F440504
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 423 | 247 | 423 | 187 |
Family's Representative Sequence
| Representative Sequence | 3300009098|Ga0105245_10001900|Ga0105245_100019008 |
| Length | 200 |
| Sequence | MGKTRLNPESIKGGAMRNFILGVIVTILLLGFCTMAYLLLGYMETNADAQPSHLEMRVAMSALDASMDKHAPRISSPIPPTDDNLIAGMKVYTMNCALCHGGLDKKPSTLQHNFYPPVPQLILHPIDDPDWHVYYAVKTGVRYTGMPAWNNALADDDIWKVTEFLTHLEKLPAPVQEFWKNSFGTPPAPTPSAVPESHHH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 6 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 7 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 8 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 9 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 10 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 11 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 18 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 21 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 41 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 50 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 53 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 54 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 55 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 57 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 58 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 59 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 60 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 61 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 62 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 63 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 64 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 65 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 71 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 72 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 73 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 74 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 75 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 85 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 101 | 3300022730 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 | Metagenome | Rhizosphere |
| 102 | 3300022732 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 | Metagenome | Rhizosphere |
| 103 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 104 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 105 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 165 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 166 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 170 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 171 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 172 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 173 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 174 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 175 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 176 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 177 | 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Metagenome | Unclassified |
| 178 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 179 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 180 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 181 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 182 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 183 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 184 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 185 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 186 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 187 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 188 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 189 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 190 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 191 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 192 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 193 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 194 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 195 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 196 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 197 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 198 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 199 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 200 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 201 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 202 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 203 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 228 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 229 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 230 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 231 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 232 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 233 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 234 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 235 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 236 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 237 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 238 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 239 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 240 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 241 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 242 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 243 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 244 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.11 |
| Metatranscriptomes | 1.89 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.24 |
| Nodule | 0 |
| Rhizoplane | 4.96 |
| Rhizosphere | 92.67 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.13 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MBSR1b_contig_14265637 | 2162886012 | Bacteria | 3352 |
| 2 | LJNas_1000008 | 3300000546 | Bacteria | 25309 |
| 3 | JGI24747J21853_1003750 | 3300001978 | Bacteria | 1326 |
| 4 | JGI24737J22298_10009731 | 3300001990 | Bacteria | 3186 |
| 5 | JGI24743J22301_10000415 | 3300001991 | Bacteria | 4822 |
| 6 | JGI24745J21846_1005447 | 3300002073 | Unclassified | 1390 |
| 7 | JGI24748J21848_1002984 | 3300002074 | Bacteria | 1926 |
| 8 | JGI24751J29686_10003600 | 3300002459 | Bacteria | 3124 |
| 9 | rootH2_10158254 | 3300003320 | Bacteria | 1886 |
| 10 | Ga0065712_10079928 | 3300005290 | Bacteria | 3164 |
| 11 | Ga0065715_10090939 | 3300005293 | Bacteria | 6296 |
| 12 | Ga0070676_10007823 | 3300005328 | Bacteria | 5746 |
| 13 | Ga0070683_100001062 | 3300005329 | Bacteria | 20615 |
| 14 | Ga0070690_100044956 | 3300005330 | Bacteria | 2804 |
| 15 | Ga0070670_100038427 | 3300005331 | Bacteria | 4116 |
| 16 | Ga0070670_100110609 | 3300005331 | Unclassified | 2367 |
| 17 | Ga0070677_10012694 | 3300005333 | Bacteria | 2929 |
| 18 | Ga0068869_100124999 | 3300005334 | Unclassified | 1971 |
| 19 | Ga0070666_10021347 | 3300005335 | Bacteria | 4197 |
| 20 | Ga0070666_10030043 | 3300005335 | Bacteria | 3577 |
| 21 | Ga0070682_100065562 | 3300005337 | Bacteria | 2308 |
| 22 | Ga0068868_100011081 | 3300005338 | Bacteria | 6558 |
| 23 | Ga0068868_100030310 | 3300005338 | Unclassified | 4148 |
| 24 | Ga0070660_100002753 | 3300005339 | Bacteria | 12083 |
| 25 | Ga0070689_100003567 | 3300005340 | Bacteria | 10364 |
| 26 | Ga0070687_100014805 | 3300005343 | Bacteria | 3512 |
| 27 | Ga0070661_100038895 | 3300005344 | Bacteria | 3464 |
| 28 | Ga0070668_100000767 | 3300005347 | Bacteria | 22081 |
| 29 | Ga0070675_100072045 | 3300005354 | Bacteria | 2868 |
| 30 | Ga0070671_100025349 | 3300005355 | Bacteria | 4865 |
| 31 | Ga0070688_100000794 | 3300005365 | Bacteria | 15612 |
| 32 | Ga0070659_100009140 | 3300005366 | Bacteria | 7268 |
| 33 | Ga0070709_10006124 | 3300005434 | Bacteria | 6544 |
| 34 | Ga0070709_10050956 | 3300005434 | Unclassified | 2596 |
| 35 | Ga0070709_10095085 | 3300005434 | Bacteria | 1973 |
| 36 | Ga0070709_10112534 | 3300005434 | Bacteria | 1832 |
