0496114_0766688 3300048917 Bacteria 842
383 Ga0496114_1463438 3300048917 Bacteria 571
384 Ga0496114_1640008 3300048917 Bacteria 531
385 Ga0496115_0002529 3300048918 Bacteria 13145
386 Ga0496115_0096635 3300048918 Bacteria 2419
387 Ga0496115_0101413 3300048918 Bacteria 2360
388 Ga0496115_0384951 3300048918 Bacteria 1140
389 Ga0496115_0935471 3300048918 Bacteria 666
390 Ga0496115_1246394 3300048918 Bacteria 556
391 Ga0496121_0084319 3300048924 Bacteria 2506
392 Ga0496124_0292385 3300048927 Bacteria 1182
393 Ga0496126_0016086 3300048929 Bacteria 7498
394 Ga0501067_0028559 3300049583 Bacteria 3091
395 Ga0501068_0011938 3300049584 Bacteria 4913
396 Ga0501070_1212988 3300049586 Bacteria 579
397 Ga0501076_0268578 3300049592 Bacteria 1397
398 nmdc:mga07m45_298527_c1 3300050496 Bacteria 937
399 nmdc:mga05p37_1928692_c1 3300050507 Unclassified 563
400 nmdc:mga05p37_292961_c1 3300050507 Unclassified 1937
401 nmdc:mga09592_696586_c1 3300050508 Unclassified 865
402 nmdc:mga0qj67_344597_c1 3300050509 Unclassified 1205
403 nmdc:mga06r32_59388_c1 3300050510 Bacteria 3677
404 nmdc:mga08y16_1052641_c1 3300050511 Unclassified 791
405 nmdc:mga08y16_129171_c1 3300050511 Bacteria 2629
406 nmdc:mga08y16_14374_c1 3300050511 Bacteria 8333
407 nmdc:mga0n895_101655_c1 3300050512 Bacteria 2885
408 nmdc:mga0n895_106214_c1 3300050512 Unclassified 2821
409 nmdc:mga0rr50_15706_c1 3300050513 Bacteria 5004
410 nmdc:mga0rr50_1884_c1 3300050513 Bacteria 11635
411 nmdc:mga08x19_805627_c1 3300050514 Bacteria 667
412 nmdc:mga08x19_8104_c1 3300050514 Bacteria 6241
413 nmdc:mga0a205_7417_c1 3300050515 Bacteria 9932
414 nmdc:mga0a205_79114_c1 3300050515 Bacteria 3177
415 Ga0495601_0030521 3300053077 Bacteria 3347
416 Ga0495601_0274701 3300053077 Bacteria 1099
417 Ga0495612_0512577 3300053078 Bacteria 551
418 Ga0495655_0188461 3300053083 Bacteria 669
419 Ga0495595_0390504 3300053084 Bacteria 705
420 Ga0495619_0008940 3300053085 Bacteria 6322
421 Ga0495619_0050654 3300053085 Bacteria 2742
422 Ga0500616_0000319 3300053153 Bacteria 69060
423 Ga0530510_0197709 3300061734 Bacteria 1493
424 Ga0105243_10011348
425 JGI24752J21851_1065715
426 JGI25407J50210_10031202
427 JGI25405J52794_10010661
428 Ga0070676_10912039
429 Ga0070683_100526176
430 Ga0070670_100985244
431 Ga0068869_101786581
432 Ga0070666_10086095
433 Ga0070682_100046778
434 Ga0070682_101376166
435 Ga0068868_101993474
436 Ga0070660_101696046
437 Ga0070687_101444914
438 Ga0070692_10311259
439 Ga0070692_10352198
440 Ga0070668_100052730
441 Ga0070668_100082644
442 Ga0070669_100159508
443 Ga0070671_100080133
444 Ga0070674_100602019
445 Ga0070674_100832387
446 Ga0070659_100015713
447 Ga0070659_100780602
448 Ga0070714_100498564
449 Ga0070713_100012984
450 Ga0070710_10015139
451 Ga0070711_100014694
452 Ga0070711_100322748
453 Ga0070700_100643248
454 Ga0070694_100100190
455 Ga0070663_100011480
456 Ga0070678_100198809
457 Ga0070678_101599082
458 Ga0070662_100069516
459 Ga0070662_100181348
460 Ga0070681_10129559
461 Ga0068867_100208233
462 Ga0068867_100240915
463 Ga0070679_100861976
464 Ga0068853_100326480
465 Ga0070686_100969647
466 Ga0070695_100693914
467 Ga0070665_100249890
468 Ga0070704_100276922
469 Ga0068855_100488628
470 Ga0068854_101140998
471 Ga0068856_100239148
472 Ga0068856_100716012
473 Ga0070702_100020156
474 Ga0070702_100365984
475 Ga0070702_101350635
476 Ga0068852_100362367