| 37 | Ga0070709_10190093 | 3300005434 | Bacteria | 1448 |
| 38 | Ga0070714_100000299 | 3300005435 | Bacteria | 37652 |
| 39 | Ga0070714_100004403 | 3300005435 | Bacteria | 10597 |
| 40 | Ga0070714_100044108 | 3300005435 | Bacteria | 3774 |
| 41 | Ga0070714_100062288 | 3300005435 | Bacteria | 3206 |
| 42 | Ga0070714_100065488 | 3300005435 | Bacteria | 3130 |
| 43 | Ga0070714_100075297 | 3300005435 | Bacteria | 2928 |
| 44 | Ga0070714_100298567 | 3300005435 | Unclassified | 1501 |
| 45 | Ga0070714_100300506 | 3300005435 | Unclassified | 1496 |
| 46 | Ga0070714_100876516 | 3300005435 | Unclassified | 871 |
| 47 | Ga0070713_100000060 | 3300005436 | Bacteria | 69784 |
| 48 | Ga0070713_100016622 | 3300005436 | Bacteria | 5535 |
| 49 | Ga0070713_100021298 | 3300005436 | Bacteria | 4983 |
| 50 | Ga0070713_100130484 | 3300005436 | Bacteria | 2215 |
| 51 | Ga0070713_100296387 | 3300005436 | Unclassified | 1488 |
| 52 | Ga0070713_100371334 | 3300005436 | Bacteria | 1331 |
| 53 | Ga0070713_100775052 | 3300005436 | Bacteria | 918 |
| 54 | Ga0070710_10119727 | 3300005437 | Bacteria | 1592 |
| 55 | Ga0070710_10246312 | 3300005437 | Bacteria | 1147 |
| 56 | Ga0070711_100000525 | 3300005439 | Bacteria | 19885 |
| 57 | Ga0070711_100002974 | 3300005439 | Bacteria | 9780 |
| 58 | Ga0070711_100113674 | 3300005439 | Bacteria | 1991 |
| 59 | Ga0070711_100142251 | 3300005439 | Bacteria | 1800 |
| 60 | Ga0070711_100420330 | 3300005439 | Bacteria | 1089 |
| 61 | Ga0070708_100000347 | 3300005445 | Bacteria | 34980 |
| 62 | Ga0070708_100002534 | 3300005445 | Bacteria | 14109 |
| 63 | Ga0070708_100006847 | 3300005445 | Bacteria | 9089 |
| 64 | Ga0070663_100060576 | 3300005455 | Bacteria | 2723 |
| 65 | Ga0070678_100015838 | 3300005456 | Bacteria | 4803 |
| 66 | Ga0070662_100007780 | 3300005457 | Bacteria | 6963 |
| 67 | Ga0070681_10023131 | 3300005458 | Bacteria | 6250 |
| 68 | Ga0068867_100061822 | 3300005459 | Bacteria | 2781 |
| 69 | Ga0068867_100573599 | 3300005459 | Unclassified | 980 |
| 70 | Ga0070685_10034904 | 3300005466 | Bacteria | 2835 |
| 71 | Ga0070706_100004125 | 3300005467 | Bacteria | 14130 |
| 72 | Ga0070706_100031570 | 3300005467 | Unclassified | 4884 |
| 73 | Ga0070706_100037294 | 3300005467 | Bacteria | 4490 |
| 74 | Ga0070706_100126319 | 3300005467 | Bacteria | 2385 |
| 75 | Ga0070707_100002300 | 3300005468 | Bacteria | 18254 |
| 76 | Ga0070707_100037541 | 3300005468 | Bacteria | 4624 |
| 77 | Ga0070707_100143895 | 3300005468 | Unclassified | 2320 |
| 78 | Ga0070698_100009673 | 3300005471 | Bacteria | 10312 |
| 79 | Ga0070698_100026328 | 3300005471 | Bacteria | 6054 |
| 80 | Ga0070698_100071655 | 3300005471 | Bacteria | 3475 |
| 81 | Ga0070698_101012508 | 3300005471 | Unclassified | 778 |
| 82 | Ga0070699_100000343 | 3300005518 | Bacteria | 45107 |
| 83 | Ga0070699_100013644 | 3300005518 | Bacteria | 6992 |
| 84 | Ga0070679_100481168 | 3300005530 | Bacteria | 1186 |
| 85 | Ga0070684_100004290 | 3300005535 | Bacteria | 10819 |
| 86 | Ga0070697_100000960 | 3300005536 | Bacteria | 21769 |
| 87 | Ga0070697_100002199 | 3300005536 | Bacteria | 14971 |
| 88 | Ga0070697_100015775 | 3300005536 | Bacteria | 5934 |
| 89 | Ga0068853_100001951 | 3300005539 | Bacteria | 15203 |
| 90 | Ga0070686_100001352 | 3300005544 | Bacteria | 13882 |
| 91 | Ga0070693_100010426 | 3300005547 | Bacteria | 4656 |
| 92 | Ga0068855_100042369 | 3300005563 | Bacteria | 5393 |
| 93 | Ga0068857_100000637 | 3300005577 | Bacteria | 25847 |
| 94 | Ga0068856_100253398 | 3300005614 | Bacteria | 1775 |
| 95 | Ga0070702_100005694 | 3300005615 | Bacteria | 5834 |
| 96 | Ga0068852_100001238 | 3300005616 | Bacteria | 17011 |
| 97 | Ga0068866_10003074 | 3300005718 | Bacteria | 6883 |
| 98 | Ga0068861_100530404 | 3300005719 | Bacteria | 1069 |
| 99 | Ga0068851_10002917 | 3300005834 | Bacteria | 7555 |
| 100 | Ga0068870_10118368 | 3300005840 | Bacteria | 1522 |
| 101 | Ga0068863_100477766 | 3300005841 | Bacteria | 1225 |
| 102 | Ga0068858_100064473 | 3300005842 | Unclassified | 3391 |
| 103 | Ga0068860_100059507 | 3300005843 | Bacteria | 3631 |
| 104 | Ga0068860_100493253 | 3300005843 | Bacteria | 1222 |
| 105 | Ga0068862_100026020 | 3300005844 | Bacteria | 4917 |
| 106 | Ga0068862_100421903 | 3300005844 | Bacteria | 1252 |
| 107 | Ga0070717_10002369 | 3300006028 | Bacteria | 13286 |
| 108 | Ga0070717_10016003 | 3300006028 | Bacteria | 5807 |
| 109 | Ga0070717_10070932 | 3300006028 | Bacteria | 2905 |
| 110 | Ga0070717_10092255 | 3300006028 | Bacteria | 2558 |
| 111 | Ga0070717_10219987 | 3300006028 | Bacteria | 1669 |
| 112 | Ga0070717_10363525 | 3300006028 | Bacteria | 1296 |
| 113 | Ga0070717_10515394 | 3300006028 | Unclassified | 1081 |
| 114 | Ga0070717_10561416 | 3300006028 | Bacteria | 1034 |
| 115 | Ga0070715_10045095 | 3300006163 | Bacteria | 1868 |
| 116 | Ga0070715_10072217 | 3300006163 | Bacteria | 1544 |
| 117 | Ga0070715_10566624 | 3300006163 | Bacteria | 661 |
| 118 | Ga0070716_100014543 | 3300006173 | Bacteria | 4032 |
| 119 | Ga0070716_100019252 | 3300006173 | Bacteria | 3565 |
| 120 | Ga0070716_100041130 | 3300006173 | Bacteria | 2574 |
| 121 | Ga0070712_100000780 | 3300006175 | Bacteria | 18819 |
| 122 | Ga0070712_100008838 | 3300006175 | Bacteria | 6343 |
| 123 | Ga0070712_100079657 | 3300006175 | Bacteria | 2368 |
| 124 | Ga0070712_100142085 | 3300006175 | Bacteria | 1833 |
| 125 | Ga0070712_100423908 | 3300006175 | Bacteria | 1103 |
| 126 | Ga0097621_100001100 | 3300006237 | Bacteria | 18890 |
| 127 | Ga0097621_100063505 | 3300006237 | Bacteria | 3035 |
| 128 | Ga0068871_100111672 | 3300006358 | Bacteria | 2299 |
| 129 | Ga0075434_100377800 | 3300006871 | Bacteria | 1438 |
| 130 | Ga0068865_100015126 | 3300006881 | Bacteria | 4916 |
| 131 | Ga0075435_100014849 | 3300007076 | Bacteria | 5840 |
| 132 | Ga0099795_10037392 | 3300007788 | Unclassified | 1708 |
| 133 | Ga0105250_10084355 | 3300009092 | Bacteria | 1289 |
| 134 | Ga0105240_10198499 | 3300009093 | Bacteria | 2353 |
| 135 | Ga0105245_10001900 | 3300009098 | Bacteria | 18993 |
| 136 | Ga0105245_10006049 | 3300009098 | Bacteria | 10639 |
| 137 | Ga0105245_10206483 | 3300009098 | Bacteria | 1889 |
| 138 | Ga0105245_10581111 | 3300009098 | Bacteria | 1145 |
| 139 | Ga0105247_10000903 | 3300009101 | Bacteria | 22344 |
| 140 | Ga0105247_10329054 | 3300009101 | Unclassified | 1068 |
| 141 | Ga0105241_10001381 | 3300009174 | Bacteria | 18535 |
| 142 | Ga0105241_10314408 | 3300009174 | Bacteria | 1348 |
| 143 | Ga0105242_10023224 | 3300009176 | Unclassified | 4889 |
| 144 | Ga0105242_10252683 | 3300009176 | Bacteria | 1589 |
| 145 | Ga0105248_10038199 | 3300009177 | Bacteria | 5373 |
| 146 | Ga0105248_10192760 | 3300009177 | Bacteria | 2296 |
| 147 | Ga0105248_10436186 | 3300009177 | Bacteria | 1476 |
| 148 | Ga0105237_10018546 | 3300009545 | Bacteria | 7199 |
| 149 | Ga0105249_10113306 | 3300009553 | Bacteria | 2566 |
| 150 | Ga0105249_10274508 | 3300009553 | Unclassified | 1681 |
| 151 | Ga0099796_10064792 | 3300010159 | Unclassified | 1305 |
| 152 | Ga0105239_10029583 | 3300010375 | Bacteria | 6023 |
| 153 | Ga0105239_10366911 | 3300010375 | Bacteria | 1627 |
| 154 | Ga0105246_10000750 | 3300011119 | Bacteria | 18492 |
| 155 | Ga0157373_10006392 | 3300013100 | Bacteria | 8802 |
| 156 | Ga0157371_10007759 | 3300013102 | Bacteria | 8628 |
| 157 | Ga0157370_10451907 | 3300013104 | Unclassified | 1181 |
| 158 | Ga0157369_10248467 | 3300013105 | Unclassified | 1857 |
| 159 | Ga0157374_10145880 | 3300013296 | Bacteria | 2299 |
| 160 | Ga0157374_10154847 | 3300013296 | Unclassified | 2230 |
| 161 | Ga0157378_10000411 | 3300013297 | Bacteria | 42281 |
| 162 | Ga0157378_10130819 | 3300013297 | Bacteria | 2323 |
| 163 | Ga0163162_10108674 | 3300013306 | Unclassified | 2870 |
| 164 | Ga0163162_10204937 | 3300013306 | Bacteria | 2101 |
| 165 | Ga0163162_10308618 | 3300013306 | Bacteria | 1714 |
| 166 | Ga0157372_10004071 | 3300013307 | Bacteria | 15674 |
| 167 | Ga0157372_10156184 | 3300013307 | Bacteria | 2635 |
| 168 | Ga0157372_10183978 | 3300013307 | Bacteria | 2419 |
| 169 | Ga0157372_10314696 | 3300013307 | Bacteria | 1822 |
| 170 | Ga0163163_10075151 | 3300014325 | Bacteria | 3372 |
| 171 | Ga0163163_10139028 | 3300014325 | Bacteria | 2470 |
| 172 | Ga0157377_10001207 | 3300014745 | Bacteria | 11008 |
| 173 | Ga0157379_10002043 | 3300014968 | Bacteria | 16758 |
| 174 | Ga0157379_10004106 | 3300014968 | Bacteria | 12424 |
| 175 | Ga0157376_10014082 | 3300014969 | Bacteria | 5989 |
| 176 | Ga0157376_10021292 | 3300014969 | Bacteria | 5035 |
| 177 | Ga0163161_10003449 | 3300017792 | Bacteria | 11078 |
| 178 | Ga0213876_10049080 | 3300021384 | Bacteria | 2230 |
| 179 | Ga0213876_10127695 | 3300021384 | Bacteria | 1351 |
| 180 | Ga0224570_100452 | 3300022730 | Bacteria | 3223 |
| 181 | Ga0224570_108151 | 3300022730 | Unclassified | 648 |
| 182 | Ga0224569_107221 | 3300022732 | Unclassified | 806 |
| 183 | Ga0224569_107319 | 3300022732 | Unclassified | 799 |
| 184 | Ga0224572_1071110 | 3300024225 | Unclassified | 643 |
| 185 | Ga0228598_1000536 | 3300024227 | Bacteria | 7896 |
| 186 | Ga0207697_10003737 | 3300025315 | Bacteria | 7445 |
| 187 | Ga0207656_10003649 | 3300025321 | Bacteria | 5319 |
| 188 | Ga0207682_10070647 | 3300025893 | Unclassified | 1479 |
| 189 | Ga0207692_10016345 | 3300025898 | Bacteria | 3284 |
| 190 | Ga0207692_10038197 | 3300025898 | Bacteria | 2354 |
| 191 | Ga0207692_10284977 | 3300025898 | Bacteria | 1001 |
| 192 | Ga0207642_10029547 | 3300025899 | Bacteria | 2271 |
| 193 | Ga0207688_10005673 | 3300025901 | Bacteria | 6788 |
| 194 | Ga0207680_10007582 | 3300025903 | Bacteria | 5298 |
| 195 | Ga0207647_10007354 | 3300025904 | Bacteria | 7961 |
| 196 | Ga0207699_10004663 | 3300025906 | Bacteria | 6555 |
| 197 | Ga0207699_10020398 | 3300025906 | Bacteria | 3552 |
| 198 | Ga0207699_10038327 | 3300025906 | Bacteria | 2746 |
| 199 | Ga0207699_10365009 | 3300025906 | Bacteria | 1022 |
| 200 | Ga0207645_10000011 | 3300025907 | Bacteria | 132246 |
| 201 | Ga0207643_10000185 | 3300025908 | Bacteria | 42810 |
| 202 | Ga0207684_10000081 | 3300025910 | Bacteria | 178619 |
| 203 | Ga0207684_10025073 | 3300025910 | Bacteria | 5082 |
| 204 | Ga0207684_10148863 | 3300025910 | Bacteria | 2014 |
| 205 | Ga0207654_10246313 | 3300025911 | Bacteria | 1196 |
| 206 | Ga0207707_10017723 | 3300025912 | Bacteria | 6213 |
| 207 | Ga0207695_10153177 | 3300025913 | Bacteria | 2243 |
| 208 | Ga0207695_10197937 | 3300025913 | Bacteria | 1925 |
| 209 | Ga0207671_10132005 | 3300025914 | Bacteria | 1918 |
| 210 | Ga0207693_10000191 | 3300025915 | Bacteria | 56013 |
| 211 | Ga0207693_10009709 | 3300025915 | Bacteria | 7834 |
| 212 | Ga0207693_10020239 | 3300025915 | Bacteria | 5293 |
| 213 | Ga0207693_10356284 | 3300025915 | Bacteria | 1145 |
| 214 | Ga0207663_10005262 | 3300025916 | Bacteria | 6515 |
| 215 | Ga0207663_10006472 | 3300025916 | Bacteria | 5994 |
| 216 | Ga0207663_10009210 | 3300025916 | Bacteria | 5208 |
| 217 | Ga0207663_10039784 | 3300025916 | Bacteria | 2852 |
| 218 | Ga0207663_10148469 | 3300025916 | Bacteria | 1642 |
| 219 | Ga0207663_10389731 | 3300025916 | Bacteria | 1063 |
| 220 | Ga0207663_10797252 | 3300025916 | Bacteria | 752 |
| 221 | Ga0207662_10002009 | 3300025918 | Bacteria | 10055 |
| 222 | Ga0207657_10000505 | 3300025919 | Bacteria | 41238 |
| 223 | Ga0207652_10361711 | 3300025921 | Bacteria | 1310 |
| 224 | Ga0207646_10002622 | 3300025922 | Bacteria | 21121 |
| 225 | Ga0207646_10266624 | 3300025922 | Bacteria | 1548 |
| 226 | Ga0207646_10372457 | 3300025922 | Bacteria | 1290 |
| 227 | Ga0207646_11168056 | 3300025922 | Unclassified | 676 |
| 228 | Ga0207681_10113096 | 3300025923 | Bacteria | 1978 |
| 229 | Ga0207694_10725691 | 3300025924 | Unclassified | 838 |
| 230 | Ga0207650_10000336 | 3300025925 | Bacteria | 45514 |
| 231 | Ga0207659_10014180 | 3300025926 | Bacteria | 5131 |
| 232 | Ga0207687_10008478 | 3300025927 | Bacteria | 6720 |
| 233 | Ga0207687_10041220 | 3300025927 | Bacteria | 3169 |
| 234 | Ga0207687_10095570 | 3300025927 | Bacteria | 2176 |
| 235 | Ga0207700_10000358 | 3300025928 | Bacteria | 26677 |
| 236 | Ga0207700_10001527 | 3300025928 | Bacteria | 13113 |
| 237 | Ga0207700_10027786 | 3300025928 | Bacteria | 3967 |
| 238 | Ga0207700_10064027 | 3300025928 | Bacteria | 2799 |
| 239 | Ga0207700_10077140 | 3300025928 | Bacteria | 2588 |
| 240 | Ga0207700_10101140 | 3300025928 | Bacteria | 2299 |
| 241 | Ga0207700_10290255 | 3300025928 | Bacteria | 1409 |
| 242 | Ga0207700_10472805 | 3300025928 | Bacteria | 1107 |
| 243 | Ga0207700_10781327 | 3300025928 | Bacteria | 854 |
| 244 | Ga0207664_10000320 | 3300025929 | Bacteria | 35727 |
| 245 | Ga0207664_10008569 | 3300025929 | Bacteria | 7144 |
| 246 | Ga0207664_10087436 | 3300025929 | Bacteria | 2548 |
| 247 | Ga0207664_10088467 | 3300025929 | Bacteria | 2534 |
| 248 | Ga0207664_10133914 | 3300025929 | Unclassified | 2089 |
| 249 | Ga0207664_10170015 | 3300025929 | Bacteria | 1865 |
| 250 | Ga0207664_10248209 | 3300025929 | Bacteria | 1552 |
| 251 | Ga0207664_10507209 | 3300025929 | Bacteria | 1080 |
| 252 | Ga0207664_10761516 | 3300025929 | Unclassified | 871 |
| 253 | Ga0207644_10010589 | 3300025931 | Bacteria | 6079 |
| 254 | Ga0207690_10067511 | 3300025932 | Bacteria | 2453 |
| 255 | Ga0207706_10000747 | 3300025933 | Bacteria | 33873 |
| 256 | Ga0207686_10012405 | 3300025934 | Unclassified | 4687 |
| 257 | Ga0207686_10250192 | 3300025934 | Unclassified | 1294 |
| 258 | Ga0207669_10011301 | 3300025937 | Bacteria | 4339 |
| 259 | Ga0207704_10059148 | 3300025938 | Bacteria | 2364 |
| 260 | Ga0207665_10013441 | 3300025939 | Bacteria | 5383 |
| 261 | Ga0207665_10023087 | 3300025939 | Bacteria | 4098 |
| 262 | Ga0207665_10031634 | 3300025939 | Bacteria | 3501 |
| 263 | Ga0207665_10088409 | 3300025939 | Unclassified | 2143 |
| 264 | Ga0207691_10000476 | 3300025940 | Bacteria | 39750 |
| 265 | Ga0207711_10023734 | 3300025941 | Bacteria | 5135 |
| 266 | Ga0207689_10000194 | 3300025942 | Bacteria | 53148 |
| 267 | Ga0207661_10005547 | 3300025944 | Bacteria | 8902 |
| 268 | Ga0207679_10001049 | 3300025945 | Bacteria | 17586 |
| 269 | Ga0207667_10207902 | 3300025949 | Unclassified | 2006 |
| 270 | Ga0207651_10000446 | 3300025960 | Bacteria | 17458 |
| 271 | Ga0207712_10035606 | 3300025961 | Bacteria | 3384 |
| 272 | Ga0207668_10069577 | 3300025972 | Bacteria | 2506 |
| 273 | Ga0207640_10020949 | 3300025981 | Bacteria | 3888 |
| 274 | Ga0207658_10012570 | 3300025986 | Bacteria | 5778 |
| 275 | Ga0207677_10037631 | 3300026023 | Bacteria | 3164 |
| 276 | Ga0207677_10077895 | 3300026023 | Unclassified | 2365 |
| 277 | Ga0207677_10150764 | 3300026023 | Bacteria | 1793 |
| 278 | Ga0207703_10143715 | 3300026035 | Bacteria | 2073 |
| 279 | Ga0207703_10702984 | 3300026035 | Unclassified | 961 |
| 280 | Ga0207639_10072298 | 3300026041 | Bacteria | 2700 |
| 281 | Ga0207678_10001308 | 3300026067 | Bacteria | 23081 |
| 282 | Ga0207702_10006499 | 3300026078 | Bacteria | 10064 |
| 283 | Ga0207702_10209632 | 3300026078 | Bacteria | 1811 |
| 284 | Ga0207641_10000316 | 3300026088 | Bacteria | 59952 |
| 285 | Ga0207648_10000690 | 3300026089 | Bacteria | 37808 |
| 286 | Ga0207676_10000107 | 3300026095 | Bacteria | 74255 |
| 287 | Ga0207674_10000034 | 3300026116 | Bacteria | 137337 |
| 288 | Ga0207675_100040371 | 3300026118 | Bacteria | 4358 |
| 289 | Ga0207683_10000674 | 3300026121 | Bacteria | 31299 |
| 290 | Ga0207698_10136827 | 3300026142 | Bacteria | 2103 |
| 291 | Ga0265354_1012159 | 3300028016 | Bacteria | 817 |
| 292 | Ga0265356_1000192 | 3300028017 | Bacteria | 11540 |
| 293 | Ga0268266_10056986 | 3300028379 | Bacteria | 3361 |
| 294 | Ga0268265_10021898 | 3300028380 | Bacteria | 4484 |
| 295 | Ga0268264_10059533 | 3300028381 | Bacteria | 3200 |
| 296 | Ga0265338_10000863 | 3300028800 | Bacteria | 51343 |
| 297 | Ga0265338_10061753 | 3300028800 | Bacteria | 3282 |
| 298 | Ga0265338_10108129 | 3300028800 | Bacteria | 2247 |
| 299 | Ga0265338_10149935 | 3300028800 | Bacteria | 1813 |