477 Ga0068859_101028712
478 Ga0068864_100197264
479 Ga0068866_10019600
480 Ga0068861_100878161
481 Ga0068861_101301808
482 Ga0068863_100022899
483 Ga0068863_101878438
484 Ga0068858_100042468
485 Ga0068860_100149126
486 Ga0068860_100379666
487 Ga0068862_100717477
488 Ga0081455_10003006
489 Ga0081455_10012147
490 Ga0081455_10016221
491 Ga0081455_10019441
492 Ga0081538_10000133
493 Ga0081540_1058278
494 Ga0070717_11314082
495 Ga0075432_10000279
496 Ga0075432_10000591
497 Ga0070712_100019961
498 Ga0070712_100332851
499 Ga0075427_10059632
500 Ga0097621_100013731
501 Ga0097621_100946493
502 Ga0075370_10061183
503 Ga0075428_100002244
504 Ga0075428_100147448
505 Ga0075428_100354356
506 Ga0075430_100328149
507 Ga0075431_100062909
508 Ga0075433_10002217
509 Ga0075433_10015727
510 Ga0075434_100002374
511 Ga0075434_100005827
512 Ga0075434_101081174
513 Ga0075429_100120108
514 Ga0075429_100817235
515 Ga0068865_100045120
516 Ga0075436_100011560
517 Ga0075436_100839470
518 Ga0075436_101083968
519 Ga0097620_101028734
520 Ga0075435_100005779
521 Ga0075435_100007296
522 Ga0111539_10013088
523 Ga0111539_10023505
524 Ga0111539_10741644
525 Ga0111539_11682703
526 Ga0105245_10017210
527 Ga0105245_10079422
528 Ga0105245_10294963
529 Ga0105245_10598300
530 Ga0105245_10707912
531 Ga0105247_10007294
532 Ga0105247_10760205
533 Ga0105247_11724136
534 Ga0114129_10006324
535 Ga0114129_11550361
536 Ga0105243_10449769
537 Ga0105243_10878249
538 Ga0105243_11819466
539 Ga0105243_12719094
540 Ga0105241_10006110
541 Ga0105242_10010192
542 Ga0105242_10226750
543 Ga0105242_11236779
544 Ga0105242_11824558
545 Ga0105237_10164231
546 Ga0105238_10015465
547 Ga0105238_10066862
548 Ga0105238_10233174
549 Ga0105249_10033750
550 Ga0105249_10034893
551 Ga0105249_11484269
552 Ga0105249_13073864
553 Ga0105249_13461944
554 Ga0105239_10160992
555 Ga0105239_10464160
556 Ga0105239_10854689
557 Ga0105239_12329314
558 Ga0105246_10763186
559 Ga0105246_10846231
560 Ga0157371_10150128
561 Ga0157371_10281838
562 Ga0157371_10752695
563 Ga0157370_11721468
564 Ga0157369_10558344
565 Ga0157369_11356208
566 Ga0157369_12331653
567 Ga0157374_10202575
568 Ga0157374_11095408
569 Ga0157374_11505173
570 Ga0157378_10020003
571 Ga0157378_12061652
572 Ga0163162_10062270
573 Ga0163162_10077557
574 Ga0163162_10341316
575 Ga0163162_10969093
576 Ga0157372_10084199
577 Ga0157372_10294487
578 Ga0157372_11154518
579 Ga0157375_10020063
580 Ga0157375_10641496
581 Ga0163163_10099019
582 Ga0163163_11951158
583 Ga0157380_10216525
584 Ga0157377_10382289
585 Ga0157377_10610237
586 Ga0157379_10021935
587 Ga0157379_10251236
588 Ga0157376_10239687
589 Ga0157376_10528057
590 Ga0157376_10946047
591 Ga0157376_11063503
592 Ga0163161_10040709
593 Ga0206351_10034985
594 Ga0224712_10061207
595 Ga0207642_10015097
596 Ga0207688_10014073
597 Ga0207688_10056316
598 Ga0207647_10296921
599 Ga0207671_10387715
600 Ga0207693_10001527
601 Ga0207693_10555506
602 Ga0207693_11248886
603 Ga0207663_10245465
604 Ga0207663_10887971
605 Ga0207662_11233544
606 Ga0207652_11178828
607 Ga0207681_10546784
608 Ga0207681_10891316
609 Ga0207694_10817119
610 Ga0207694_10891168
611 Ga0207687_10164398
612 Ga0207687_11042928
613 Ga0207687_11964887
614 Ga0207700_10092157
615 Ga0207664_10360976
616 Ga0207664_10427791
617 Ga0207644_10030914
618 Ga0207690_10028385
619 Ga0207706_10051525
620 Ga0207706_10144976
621 Ga0207686_10161432