| 300 | Ga0265338_10544805 | 3300028800 | Unclassified | 813 |
| 301 | Ga0265762_1000209 | 3300030760 | Bacteria | 9385 |
| 302 | Ga0265762_1002708 | 3300030760 | Bacteria | 3170 |
| 303 | Ga0265762_1026208 | 3300030760 | Unclassified | 1090 |
| 304 | Ga0265763_1004423 | 3300030763 | Bacteria | 1151 |
| 305 | Ga0265760_10000151 | 3300031090 | Bacteria | 17947 |
| 306 | Ga0265760_10000746 | 3300031090 | Bacteria | 9303 |
| 307 | Ga0265760_10001574 | 3300031090 | Bacteria | 6720 |
| 308 | Ga0265760_10028610 | 3300031090 | Unclassified | 1636 |
| 309 | Ga0265325_10025116 | 3300031241 | Bacteria | 3237 |
| 310 | Ga0265340_10267656 | 3300031247 | Unclassified | 760 |
| 311 | Ga0265339_10019904 | 3300031249 | Bacteria | 3929 |
| 312 | Ga0265316_10153356 | 3300031344 | Bacteria | 1725 |
| 313 | Ga0265316_10569145 | 3300031344 | Unclassified | 805 |
| 314 | Ga0316214_1006653 | 3300033545 | Bacteria | 1530 |
| 315 | Ga0316212_1001581 | 3300033547 | Bacteria | 3125 |
| 316 | Ga0316212_1018960 | 3300033547 | Unclassified | 966 |
| 317 | Ga0373926_0043501 | 3300035083 | Bacteria | 1607 |
| 318 | Ga0373934_0004385 | 3300035086 | Bacteria | 5214 |
| 319 | Ga0373944_0015985 | 3300035089 | Bacteria | 2111 |
| 320 | Ga0373923_0003853 | 3300035111 | Bacteria | 4884 |
| 321 | Ga0373923_0128190 | 3300035111 | Unclassified | 1138 |
| 322 | Ga0373936_0007249 | 3300035113 | Bacteria | 4171 |
| 323 | Ga0373936_0041541 | 3300035113 | Bacteria | 1845 |
| 324 | Ga0373945_0087432 | 3300035116 | Unclassified | 1202 |
| 325 | Ga0373953_0010054 | 3300035117 | Bacteria | 3279 |
| 326 | Ga0373954_0020121 | 3300035118 | Bacteria | 3016 |
| 327 | Ga0373956_0101077 | 3300035119 | Bacteria | 1337 |
| 328 | Ga0373957_0031849 | 3300035120 | Bacteria | 1939 |
| 329 | Ga0373943_0004633 | 3300035170 | Bacteria | 6216 |
| 330 | Ga0373943_0057756 | 3300035170 | Bacteria | 1929 |
| 331 | Ga0373943_0285378 | 3300035170 | Bacteria | 934 |
| 332 | Ga0373946_0045435 | 3300035171 | Bacteria | 1817 |
| 333 | Ga0373946_0151017 | 3300035171 | Bacteria | 1084 |
| 334 | Ga0373955_0188351 | 3300035172 | Bacteria | 1226 |
| 335 | Ga0373955_0218132 | 3300035172 | Unclassified | 1139 |
| 336 | Ga0373955_0263238 | 3300035172 | Bacteria | 1035 |
| 337 | Ga0373955_0599203 | 3300035172 | Unclassified | 675 |
| 338 | Ga0373924_0008174 | 3300035410 | Bacteria | 3793 |
| 339 | Ga0373931_0104556 | 3300035691 | Bacteria | 1597 |
| 340 | Ga0373935_0025491 | 3300035692 | Unclassified | 3644 |
| 341 | Ga0373935_0051891 | 3300035692 | Bacteria | 2605 |
| 342 | Ga0373935_0111164 | 3300035692 | Bacteria | 1819 |
| 343 | Ga0373927_0000062 | 3300035695 | Bacteria | 77303 |
| 344 | Ga0373927_0019005 | 3300035695 | Bacteria | 4508 |
| 345 | Ga0373947_0000539 | 3300035725 | Bacteria | 22153 |
| 346 | Ga0373947_0110248 | 3300035725 | Unclassified | 1738 |
| 347 | Ga0373947_0705510 | 3300035725 | Unclassified | 688 |
| 348 | Ga0373947_0844090 | 3300035725 | Unclassified | 625 |
| 349 | Ga0373937_0011606 | 3300036401 | Bacteria | 7738 |
| 350 | Ga0373937_0060774 | 3300036401 | Bacteria | 3472 |
| 351 | Ga0373937_0321484 | 3300036401 | Unclassified | 1464 |
| 352 | Ga0373937_0498961 | 3300036401 | Bacteria | 1156 |
| 353 | Ga0373925_0001460 | 3300037068 | Bacteria | 20404 |
| 354 | Ga0373925_0013393 | 3300037068 | Bacteria | 5935 |
| 355 | Ga0373925_0026745 | 3300037068 | Bacteria | 4223 |
| 356 | Ga0436365_0510483 | 3300039437 | Bacteria | 2542 |
| 357 | Ga0436365_1934391 | 3300039437 | Bacteria | 1528 |
| 358 | Ga0436363_0290563 | 3300039450 | Bacteria | 1123 |
| 359 | Ga0436362_1226293 | 3300039453 | Bacteria | 6161 |
| 360 | Ga0466967_0174983 | 3300045976 | Bacteria | 2022 |
| 361 | Ga0495629_0127838 | 3300046459 | Bacteria | 1770 |
| 362 | Ga0495641_0270402 | 3300046461 | Unclassified | 765 |
| 363 | Ga0495653_0087938 | 3300046463 | Bacteria | 2281 |
| 364 | Ga0495580_0010415 | 3300046472 | Bacteria | 7246 |
| 365 | Ga0495580_0025716 | 3300046472 | Bacteria | 4300 |
| 366 | Ga0495580_0037587 | 3300046472 | Unclassified | 3472 |
| 367 | Ga0495580_0183623 | 3300046472 | Bacteria | 1444 |
| 368 | Ga0495580_0293758 | 3300046472 | Bacteria | 1107 |
| 369 | Ga0495580_0340483 | 3300046472 | Bacteria | 1017 |
| 370 | Ga0495582_0021931 | 3300046473 | Unclassified | 3494 |
| 371 | Ga0495582_0026853 | 3300046473 | Bacteria | 3155 |
| 372 | Ga0495664_0009882 | 3300046477 | Bacteria | 5351 |
| 373 | Ga0495628_0267694 | 3300046516 | Unclassified | 1272 |
| 374 | Ga0495630_0006985 | 3300046517 | Bacteria | 8050 |
| 375 | Ga0495652_0312953 | 3300046529 | Bacteria | 1137 |
| 376 | Ga0495665_0127432 | 3300046531 | Unclassified | 1333 |
| 377 | Ga0495640_0284842 | 3300046533 | Bacteria | 1029 |
| 378 | Ga0495645_0210203 | 3300046543 | Unclassified | 1314 |
| 379 | Ga0495635_0133105 | 3300046663 | Bacteria | 1695 |
| 380 | Ga0495657_0112350 | 3300046675 | Bacteria | 1725 |
| 381 | Ga0495623_0253076 | 3300046679 | Bacteria | 990 |
| 382 | Ga0495646_0052754 | 3300046680 | Bacteria | 2455 |
| 383 | Ga0495647_0136837 | 3300046681 | Bacteria | 1042 |
| 384 | Ga0495624_0033868 | 3300046690 | Bacteria | 3308 |
| 385 | Ga0495581_0026118 | 3300047315 | Bacteria | 3388 |
| 386 | Ga0495674_0009986 | 3300047319 | Bacteria | 8995 |
| 387 | Ga0495674_0013514 | 3300047319 | Bacteria | 7676 |
| 388 | Ga0495676_0109980 | 3300047321 | Bacteria | 2024 |
| 389 | Ga0495684_0303784 | 3300047471 | Bacteria | 1145 |
| 390 | Ga0495602_0025150 | 3300048088 | Bacteria | 5765 |
| 391 | Ga0495602_0032541 | 3300048088 | Bacteria | 4908 |
| 392 | Ga0495614_0213589 | 3300048089 | Bacteria | 875 |
| 393 | Ga0496100_0747254 | 3300048903 | Unclassified | 765 |
| 394 | Ga0496101_0068198 | 3300048904 | Bacteria | 2600 |
| 395 | Ga0496102_0037057 | 3300048905 | Bacteria | 4398 |
| 396 | Ga0496102_0056498 | 3300048905 | Bacteria | 3581 |
| 397 | Ga0496102_0209591 | 3300048905 | Bacteria | 1837 |
| 398 | Ga0496103_0004482 | 3300048906 | Bacteria | 8464 |
| 399 | Ga0496104_0006518 | 3300048907 | Bacteria | 10268 |
| 400 | Ga0496104_0380734 | 3300048907 | Unclassified | 1323 |
| 401 | Ga0496106_0360198 | 3300048909 | Bacteria | 1168 |
| 402 | Ga0496107_0027203 | 3300048910 | Bacteria | 4061 |
| 403 | Ga0496108_0000364 | 3300048911 | Bacteria | 38115 |
| 404 | Ga0496109_0000083 | 3300048912 | Bacteria | 96495 |
| 405 | Ga0496110_0000236 | 3300048913 | Bacteria | 35769 |
| 406 | Ga0496111_0008193 | 3300048914 | Bacteria | 6908 |
| 407 | Ga0496111_0236821 | 3300048914 | Bacteria | 1356 |
| 408 | Ga0496112_0000033 | 3300048915 | Bacteria | 112312 |
| 409 | Ga0496112_0042146 | 3300048915 | Bacteria | 4466 |
| 410 | Ga0496112_0123674 | 3300048915 | Bacteria | 2558 |
| 411 | Ga0496113_0004588 | 3300048916 | Bacteria | 8517 |
| 412 | Ga0496114_0468494 | 3300048917 | Bacteria | 1115 |
| 413 | Ga0496115_0006102 | 3300048918 | Bacteria | 8805 |
| 414 | nmdc:mga0rr50_943236_c1 | 3300050513 | Bacteria | 736 |
| 415 | nmdc:mga08x19_19007_c1 | 3300050514 | Bacteria | 4214 |
| 416 | nmdc:mga08x19_232018_c1 | 3300050514 | Bacteria | 1270 |
| 417 | nmdc:mga08x19_274843_c1 | 3300050514 | Unclassified | 1166 |
| 418 | Ga0495601_0086469 | 3300053077 | Unclassified | 2015 |
| 419 | Ga0495612_0079687 | 3300053078 | Bacteria | 1375 |
| 420 | Ga0495612_0122156 | 3300053078 | Bacteria | 1121 |
| 421 | Ga0495612_0425583 | 3300053078 | Unclassified | 605 |
| 422 | Ga0495619_0508608 | 3300053085 | Unclassified | 828 |
| 423 | Ga0500590_103724 | 3300053148 | Bacteria | 1361 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046461 | Ga0495641_0270402 | Ga0495641_0270402_226_720 | 158 |
| 2 | 3300025928 | Ga0207700_10290255 | Ga0207700_102902552 | 160 |
| 3 | 3300006028 | Ga0070717_10561416 | Ga0070717_105614161 | 163 |
| 4 | 3300035116 | Ga0373945_0087432 | Ga0373945_0087432_644_1186 | 163 |
| 5 | 3300036401 | Ga0373937_0498961 | Ga0373937_0498961_427_993 | 163 |
| 6 | 3300046675 | Ga0495657_0112350 | Ga0495657_0112350_424_990 | 163 |
| 7 | 3300050514 | nmdc:mga08x19_274843_c1 | nmdc:mga08x19_274843_c1_52_612 | 163 |
| 8 | 3300014969 | Ga0157376_10021292 | Ga0157376_100212925 | 164 |
| 9 | 3300005435 | Ga0070714_100044108 | Ga0070714_1000441083 | 165 |
| 10 | 3300025912 | Ga0207707_10017723 | Ga0207707_100177233 | 165 |
| 11 | 3300025929 | Ga0207664_10088467 | Ga0207664_100884673 | 165 |
| 12 | 3300036401 | Ga0373937_0321484 | Ga0373937_0321484_837_1448 | 165 |
| 13 | 3300046472 | Ga0495580_0340483 | Ga0495580_0340483_377_943 | 165 |
| 14 | 3300005434 | Ga0070709_10112534 | Ga0070709_101125342 | 166 |
| 15 | 3300031090 | Ga0265760_10028610 | Ga0265760_100286101 | 166 |
| 16 | 3300013307 | Ga0157372_10183978 | Ga0157372_101839783 | 167 |
| 17 | 3300005467 | Ga0070706_100126319 | Ga0070706_1001263192 | 168 |
| 18 | 3300025910 | Ga0207684_10148863 | Ga0207684_101488632 | 168 |
| 19 | 3300028800 | Ga0265338_10061753 | Ga0265338_100617531 | 168 |
| 20 | 3300031241 | Ga0265325_10025116 | Ga0265325_100251162 | 168 |
| 21 | 3300005530 | Ga0070679_100481168 | Ga0070679_1004811682 | 169 |
| 22 | 3300025921 | Ga0207652_10361711 | Ga0207652_103617112 | 169 |
| 23 | 3300025939 | Ga0207665_10088409 | Ga0207665_100884092 | 169 |
| 24 | 3300035172 | Ga0373955_0599203 | Ga0373955_0599203_37_648 | 169 |
| 25 | 3300005434 | Ga0070709_10095085 | Ga0070709_100950852 | 170 |
| 26 | 3300005434 | Ga0070709_10190093 | Ga0070709_101900932 | 170 |
| 27 | 3300005435 | Ga0070714_100062288 | Ga0070714_1000622882 | 170 |
| 28 | 3300005435 | Ga0070714_100065488 | Ga0070714_1000654882 | 170 |
| 29 | 3300005436 | Ga0070713_100000060 | Ga0070713_10000006015 | 170 |
| 30 | 3300005437 | Ga0070710_10119727 | Ga0070710_101197272 | 170 |
| 31 | 3300005439 | Ga0070711_100000525 | Ga0070711_1000005254 | 170 |
| 32 | 3300006028 | Ga0070717_10016003 | Ga0070717_100160032 | 170 |
| 33 | 3300006163 | Ga0070715_10045095 | Ga0070715_100450952 | 170 |
| 34 | 3300006175 | Ga0070712_100000780 | Ga0070712_1000007809 | 170 |
| 35 | 3300025898 | Ga0207692_10038197 | Ga0207692_100381972 | 170 |
| 36 | 3300025906 | Ga0207699_10020398 | Ga0207699_100203983 | 170 |
| 37 | 3300025915 | Ga0207693_10000191 | Ga0207693_1000019121 | 170 |
| 38 | 3300025916 | Ga0207663_10006472 | Ga0207663_100064726 | 170 |
| 39 | 3300025928 | Ga0207700_10000358 | Ga0207700_100003589 | 170 |
| 40 | 3300025929 | Ga0207664_10170015 | Ga0207664_101700152 | 170 |
| 41 | 3300025929 | Ga0207664_10248209 | Ga0207664_102482092 | 170 |
| 42 | 3300035111 | Ga0373923_0128190 | Ga0373923_0128190_443_1006 | 170 |
| 43 | 3300035113 | Ga0373936_0041541 | Ga0373936_0041541_332_895 | 170 |
| 44 | 3300035692 | Ga0373935_0025491 | Ga0373935_0025491_808_1371 | 170 |
| 45 | 3300035725 | Ga0373947_0110248 | Ga0373947_0110248_241_804 | 170 |
| 46 | 3300035725 | Ga0373947_0844090 | Ga0373947_0844090_43_606 | 170 |
| 47 | 3300037068 | Ga0373925_0026745 | Ga0373925_0026745_688_1251 | 170 |
| 48 | 3300046459 | Ga0495629_0127838 | Ga0495629_0127838_1069_1632 | 170 |
| 49 | 3300046472 | Ga0495580_0010415 | Ga0495580_0010415_4757_5320 | 170 |
| 50 | 3300046473 | Ga0495582_0021931 | Ga0495582_0021931_2919_3482 | 170 |
| 51 | 3300046543 | Ga0495645_0210203 | Ga0495645_0210203_717_1280 | 170 |
| 52 | 3300046681 | Ga0495647_0136837 | Ga0495647_0136837_428_991 | 170 |
| 53 | 3300047319 | Ga0495674_0009986 | Ga0495674_0009986_1130_1693 | 170 |
| 54 | 3300048907 | Ga0496104_0380734 | Ga0496104_0380734_86_649 | 170 |
| 55 | 3300048918 | Ga0496115_0006102 | Ga0496115_0006102_4856_5419 | 170 |
| 56 | 3300053077 | Ga0495601_0086469 | Ga0495601_0086469_926_1489 | 170 |
| 57 | 3300053078 | Ga0495612_0079687 | Ga0495612_0079687_411_974 | 170 |
| 58 | 3300053085 | Ga0495619_0508608 | Ga0495619_0508608_102_665 | 170 |
| 59 | 3300005458 | Ga0070681_10023131 | Ga0070681_100231314 | 171 |
| 60 | 3300006028 | Ga0070717_10070932 | Ga0070717_100709323 | 171 |
| 61 | 3300006028 | Ga0070717_10515394 | Ga0070717_105153942 | 171 |
| 62 | 3300009093 | Ga0105240_10198499 | Ga0105240_101984992 | 171 |
| 63 | 3300013104 | Ga0157370_10451907 | Ga0157370_104519072 | 171 |
| 64 | 3300025913 | Ga0207695_10153177 | Ga0207695_101531772 | 171 |
| 65 | 3300025924 | Ga0207694_10725691 | Ga0207694_107256911 | 171 |
| 66 | 3300025928 | Ga0207700_10027786 | Ga0207700_100277862 | 171 |
| 67 | 3300048915 | Ga0496112_0042146 | Ga0496112_0042146_749_1312 | 171 |
| 68 | 3300035172 | Ga0373955_0188351 | Ga0373955_0188351_136_714 | 173 |
| 69 | 3300025928 | Ga0207700_10781327 | Ga0207700_107813271 | 174 |
| 70 | 3300005436 | Ga0070713_100775052 | Ga0070713_1007750521 | 177 |
| 71 | 3300006028 | Ga0070717_10002369 | Ga0070717_100023697 | 177 |
| 72 | 3300006163 | Ga0070715_10566624 | Ga0070715_105666241 | 177 |
| 73 | 3300022732 | Ga0224569_107319 | Ga0224569_1073191 | 177 |
| 74 | 3300031344 | Ga0265316_10153356 | Ga0265316_101533562 | 177 |
| 75 | 3300039450 | Ga0436363_0290563 | Ga0436363_0290563_149_721 | 177 |
| 76 | 3300005435 | Ga0070714_100000299 | Ga0070714_10000029924 | 179 |
| 77 | 3300021384 | Ga0213876_10127695 | Ga0213876_101276952 | 179 |
| 78 | 3300033547 | Ga0316212_1018960 | Ga0316212_10189601 | 179 |
| 79 | 3300039437 | Ga0436365_1934391 | Ga0436365_1934391_354_917 | 179 |
| 80 | 3300039453 | Ga0436362_1226293 | Ga0436362_1226293_4199_4762 | 179 |
| 81 | 3300005468 | Ga0070707_100143895 | Ga0070707_1001438952 | 180 |
| 82 | 3300005844 | Ga0068862_100421903 | Ga0068862_1004219032 | 180 |
| 83 | 3300009092 | Ga0105250_10084355 | Ga0105250_100843552 | 180 |
| 84 | 3300009098 | Ga0105245_10581111 | Ga0105245_105811111 | 180 |
| 85 | 3300009553 | Ga0105249_10274508 | Ga0105249_102745082 | 180 |
| 86 | 3300025898 | Ga0207692_10016345 | Ga0207692_100163454 | 180 |
| 87 | 3300025927 | Ga0207687_10095570 | Ga0207687_100955702 | 180 |
| 88 | 3300028800 | Ga0265338_10000863 | Ga0265338_1000086342 | 180 |
| 89 | 3300028800 | Ga0265338_10149935 | Ga0265338_101499352 | 180 |
| 90 | 3300030763 | Ga0265763_1004423 | Ga0265763_10044232 | 180 |
| 91 | 3300031249 | Ga0265339_10019904 | Ga0265339_100199042 | 180 |
| 92 | 3300031344 | Ga0265316_10569145 | Ga0265316_105691451 | 180 |
| 93 | 3300005435 | Ga0070714_100300506 | Ga0070714_1003005062 | 181 |
| 94 | 3300005471 | Ga0070698_101012508 | Ga0070698_1010125081 | 181 |
| 95 | 3300005518 | Ga0070699_100013644 | Ga0070699_1000136445 | 181 |
| 96 | 3300006028 | Ga0070717_10219987 | Ga0070717_102199872 | 181 |
| 97 | 3300007788 | Ga0099795_10037392 | Ga0099795_100373922 | 181 |
| 98 | 3300010159 | Ga0099796_10064792 | Ga0099796_100647922 | 181 |
| 99 | 3300025922 | Ga0207646_10266624 | Ga0207646_102666242 | 181 |
| 100 | 3300025928 | Ga0207700_10472805 | Ga0207700_104728052 | 181 |
| 101 | 3300025929 | Ga0207664_10133914 | Ga0207664_101339142 | 181 |
| 102 | 3300030760 | Ga0265762_1000209 | Ga0265762_10002096 | 181 |
| 103 | 3300048914 | Ga0496111_0236821 | Ga0496111_0236821_216_776 | 181 |
| 104 | 3300050513 | nmdc:mga0rr50_943236_c1 | nmdc:mga0rr50_943236_c1_72_632 | 181 |
| 105 | 3300050514 | nmdc:mga08x19_19007_c1 | nmdc:mga08x19_19007_c1_614_1174 | 181 |
| 106 | 3300005439 | Ga0070711_100420330 | Ga0070711_1004203302 | 182 |
| 107 | 3300005445 | Ga0070708_100000347 | Ga0070708_10000034718 | 182 |
| 108 | 3300005467 | Ga0070706_100004125 | Ga0070706_1000041254 | 182 |
| 109 | 3300005467 | Ga0070706_100037294 | Ga0070706_1000372944 | 182 |
| 110 | 3300005468 | Ga0070707_100002300 | Ga0070707_10000230010 | 182 |
| 111 | 3300005471 | Ga0070698_100009673 | Ga0070698_1000096735 | 182 |
| 112 | 3300005471 | Ga0070698_100026328 | Ga0070698_1000263285 | 182 |
| 113 | 3300005518 | Ga0070699_100000343 | Ga0070699_10000034340 | 182 |
| 114 | 3300005536 | Ga0070697_100000960 | Ga0070697_10000096015 | 182 |
| 115 | 3300006028 | Ga0070717_10092255 | Ga0070717_100922552 | 182 |
| 116 | 3300006175 | Ga0070712_100079657 | Ga0070712_1000796572 | 182 |
| 117 | 3300006175 | Ga0070712_100423908 | Ga0070712_1004239082 | 182 |
| 118 | 3300025910 | Ga0207684_10000081 | Ga0207684_10000081109 | 182 |
| 119 | 3300025915 | Ga0207693_10356284 | Ga0207693_103562842 | 182 |