622 Ga0207686_10186579
623 Ga0207686_10418907
624 Ga0207686_10575898
625 Ga0207709_10005138
626 Ga0207709_10081327
627 Ga0207709_10271527
628 Ga0207669_10284246
629 Ga0207669_10464910
630 Ga0207704_10029690
631 Ga0207704_10093902
632 Ga0207704_10149853
633 Ga0207711_10111980
634 Ga0207711_10861971
635 Ga0207689_10159843
636 Ga0207661_10308003
637 Ga0207679_10378726
638 Ga0207667_10406610
639 Ga0207712_10120163
640 Ga0207712_10269266
641 Ga0207668_10230682
642 Ga0207668_10405136
643 Ga0207640_10050650
644 Ga0207677_11647346
645 Ga0207677_12032836
646 Ga0207678_10025303
647 Ga0207678_10761197
648 Ga0207678_11378428
649 Ga0207678_11537505
650 Ga0207708_10287623
651 Ga0207702_10027752
652 Ga0207702_11128725
653 Ga0207702_11521202
654 Ga0207641_10224242
655 Ga0207648_10046785
656 Ga0207648_10444277
657 Ga0207676_11786040
658 Ga0207675_100023355
659 Ga0207675_100112299
660 Ga0207683_10263383
661 Ga0207683_11617316
662 Ga0207698_12013527
663 Ga0207428_10000786
664 Ga0207428_10007628
665 Ga0268266_10220057
666 Ga0268266_10241702
667 Ga0268265_12280659
668 Ga0268264_10230629
669 Ga0265336_10005472
670 Ga0265338_10000745
671 Ga0265338_10390379
672 Ga0265340_10008145
673 Ga0373930_0125301
674 Ga0373949_0189735
675 Ga0373939_0332946
676 Ga0373942_0364576
677 Ga0373927_1069905
678 Ga0373937_1392400
679 Ga0395905_0610097
680 Ga0451835_0668021
681 Ga0439450_116636
682 Ga0439444_0018095
683 Ga0439464_0106125
684 Ga0439460_0054879
685 Ga0439440_0103451
686 Ga0439440_0119836
687 Ga0495592_0117216
688 Ga0495603_0026191
689 Ga0495603_0792485
690 Ga0495629_0080011
691 Ga0495629_0474282
692 Ga0495641_0116170
693 Ga0495651_0675358
694 Ga0495653_0076035
695 Ga0495582_0078186
696 Ga0495582_0398086
697 Ga0495639_0334547
698 Ga0495664_0394581
699 Ga0495664_0745650
700 Ga0495594_0167883
701 Ga0495607_0452364
702 Ga0495608_0608652
703 Ga0495608_0665127
704 Ga0495608_0820255
705 Ga0495618_0314046
706 Ga0495628_0464326
707 Ga0495630_0802988
708 Ga0495631_0449451
709 Ga0495631_0509698
710 Ga0495637_0222972
711 Ga0495644_0038648
712 Ga0495652_0798051
713 Ga0495665_0124427
714 Ga0495640_0061108
715 Ga0495640_0271028
716 Ga0495586_0518952
717 Ga0495598_0282389
718 Ga0495609_0222596
719 Ga0495633_0373968
720 Ga0495667_0049897
721 Ga0495667_0295722
722 Ga0495667_0776913
723 Ga0495656_0331985
724 Ga0495668_0711457
725 Ga0495611_0318490
726 Ga0495635_0110662
727 Ga0495635_0298991
728 Ga0495635_0361765
729 Ga0495635_0390286
730 Ga0495635_0822220
731 Ga0495659_0179445
732 Ga0495588_0478487
733 Ga0495657_0130962
734 Ga0495657_0593174
735 Ga0495658_0300601
736 Ga0495624_0666958
737 Ga0495670_0067324
738 Ga0495600_0266341
739 Ga0495600_0567274
740 Ga0495581_0036920
741 Ga0495636_0412185
742 Ga0495674_0319214
743 Ga0495680_0109103
744 Ga0495675_0081054
745 Ga0495675_0832759
746 Ga0495593_0057886
747 Ga0495615_0043591
748 Ga0496100_0040488
749 Ga0496100_0972291
750 Ga0496102_0600064
751 Ga0496102_0888160
752 Ga0496102_1011753
753 Ga0496103_0661334
754 Ga0496104_0094594
755 Ga0496104_0133278
756 Ga0496104_0206049
757 Ga0496104_0330201
758 Ga0496104_0877032
759 Ga0496104_0882847
760 Ga0496104_0982759
761 Ga0496104_1276217
762 Ga0496105_0008327
763 Ga0496105_0035903
764 Ga0496105_0610084
765 Ga0496105_0624468
766 Ga0496106_0286727
767 Ga0496107_0009220
768 Ga0496107_0056658
769 Ga0496107_0339638
770 Ga0496108_0025012
771 Ga0496108_0046954
772 Ga0496108_0223414