| 120 | 3300025916 | Ga0207663_10009210 | Ga0207663_100092102 | 182 |
| 121 | 3300025916 | Ga0207663_10389731 | Ga0207663_103897311 | 182 |
| 122 | 3300025922 | Ga0207646_10002622 | Ga0207646_1000262212 | 182 |
| 123 | 3300025929 | Ga0207664_10000320 | Ga0207664_1000032025 | 182 |
| 124 | 3300026078 | Ga0207702_10006499 | Ga0207702_100064997 | 182 |
| 125 | 3300035086 | Ga0373934_0004385 | Ga0373934_0004385_3987_4553 | 182 |
| 126 | 3300035089 | Ga0373944_0015985 | Ga0373944_0015985_597_1163 | 182 |
| 127 | 3300035111 | Ga0373923_0003853 | Ga0373923_0003853_1072_1638 | 182 |
| 128 | 3300035113 | Ga0373936_0007249 | Ga0373936_0007249_1147_1713 | 182 |
| 129 | 3300035117 | Ga0373953_0010054 | Ga0373953_0010054_1643_2209 | 182 |
| 130 | 3300035118 | Ga0373954_0020121 | Ga0373954_0020121_634_1200 | 182 |
| 131 | 3300035119 | Ga0373956_0101077 | Ga0373956_0101077_261_827 | 182 |
| 132 | 3300035120 | Ga0373957_0031849 | Ga0373957_0031849_1278_1844 | 182 |
| 133 | 3300035170 | Ga0373943_0004633 | Ga0373943_0004633_1472_2038 | 182 |
| 134 | 3300035171 | Ga0373946_0045435 | Ga0373946_0045435_135_701 | 182 |
| 135 | 3300035172 | Ga0373955_0263238 | Ga0373955_0263238_336_902 | 182 |
| 136 | 3300035410 | Ga0373924_0008174 | Ga0373924_0008174_1974_2540 | 182 |
| 137 | 3300035692 | Ga0373935_0051891 | Ga0373935_0051891_1137_1703 | 182 |
| 138 | 3300035695 | Ga0373927_0000062 | Ga0373927_0000062_61574_62140 | 182 |
| 139 | 3300035725 | Ga0373947_0000539 | Ga0373947_0000539_20917_21483 | 182 |
| 140 | 3300036401 | Ga0373937_0060774 | Ga0373937_0060774_452_1018 | 182 |
| 141 | 3300037068 | Ga0373925_0013393 | Ga0373925_0013393_1213_1779 | 182 |
| 142 | 3300046463 | Ga0495653_0087938 | Ga0495653_0087938_1294_1860 | 182 |
| 143 | 3300046472 | Ga0495580_0183623 | Ga0495580_0183623_208_774 | 182 |
| 144 | 3300046472 | Ga0495580_0293758 | Ga0495580_0293758_12_578 | 182 |
| 145 | 3300046477 | Ga0495664_0009882 | Ga0495664_0009882_3580_4146 | 182 |
| 146 | 3300046516 | Ga0495628_0267694 | Ga0495628_0267694_177_743 | 182 |
| 147 | 3300046517 | Ga0495630_0006985 | Ga0495630_0006985_5152_5718 | 182 |
| 148 | 3300046529 | Ga0495652_0312953 | Ga0495652_0312953_383_949 | 182 |
| 149 | 3300046531 | Ga0495665_0127432 | Ga0495665_0127432_172_738 | 182 |
| 150 | 3300046533 | Ga0495640_0284842 | Ga0495640_0284842_453_1019 | 182 |
| 151 | 3300046663 | Ga0495635_0133105 | Ga0495635_0133105_413_979 | 182 |
| 152 | 3300046680 | Ga0495646_0052754 | Ga0495646_0052754_1251_1817 | 182 |
| 153 | 3300046690 | Ga0495624_0033868 | Ga0495624_0033868_1500_2066 | 182 |
| 154 | 3300047319 | Ga0495674_0013514 | Ga0495674_0013514_7066_7632 | 182 |
| 155 | 3300047321 | Ga0495676_0109980 | Ga0495676_0109980_41_607 | 182 |
| 156 | 3300047471 | Ga0495684_0303784 | Ga0495684_0303784_229_795 | 182 |
| 157 | 3300048088 | Ga0495602_0032541 | Ga0495602_0032541_2870_3436 | 182 |
| 158 | 3300053078 | Ga0495612_0122156 | Ga0495612_0122156_529_1095 | 182 |
| 159 | 3300003320 | rootH2_10158254 | rootH2_101582543 | 183 |
| 160 | 3300005335 | Ga0070666_10021347 | Ga0070666_100213472 | 183 |
| 161 | 3300005338 | Ga0068868_100011081 | Ga0068868_1000110819 | 183 |
| 162 | 3300005434 | Ga0070709_10050956 | Ga0070709_100509562 | 183 |
| 163 | 3300005435 | Ga0070714_100004403 | Ga0070714_1000044035 | 183 |
| 164 | 3300005436 | Ga0070713_100016622 | Ga0070713_1000166227 | 183 |
| 165 | 3300005436 | Ga0070713_100021298 | Ga0070713_1000212985 | 183 |
| 166 | 3300005439 | Ga0070711_100142251 | Ga0070711_1001422512 | 183 |
| 167 | 3300005459 | Ga0068867_100573599 | Ga0068867_1005735991 | 183 |
| 168 | 3300005842 | Ga0068858_100064473 | Ga0068858_1000644735 | 183 |
| 169 | 3300006028 | Ga0070717_10363525 | Ga0070717_103635252 | 183 |
| 170 | 3300006237 | Ga0097621_100001100 | Ga0097621_1000011009 | 183 |
| 171 | 3300009098 | Ga0105245_10001900 | Ga0105245_100019008 | 183 |
| 172 | 3300009176 | Ga0105242_10023224 | Ga0105242_100232249 | 183 |
| 173 | 3300009177 | Ga0105248_10038199 | Ga0105248_100381992 | 183 |
| 174 | 3300010375 | Ga0105239_10366911 | Ga0105239_103669112 | 183 |
| 175 | 3300013296 | Ga0157374_10154847 | Ga0157374_101548472 | 183 |
| 176 | 3300013297 | Ga0157378_10000411 | Ga0157378_100004114 | 183 |
| 177 | 3300013306 | Ga0163162_10204937 | Ga0163162_102049372 | 183 |
| 178 | 3300013307 | Ga0157372_10314696 | Ga0157372_103146963 | 183 |
| 179 | 3300022730 | Ga0224570_108151 | Ga0224570_1081511 | 183 |
| 180 | 3300022732 | Ga0224569_107221 | Ga0224569_1072211 | 183 |
| 181 | 3300025916 | Ga0207663_10797252 | Ga0207663_107972522 | 183 |
| 182 | 3300025927 | Ga0207687_10008478 | Ga0207687_100084788 | 183 |
| 183 | 3300025928 | Ga0207700_10001527 | Ga0207700_100015277 | 183 |
| 184 | 3300025929 | Ga0207664_10008569 | Ga0207664_100085692 | 183 |
| 185 | 3300025934 | Ga0207686_10012405 | Ga0207686_100124051 | 183 |
| 186 | 3300026023 | Ga0207677_10150764 | Ga0207677_101507642 | 183 |
| 187 | 3300026035 | Ga0207703_10702984 | Ga0207703_107029841 | 183 |
| 188 | 3300053148 | Ga0500590_103724 | Ga0500590_103724_369_926 | 183 |
| 189 | 3300000546 | LJNas_1000008 | LJNas_10000082 | 184 |
| 190 | 3300022730 | Ga0224570_100452 | Ga0224570_1004523 | 184 |
| 191 | 3300024225 | Ga0224572_1071110 | Ga0224572_10711101 | 184 |
| 192 | 3300024227 | Ga0228598_1000536 | Ga0228598_10005365 | 184 |
| 193 | 3300025914 | Ga0207671_10132005 | Ga0207671_101320052 | 184 |
| 194 | 3300028016 | Ga0265354_1012159 | Ga0265354_10121592 | 184 |
| 195 | 3300028017 | Ga0265356_1000192 | Ga0265356_10001923 | 184 |
| 196 | 3300028800 | Ga0265338_10544805 | Ga0265338_105448051 | 184 |
| 197 | 3300030760 | Ga0265762_1026208 | Ga0265762_10262082 | 184 |
| 198 | 3300031090 | Ga0265760_10000151 | Ga0265760_100001517 | 184 |
| 199 | 3300031090 | Ga0265760_10000746 | Ga0265760_100007465 | 184 |
| 200 | 3300031090 | Ga0265760_10001574 | Ga0265760_100015746 | 184 |
| 201 | 3300031247 | Ga0265340_10267656 | Ga0265340_102676561 | 184 |
| 202 | 3300033545 | Ga0316214_1006653 | Ga0316214_10066532 | 184 |
| 203 | 3300050514 | nmdc:mga08x19_232018_c1 | nmdc:mga08x19_232018_c1_365_925 | 184 |
| 204 | 3300005434 | Ga0070709_10006124 | Ga0070709_100061243 | 185 |
| 205 | 3300005435 | Ga0070714_100075297 | Ga0070714_1000752972 | 185 |
| 206 | 3300005435 | Ga0070714_100298567 | Ga0070714_1002985672 | 185 |
| 207 | 3300005435 | Ga0070714_100876516 | Ga0070714_1008765161 | 185 |
| 208 | 3300005436 | Ga0070713_100130484 | Ga0070713_1001304841 | 185 |
| 209 | 3300005436 | Ga0070713_100296387 | Ga0070713_1002963872 | 185 |
| 210 | 3300005436 | Ga0070713_100371334 | Ga0070713_1003713341 | 185 |
| 211 | 3300005437 | Ga0070710_10246312 | Ga0070710_102463121 | 185 |
| 212 | 3300005439 | Ga0070711_100002974 | Ga0070711_1000029745 | 185 |
| 213 | 3300005439 | Ga0070711_100113674 | Ga0070711_1001136742 | 185 |
| 214 | 3300005445 | Ga0070708_100002534 | Ga0070708_10000253411 | 185 |
| 215 | 3300005445 | Ga0070708_100006847 | Ga0070708_10000684711 | 185 |
| 216 | 3300005467 | Ga0070706_100031570 | Ga0070706_1000315702 | 185 |
| 217 | 3300005468 | Ga0070707_100037541 | Ga0070707_1000375415 | 185 |
| 218 | 3300005471 | Ga0070698_100071655 | Ga0070698_1000716552 | 185 |
| 219 | 3300005536 | Ga0070697_100002199 | Ga0070697_10000219918 | 185 |
| 220 | 3300005536 | Ga0070697_100015775 | Ga0070697_1000157757 | 185 |
| 221 | 3300005614 | Ga0068856_100253398 | Ga0068856_1002533982 | 185 |
| 222 | 3300006173 | Ga0070716_100014543 | Ga0070716_1000145433 | 185 |
| 223 | 3300006173 | Ga0070716_100019252 | Ga0070716_1000192522 | 185 |
| 224 | 3300006175 | Ga0070712_100008838 | Ga0070712_1000088385 | 185 |
| 225 | 3300006175 | Ga0070712_100142085 | Ga0070712_1001420852 | 185 |
| 226 | 3300006871 | Ga0075434_100377800 | Ga0075434_1003778002 | 185 |
| 227 | 3300007076 | Ga0075435_100014849 | Ga0075435_1000148498 | 185 |
| 228 | 3300013307 | Ga0157372_10156184 | Ga0157372_101561842 | 185 |
| 229 | 3300021384 | Ga0213876_10049080 | Ga0213876_100490802 | 185 |
| 230 | 3300025898 | Ga0207692_10284977 | Ga0207692_102849771 | 185 |
| 231 | 3300025906 | Ga0207699_10004663 | Ga0207699_100046633 | 185 |
| 232 | 3300025906 | Ga0207699_10038327 | Ga0207699_100383273 | 185 |
| 233 | 3300025906 | Ga0207699_10365009 | Ga0207699_103650092 | 185 |
| 234 | 3300025910 | Ga0207684_10025073 | Ga0207684_100250732 | 185 |
| 235 | 3300025913 | Ga0207695_10197937 | Ga0207695_101979373 | 185 |
| 236 | 3300025915 | Ga0207693_10009709 | Ga0207693_100097093 | 185 |
| 237 | 3300025915 | Ga0207693_10020239 | Ga0207693_100202396 | 185 |
| 238 | 3300025916 | Ga0207663_10005262 | Ga0207663_100052624 | 185 |
| 239 | 3300025916 | Ga0207663_10039784 | Ga0207663_100397842 | 185 |
| 240 | 3300025916 | Ga0207663_10148469 | Ga0207663_101484692 | 185 |
| 241 | 3300025922 | Ga0207646_10372457 | Ga0207646_103724572 | 185 |
| 242 | 3300025922 | Ga0207646_11168056 | Ga0207646_111680561 | 185 |
| 243 | 3300025928 | Ga0207700_10064027 | Ga0207700_100640273 | 185 |
| 244 | 3300025928 | Ga0207700_10077140 | Ga0207700_100771402 | 185 |
| 245 | 3300025928 | Ga0207700_10101140 | Ga0207700_101011402 | 185 |
| 246 | 3300025929 | Ga0207664_10087436 | Ga0207664_100874363 | 185 |
| 247 | 3300025929 | Ga0207664_10507209 | Ga0207664_105072091 | 185 |
| 248 | 3300025929 | Ga0207664_10761516 | Ga0207664_107615162 | 185 |
| 249 | 3300025939 | Ga0207665_10013441 | Ga0207665_100134417 | 185 |
| 250 | 3300025939 | Ga0207665_10023087 | Ga0207665_100230872 | 185 |
| 251 | 3300026078 | Ga0207702_10209632 | Ga0207702_102096322 | 185 |
| 252 | 3300028800 | Ga0265338_10108129 | Ga0265338_101081293 | 185 |
| 253 | 3300035083 | Ga0373926_0043501 | Ga0373926_0043501_471_1043 | 185 |
| 254 | 3300035170 | Ga0373943_0057756 | Ga0373943_0057756_700_1272 | 185 |
| 255 | 3300035170 | Ga0373943_0285378 | Ga0373943_0285378_211_768 | 185 |
| 256 | 3300035171 | Ga0373946_0151017 | Ga0373946_0151017_472_1044 | 185 |
| 257 | 3300035172 | Ga0373955_0218132 | Ga0373955_0218132_73_630 | 185 |
| 258 | 3300035692 | Ga0373935_0111164 | Ga0373935_0111164_340_912 | 185 |
| 259 | 3300035695 | Ga0373927_0019005 | Ga0373927_0019005_751_1323 | 185 |
| 260 | 3300035725 | Ga0373947_0705510 | Ga0373947_0705510_38_595 | 185 |
| 261 | 3300036401 | Ga0373937_0011606 | Ga0373937_0011606_6223_6780 | 185 |
| 262 | 3300037068 | Ga0373925_0001460 | Ga0373925_0001460_17265_17837 | 185 |
| 263 | 3300039437 | Ga0436365_0510483 | Ga0436365_0510483_1187_1753 | 185 |
| 264 | 3300046472 | Ga0495580_0025716 | Ga0495580_0025716_929_1501 | 185 |
| 265 | 3300046472 | Ga0495580_0037587 | Ga0495580_0037587_976_1542 | 185 |
| 266 | 3300046473 | Ga0495582_0026853 | Ga0495582_0026853_2004_2576 | 185 |
| 267 | 3300046679 | Ga0495623_0253076 | Ga0495623_0253076_272_835 | 185 |
| 268 | 3300047315 | Ga0495581_0026118 | Ga0495581_0026118_2433_3005 | 185 |
| 269 | 3300048088 | Ga0495602_0025150 | Ga0495602_0025150_993_1550 | 185 |
| 270 | 3300048089 | Ga0495614_0213589 | Ga0495614_0213589_93_665 | 185 |
| 271 | 3300048905 | Ga0496102_0056498 | Ga0496102_0056498_1849_2409 | 185 |
| 272 | 3300053078 | Ga0495612_0425583 | Ga0495612_0425583_10_567 | 185 |
| 273 | 3300005841 | Ga0068863_100477766 | Ga0068863_1004777662 | 186 |
| 274 | 3300005843 | Ga0068860_100493253 | Ga0068860_1004932531 | 186 |
| 275 | 3300006163 | Ga0070715_10072217 | Ga0070715_100722173 | 186 |
| 276 | 3300006173 | Ga0070716_100041130 | Ga0070716_1000411302 | 186 |
| 277 | 3300009098 | Ga0105245_10206483 | Ga0105245_102064832 | 186 |
| 278 | 3300009101 | Ga0105247_10329054 | Ga0105247_103290542 | 186 |
| 279 | 3300009174 | Ga0105241_10314408 | Ga0105241_103144083 | 186 |
| 280 | 3300009177 | Ga0105248_10436186 | Ga0105248_104361862 | 186 |
| 281 | 3300013306 | Ga0163162_10308618 | Ga0163162_103086182 | 186 |
| 282 | 3300014968 | Ga0157379_10004106 | Ga0157379_100041067 | 186 |
| 283 | 3300025911 | Ga0207654_10246313 | Ga0207654_102463132 | 186 |
| 284 | 3300025939 | Ga0207665_10031634 | Ga0207665_100316344 | 186 |
| 285 | 3300030760 | Ga0265762_1002708 | Ga0265762_10027084 | 186 |
| 286 | 3300033547 | Ga0316212_1001581 | Ga0316212_10015812 | 186 |
| 287 | 3300035691 | Ga0373931_0104556 | Ga0373931_0104556_971_1534 | 186 |
| 288 | 3300048904 | Ga0496101_0068198 | Ga0496101_0068198_1249_1812 | 186 |
| 289 | 3300048905 | Ga0496102_0209591 | Ga0496102_0209591_1233_1796 | 186 |
| 290 | 3300048906 | Ga0496103_0004482 | Ga0496103_0004482_2459_3022 | 186 |
| 291 | 3300048907 | Ga0496104_0006518 | Ga0496104_0006518_7963_8526 | 186 |
| 292 | 3300048909 | Ga0496106_0360198 | Ga0496106_0360198_306_869 | 186 |
| 293 | 3300048910 | Ga0496107_0027203 | Ga0496107_0027203_2996_3559 | 186 |
| 294 | 3300013100 | Ga0157373_10006392 | Ga0157373_100063925 | 188 |
| 295 | 3300045976 | Ga0466967_0174983 | Ga0466967_0174983_1090_1656 | 188 |
| 296 | 3300005331 | Ga0070670_100110609 | Ga0070670_1001106092 | 190 |
| 297 | 3300005334 | Ga0068869_100124999 | Ga0068869_1001249992 | 190 |
| 298 | 3300005338 | Ga0068868_100030310 | Ga0068868_1000303104 | 190 |
| 299 | 3300013306 | Ga0163162_10108674 | Ga0163162_101086745 | 190 |
| 300 | 3300014325 | Ga0163163_10139028 | Ga0163163_101390282 | 190 |
| 301 | 3300026023 | Ga0207677_10077895 | Ga0207677_100778952 | 190 |
| 302 | 3300048915 | Ga0496112_0123674 | Ga0496112_0123674_1212_1802 | 190 |
| 303 | 2162886012 | MBSR1b_contig_14265637 | MBSR1b_0382.00006390 | 195 |
| 304 | 3300001978 | JGI24747J21853_1003750 | JGI24747J21853_10037502 | 195 |
| 305 | 3300001990 | JGI24737J22298_10009731 | JGI24737J22298_100097312 | 195 |
| 306 | 3300001991 | JGI24743J22301_10000415 | JGI24743J22301_100004155 | 195 |
| 307 | 3300002073 | JGI24745J21846_1005447 | JGI24745J21846_10054471 | 195 |
| 308 | 3300002074 | JGI24748J21848_1002984 | JGI24748J21848_10029842 | 195 |
| 309 | 3300002459 | JGI24751J29686_10003600 | JGI24751J29686_100036002 | 195 |
| 310 | 3300005290 | Ga0065712_10079928 | Ga0065712_100799283 | 195 |
| 311 | 3300005293 | Ga0065715_10090939 | Ga0065715_100909393 | 195 |
| 312 | 3300005328 | Ga0070676_10007823 | Ga0070676_100078235 | 195 |
| 313 | 3300005329 | Ga0070683_100001062 | Ga0070683_10000106213 | 195 |
| 314 | 3300005330 | Ga0070690_100044956 | Ga0070690_1000449562 | 195 |
| 315 | 3300005331 | Ga0070670_100038427 | Ga0070670_1000384274 | 195 |
| 316 | 3300005333 | Ga0070677_10012694 | Ga0070677_100126942 | 195 |
| 317 | 3300005335 | Ga0070666_10030043 | Ga0070666_100300433 | 195 |
| 318 | 3300005337 | Ga0070682_100065562 | Ga0070682_1000655622 | 195 |
| 319 | 3300005339 | Ga0070660_100002753 | Ga0070660_1000027537 | 195 |
| 320 | 3300005340 | Ga0070689_100003567 | Ga0070689_1000035677 | 195 |
| 321 | 3300005343 | Ga0070687_100014805 | Ga0070687_1000148053 | 195 |
| 322 | 3300005344 | Ga0070661_100038895 | Ga0070661_1000388952 | 195 |
| 323 | 3300005347 | Ga0070668_100000767 | Ga0070668_1000007676 | 195 |
| 324 | 3300005354 | Ga0070675_100072045 | Ga0070675_1000720453 | 195 |
| 325 | 3300005355 | Ga0070671_100025349 | Ga0070671_1000253494 | 195 |
| 326 | 3300005365 | Ga0070688_100000794 | Ga0070688_1000007948 | 195 |
| 327 | 3300005366 | Ga0070659_100009140 | Ga0070659_1000091405 | 195 |
| 328 | 3300005455 | Ga0070663_100060576 | Ga0070663_1000605762 | 195 |
| 329 | 3300005456 | Ga0070678_100015838 | Ga0070678_1000158383 | 195 |
| 330 | 3300005457 | Ga0070662_100007780 | Ga0070662_1000077806 | 195 |
| 331 | 3300005459 | Ga0068867_100061822 | Ga0068867_1000618222 | 195 |
| 332 | 3300005466 | Ga0070685_10034904 | Ga0070685_100349042 | 195 |
| 333 | 3300005535 | Ga0070684_100004290 | Ga0070684_10000429011 | 195 |
| 334 | 3300005539 | Ga0068853_100001951 | Ga0068853_1000019519 | 195 |
| 335 | 3300005544 | Ga0070686_100001352 | Ga0070686_1000013529 | 195 |
| 336 | 3300005547 | Ga0070693_100010426 | Ga0070693_1000104263 | 195 |
| 337 | 3300005563 | Ga0068855_100042369 | Ga0068855_1000423693 | 195 |
| 338 | 3300005577 | Ga0068857_100000637 | Ga0068857_1000006374 | 195 |
| 339 | 3300005615 | Ga0070702_100005694 | Ga0070702_1000056945 | 195 |