773 Ga0496108_0431232
774 Ga0496109_0009997
775 Ga0496109_0019922
776 Ga0496109_0050584
777 Ga0496109_0101359
778 Ga0496109_0254007
779 Ga0496109_0345570
780 Ga0496110_0074364
781 Ga0496110_0183562
782 Ga0496110_0227113
783 Ga0496110_0431818
784 Ga0496110_0459084
785 Ga0496110_0614639
786 Ga0496111_0108682
787 Ga0496111_0131882
788 Ga0496111_0641638
789 Ga0496112_0028728
790 Ga0496112_0117798
791 Ga0496112_0128297
792 Ga0496112_0339432
793 Ga0496113_0023155
794 Ga0496113_0068885
795 Ga0496113_0155818
796 Ga0496113_0211431
797 Ga0496113_0526230
798 Ga0496114_0002594
799 Ga0496114_0050501
800 Ga0496114_0083100
801 Ga0496114_0104112
802 Ga0496114_0179124
803 Ga0496114_0340372
804 Ga0496114_0735667
805 Ga0496114_0766688
806 Ga0496114_1463438
807 Ga0496114_1640008
808 Ga0496115_0002529
809 Ga0496115_0096635
810 Ga0496115_0101413
811 Ga0496115_0384951
812 Ga0496115_0935471
813 Ga0496115_1246394
814 Ga0496121_0084319
815 Ga0496124_0292385
816 Ga0496126_0016086
817 Ga0501067_0028559
818 Ga0501068_0011938
819 Ga0501070_1212988
820 Ga0501076_0268578
821 nmdc:mga07m45_298527_c1
822 nmdc:mga05p37_1928692_c1
823 nmdc:mga05p37_292961_c1
824 nmdc:mga09592_696586_c1
825 nmdc:mga0qj67_344597_c1
826 nmdc:mga06r32_59388_c1
827 nmdc:mga08y16_1052641_c1
828 nmdc:mga08y16_129171_c1
829 nmdc:mga08y16_14374_c1
830 nmdc:mga0n895_101655_c1
831 nmdc:mga0n895_106214_c1
832 nmdc:mga0rr50_15706_c1
833 nmdc:mga0rr50_1884_c1
834 nmdc:mga08x19_805627_c1
835 nmdc:mga08x19_8104_c1
836 nmdc:mga0a205_7417_c1
837 nmdc:mga0a205_79114_c1
838 Ga0495601_0030521
839 Ga0495601_0274701
840 Ga0495612_0512577
841 Ga0495655_0188461
842 Ga0495595_0390504
843 Ga0495619_0008940
844 Ga0495619_0050654
845 Ga0500616_0000319
846 Ga0530510_0197709

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2pd1-assembly1.cif.gz_A crystal structure of ne2512 protein of unknown function from nitrosomonas europaea 0.9872 3 98
2pd1-assembly1.cif.gz_A crystal structure of ne2512 protein of unknown function from nitrosomonas europaea 0.9576 3 98
4zos-assembly2.cif.gz_B 2.20 angstrom resolution crystal structure of protein ye0340 of unidentified function from yersinia enterocolitica subsp. enterocolitica 8081] 0.8783 2 96
2omo-assembly4.cif.gz_E putative antibiotic biosynthesis monooxygenase from nitrosomonas europaea 0.8779 5 96
3fgv-assembly1.cif.gz_B crystal structure of a putative antibiotic biosynthesis monooxygenase (spo2313) from silicibacter pomeroyi dss-3 at 1.30 a resolution 0.8669 3 95
ID Description Score Start End Superfamily
2pd1D01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9798 4 94 3.30.70.100
2pd1D01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9589 4 94 3.30.70.100
af_O33291_1_95_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8811 3 98 3.30.70.100
4zosB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8783 2 96 3.30.70.100
af_O33291_1_95_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8727 3 98 3.30.70.100
ID Description Score Start End GO Terms
AF-G8NQ21-F1-model_v4 Antibiotic biosynthesis monooxygenase 0.9949 2 98
AF-A0A260ICP2-F1-model_v4 Luciferase-like domain-containing protein 0.9945 2 98 GO:0004497
GO:0016705
AF-A0A7W8ILJ8-F1-model_v4 Quinol monooxygenase YgiN 0.9936 2 98 GO:0004497
AF-A0A5C9CXV9-F1-model_v4 deleted 0.9934 3 98
AF-A0A495J9D3-F1-model_v4 Quinol monooxygenase YgiN 0.9929 2 98 GO:0004497

Map