| 340 | 3300005616 | Ga0068852_100001238 | Ga0068852_10000123812 | 195 |
| 341 | 3300005718 | Ga0068866_10003074 | Ga0068866_100030745 | 195 |
| 342 | 3300005719 | Ga0068861_100530404 | Ga0068861_1005304042 | 195 |
| 343 | 3300005834 | Ga0068851_10002917 | Ga0068851_100029172 | 195 |
| 344 | 3300005840 | Ga0068870_10118368 | Ga0068870_101183682 | 195 |
| 345 | 3300005843 | Ga0068860_100059507 | Ga0068860_1000595072 | 195 |
| 346 | 3300005844 | Ga0068862_100026020 | Ga0068862_1000260203 | 195 |
| 347 | 3300006237 | Ga0097621_100063505 | Ga0097621_1000635053 | 195 |
| 348 | 3300006358 | Ga0068871_100111672 | Ga0068871_1001116722 | 195 |
| 349 | 3300006881 | Ga0068865_100015126 | Ga0068865_1000151262 | 195 |
| 350 | 3300009098 | Ga0105245_10006049 | Ga0105245_100060497 | 195 |
| 351 | 3300009101 | Ga0105247_10000903 | Ga0105247_100009035 | 195 |
| 352 | 3300009174 | Ga0105241_10001381 | Ga0105241_1000138111 | 195 |
| 353 | 3300009176 | Ga0105242_10252683 | Ga0105242_102526832 | 195 |
| 354 | 3300009177 | Ga0105248_10192760 | Ga0105248_101927603 | 195 |
| 355 | 3300009545 | Ga0105237_10018546 | Ga0105237_100185465 | 195 |
| 356 | 3300009553 | Ga0105249_10113306 | Ga0105249_101133062 | 195 |
| 357 | 3300010375 | Ga0105239_10029583 | Ga0105239_100295833 | 195 |
| 358 | 3300011119 | Ga0105246_10000750 | Ga0105246_1000075010 | 195 |
| 359 | 3300013102 | Ga0157371_10007759 | Ga0157371_100077593 | 195 |
| 360 | 3300013105 | Ga0157369_10248467 | Ga0157369_102484671 | 195 |
| 361 | 3300013296 | Ga0157374_10145880 | Ga0157374_101458802 | 195 |
| 362 | 3300013297 | Ga0157378_10130819 | Ga0157378_101308192 | 195 |
| 363 | 3300013307 | Ga0157372_10004071 | Ga0157372_100040717 | 195 |
| 364 | 3300014325 | Ga0163163_10075151 | Ga0163163_100751512 | 195 |
| 365 | 3300014745 | Ga0157377_10001207 | Ga0157377_100012077 | 195 |
| 366 | 3300014968 | Ga0157379_10002043 | Ga0157379_1000204312 | 195 |
| 367 | 3300014969 | Ga0157376_10014082 | Ga0157376_100140824 | 195 |
| 368 | 3300017792 | Ga0163161_10003449 | Ga0163161_100034494 | 195 |
| 369 | 3300025315 | Ga0207697_10003737 | Ga0207697_100037372 | 195 |
| 370 | 3300025321 | Ga0207656_10003649 | Ga0207656_100036494 | 195 |
| 371 | 3300025893 | Ga0207682_10070647 | Ga0207682_100706471 | 195 |
| 372 | 3300025899 | Ga0207642_10029547 | Ga0207642_100295472 | 195 |
| 373 | 3300025901 | Ga0207688_10005673 | Ga0207688_100056733 | 195 |
| 374 | 3300025903 | Ga0207680_10007582 | Ga0207680_100075823 | 195 |
| 375 | 3300025904 | Ga0207647_10007354 | Ga0207647_100073543 | 195 |
| 376 | 3300025907 | Ga0207645_10000011 | Ga0207645_1000001186 | 195 |
| 377 | 3300025908 | Ga0207643_10000185 | Ga0207643_1000018533 | 195 |
| 378 | 3300025918 | Ga0207662_10002009 | Ga0207662_100020097 | 195 |
| 379 | 3300025919 | Ga0207657_10000505 | Ga0207657_1000050520 | 195 |
| 380 | 3300025923 | Ga0207681_10113096 | Ga0207681_101130962 | 195 |
| 381 | 3300025925 | Ga0207650_10000336 | Ga0207650_1000033620 | 195 |
| 382 | 3300025926 | Ga0207659_10014180 | Ga0207659_100141802 | 195 |
| 383 | 3300025927 | Ga0207687_10041220 | Ga0207687_100412202 | 195 |
| 384 | 3300025931 | Ga0207644_10010589 | Ga0207644_100105892 | 195 |
| 385 | 3300025932 | Ga0207690_10067511 | Ga0207690_100675112 | 195 |
| 386 | 3300025933 | Ga0207706_10000747 | Ga0207706_1000074720 | 195 |
| 387 | 3300025934 | Ga0207686_10250192 | Ga0207686_102501922 | 195 |
| 388 | 3300025937 | Ga0207669_10011301 | Ga0207669_100113014 | 195 |
| 389 | 3300025938 | Ga0207704_10059148 | Ga0207704_100591481 | 195 |
| 390 | 3300025940 | Ga0207691_10000476 | Ga0207691_1000047621 | 195 |
| 391 | 3300025941 | Ga0207711_10023734 | Ga0207711_100237345 | 195 |
| 392 | 3300025942 | Ga0207689_10000194 | Ga0207689_100001947 | 195 |
| 393 | 3300025944 | Ga0207661_10005547 | Ga0207661_100055479 | 195 |
| 394 | 3300025945 | Ga0207679_10001049 | Ga0207679_1000104914 | 195 |
| 395 | 3300025949 | Ga0207667_10207902 | Ga0207667_102079021 | 195 |
| 396 | 3300025960 | Ga0207651_10000446 | Ga0207651_100004464 | 195 |
| 397 | 3300025961 | Ga0207712_10035606 | Ga0207712_100356063 | 195 |
| 398 | 3300025972 | Ga0207668_10069577 | Ga0207668_100695773 | 195 |
| 399 | 3300025981 | Ga0207640_10020949 | Ga0207640_100209493 | 195 |
| 400 | 3300025986 | Ga0207658_10012570 | Ga0207658_100125702 | 195 |
| 401 | 3300026023 | Ga0207677_10037631 | Ga0207677_100376312 | 195 |
| 402 | 3300026035 | Ga0207703_10143715 | Ga0207703_101437152 | 195 |
| 403 | 3300026041 | Ga0207639_10072298 | Ga0207639_100722982 | 195 |
| 404 | 3300026067 | Ga0207678_10001308 | Ga0207678_100013087 | 195 |
| 405 | 3300026088 | Ga0207641_10000316 | Ga0207641_1000031619 | 195 |
| 406 | 3300026089 | Ga0207648_10000690 | Ga0207648_100006908 | 195 |
| 407 | 3300026095 | Ga0207676_10000107 | Ga0207676_1000010730 | 195 |
| 408 | 3300026116 | Ga0207674_10000034 | Ga0207674_1000003491 | 195 |
| 409 | 3300026118 | Ga0207675_100040371 | Ga0207675_1000403715 | 195 |
| 410 | 3300026121 | Ga0207683_10000674 | Ga0207683_1000067415 | 195 |
| 411 | 3300026142 | Ga0207698_10136827 | Ga0207698_101368272 | 195 |
| 412 | 3300028379 | Ga0268266_10056986 | Ga0268266_100569863 | 195 |
| 413 | 3300028380 | Ga0268265_10021898 | Ga0268265_100218984 | 195 |
| 414 | 3300028381 | Ga0268264_10059533 | Ga0268264_100595333 | 195 |
| 415 | 3300048903 | Ga0496100_0747254 | Ga0496100_0747254_107_694 | 195 |
| 416 | 3300048905 | Ga0496102_0037057 | Ga0496102_0037057_1249_1836 | 195 |
| 417 | 3300048911 | Ga0496108_0000364 | Ga0496108_0000364_1909_2496 | 195 |
| 418 | 3300048912 | Ga0496109_0000083 | Ga0496109_0000083_50703_51290 | 195 |
| 419 | 3300048913 | Ga0496110_0000236 | Ga0496110_0000236_6086_6673 | 195 |
| 420 | 3300048914 | Ga0496111_0008193 | Ga0496111_0008193_3414_4001 | 195 |
| 421 | 3300048915 | Ga0496112_0000033 | Ga0496112_0000033_43812_44399 | 195 |
| 422 | 3300048916 | Ga0496113_0004588 | Ga0496113_0004588_5973_6560 | 195 |
| 423 | 3300048917 | Ga0496114_0468494 | Ga0496114_0468494_273_860 | 195 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6loe-assembly1.cif.gz_E | cryo-em structure of the dithionite-reduced photosynthetic alternative complex iii from roseiflexus castenholzii | 0.7824 | 62 | 157 |
| 6lod-assembly1.cif.gz_E | cryo-em structure of the air-oxidized photosynthetic alternative complex iii from roseiflexus castenholzii | 0.7684 | 62 | 157 |
| 2gc4-assembly1.cif.gz_D | structural comparison of the oxidized ternary electron transfer complex of methylamine dehydrogenase, amicyanin and cytochrome c551i from paracoccus denitrificans with the substrate-reduced, copper free complex at 1.9 a resolution. | 0.7489 | 65 | 153 |
| 5mxy-assembly1.cif.gz_A | kustc0563 c-type cytochrome | 0.7396 | 72 | 153 |
| 6tp9-assembly4.cif.gz_K | c-type cytochrome nirc | 0.7349 | 112 | 157 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WP35_148_241_1.10.760.10 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.7282 | 70 | 153 | 1.10.760.10 |
| 4eifA00 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.7274 | 72 | 152 | 1.10.760.10 |
| 1h9yA01 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.706 | 66 | 151 | 1.10.760.10 |
| 2zboK00 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.6883 | 70 | 155 | 1.10.760.10 |
| 2c8sA00 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.6877 | 67 | 153 | 1.10.760.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V9S9M6-F1-model_v4 | Cytochrome c domain-containing protein | 0.9225 | 89 | 167 |
GO:0009055
GO:0020037 |
| AF-A0A257UKT7-F1-model_v4 | Cytochrome c domain-containing protein | 0.9166 | 44 | 165 |
GO:0009055
GO:0020037 GO:0046872 |
| AF-A0A2V5P7I6-F1-model_v4 | Cytochrome c domain-containing protein | 0.9066 | 72 | 165 |
GO:0009055
GO:0020037 GO:0046872 |
| AF-A0A2V9XRI2-F1-model_v4 | Cytochrome c domain-containing protein | 0.8835 | 57 | 162 |
GO:0009055
GO:0020037 GO:0046872 |
| AF-T1BQH8-F1-model_v4 | Cytochrome C class I protein | 0.8792 | 28 | 164 |
GO:0009055
GO:0020037 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar