F440504

General Info

Members Datasets Scaffolds Average Seq Length
423 247 423 187

Family's Representative Sequence

Representative Sequence 3300009098|Ga0105245_10001900|Ga0105245_100019008
Length 200
Sequence MGKTRLNPESIKGGAMRNFILGVIVTILLLGFCTMAYLLLGYMETNADAQPSHLEMRVAMSALDASMDKHAPRISSPIPPTDDNLIAGMKVYTMNCALCHGGLDKKPSTLQHNFYPPVPQLILHPIDDPDWHVYYAVKTGVRYTGMPAWNNALADDDIWKVTEFLTHLEKLPAPVQEFWKNSFGTPPAPTPSAVPESHHH

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
6 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
7 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
8 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
66 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
75 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
101 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
102 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
103 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
104 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
105 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
165 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
166 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
170 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
174 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
175 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
176 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
177 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
178 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
179 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
180 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
181 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
182 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
183 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
184 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
185 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
186 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
187 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
188 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
189 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
190 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
191 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
192 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
193 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
194 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
195 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
196 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
197 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
198 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
199 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
200 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
201 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
202 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
203 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
204 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
205 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
206 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
207 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
208 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
209 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
210 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
211 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
212 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
213 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
214 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
215 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
216 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
217 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
218 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
219 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
220 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
221 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
222 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
223 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
224 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
225 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
226 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
227 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
228 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
229 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
230 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
231 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
232 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
233 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
234 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
235 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
236 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
237 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
238 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
239 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
240 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
241 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
242 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
243 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
244 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
245 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
246 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
247 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.11
Metatranscriptomes 1.89
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.24
Nodule 0
Rhizoplane 4.96
Rhizosphere 92.67
Stem 0
Stem Tuber 0
Unclassified 2.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_14265637 2162886012 Bacteria 3352
2 LJNas_1000008 3300000546 Bacteria 25309
3 JGI24747J21853_1003750 3300001978 Bacteria 1326
4 JGI24737J22298_10009731 3300001990 Bacteria 3186
5 JGI24743J22301_10000415 3300001991 Bacteria 4822
6 JGI24745J21846_1005447 3300002073 Unclassified 1390
7 JGI24748J21848_1002984 3300002074 Bacteria 1926
8 JGI24751J29686_10003600 3300002459 Bacteria 3124
9 rootH2_10158254 3300003320 Bacteria 1886
10 Ga0065712_10079928 3300005290 Bacteria 3164
11 Ga0065715_10090939 3300005293 Bacteria 6296
12 Ga0070676_10007823 3300005328 Bacteria 5746
13 Ga0070683_100001062 3300005329 Bacteria 20615
14 Ga0070690_100044956 3300005330 Bacteria 2804
15 Ga0070670_100038427 3300005331 Bacteria 4116
16 Ga0070670_100110609 3300005331 Unclassified 2367
17 Ga0070677_10012694 3300005333 Bacteria 2929
18 Ga0068869_100124999 3300005334 Unclassified 1971
19 Ga0070666_10021347 3300005335 Bacteria 4197
20 Ga0070666_10030043 3300005335 Bacteria 3577
21 Ga0070682_100065562 3300005337 Bacteria 2308
22 Ga0068868_100011081 3300005338 Bacteria 6558
23 Ga0068868_100030310 3300005338 Unclassified 4148
24 Ga0070660_100002753 3300005339 Bacteria 12083
25 Ga0070689_100003567 3300005340 Bacteria 10364
26 Ga0070687_100014805 3300005343 Bacteria 3512
27 Ga0070661_100038895 3300005344 Bacteria 3464
28 Ga0070668_100000767 3300005347 Bacteria 22081
29 Ga0070675_100072045 3300005354 Bacteria 2868
30 Ga0070671_100025349 3300005355 Bacteria 4865
31 Ga0070688_100000794 3300005365 Bacteria 15612
32 Ga0070659_100009140 3300005366 Bacteria 7268
33 Ga0070709_10006124 3300005434 Bacteria 6544
34 Ga0070709_10050956 3300005434 Unclassified 2596
35 Ga0070709_10095085 3300005434 Bacteria 1973
36 Ga0070709_10112534 3300005434 Bacteria 1832
37 Ga0070709_10190093 3300005434 Bacteria 1448
38 Ga0070714_100000299 3300005435 Bacteria 37652
39 Ga0070714_100004403 3300005435 Bacteria 10597
40 Ga0070714_100044108 3300005435 Bacteria 3774
41 Ga0070714_100062288 3300005435 Bacteria 3206
42 Ga0070714_100065488 3300005435 Bacteria 3130
43 Ga0070714_100075297 3300005435 Bacteria 2928
44 Ga0070714_100298567 3300005435 Unclassified 1501
45 Ga0070714_100300506 3300005435 Unclassified 1496
46 Ga0070714_100876516 3300005435 Unclassified 871
47 Ga0070713_100000060 3300005436 Bacteria 69784
48 Ga0070713_100016622 3300005436 Bacteria 5535
49 Ga0070713_100021298 3300005436 Bacteria 4983
50 Ga0070713_100130484 3300005436 Bacteria 2215
51 Ga0070713_100296387 3300005436 Unclassified 1488
52 Ga0070713_100371334 3300005436 Bacteria 1331
53 Ga0070713_100775052 3300005436 Bacteria 918
54 Ga0070710_10119727 3300005437 Bacteria 1592
55 Ga0070710_10246312 3300005437 Bacteria 1147
56 Ga0070711_100000525 3300005439 Bacteria 19885
57 Ga0070711_100002974 3300005439 Bacteria 9780
58 Ga0070711_100113674 3300005439 Bacteria 1991
59 Ga0070711_100142251 3300005439 Bacteria 1800
60 Ga0070711_100420330 3300005439 Bacteria 1089
61 Ga0070708_100000347 3300005445 Bacteria 34980
62 Ga0070708_100002534 3300005445 Bacteria 14109
63 Ga0070708_100006847 3300005445 Bacteria 9089
64 Ga0070663_100060576 3300005455 Bacteria 2723
65 Ga0070678_100015838 3300005456 Bacteria 4803
66 Ga0070662_100007780 3300005457 Bacteria 6963
67 Ga0070681_10023131 3300005458 Bacteria 6250
68 Ga0068867_100061822 3300005459 Bacteria 2781
69 Ga0068867_100573599 3300005459 Unclassified 980
70 Ga0070685_10034904 3300005466 Bacteria 2835
71 Ga0070706_100004125 3300005467 Bacteria 14130
72 Ga0070706_100031570 3300005467 Unclassified 4884
73 Ga0070706_100037294 3300005467 Bacteria 4490
74 Ga0070706_100126319 3300005467 Bacteria 2385
75 Ga0070707_100002300 3300005468 Bacteria 18254
76 Ga0070707_100037541 3300005468 Bacteria 4624
77 Ga0070707_100143895 3300005468 Unclassified 2320
78 Ga0070698_100009673 3300005471 Bacteria 10312
79 Ga0070698_100026328 3300005471 Bacteria 6054
80 Ga0070698_100071655 3300005471 Bacteria 3475
81 Ga0070698_101012508 3300005471 Unclassified 778
82 Ga0070699_100000343 3300005518 Bacteria 45107
83 Ga0070699_100013644 3300005518 Bacteria 6992
84 Ga0070679_100481168 3300005530 Bacteria 1186
85 Ga0070684_100004290 3300005535 Bacteria 10819
86 Ga0070697_100000960 3300005536 Bacteria 21769
87 Ga0070697_100002199 3300005536 Bacteria 14971
88 Ga0070697_100015775 3300005536 Bacteria 5934
89 Ga0068853_100001951 3300005539 Bacteria 15203
90 Ga0070686_100001352 3300005544 Bacteria 13882
91 Ga0070693_100010426 3300005547 Bacteria 4656
92 Ga0068855_100042369 3300005563 Bacteria 5393
93 Ga0068857_100000637 3300005577 Bacteria 25847
94 Ga0068856_100253398 3300005614 Bacteria 1775
95 Ga0070702_100005694 3300005615 Bacteria 5834
96 Ga0068852_100001238 3300005616 Bacteria 17011
97 Ga0068866_10003074 3300005718 Bacteria 6883
98 Ga0068861_100530404 3300005719 Bacteria 1069
99 Ga0068851_10002917 3300005834 Bacteria 7555
100 Ga0068870_10118368 3300005840 Bacteria 1522
101 Ga0068863_100477766 3300005841 Bacteria 1225
102 Ga0068858_100064473 3300005842 Unclassified 3391
103 Ga0068860_100059507 3300005843 Bacteria 3631
104 Ga0068860_100493253 3300005843 Bacteria 1222
105 Ga0068862_100026020 3300005844 Bacteria 4917
106 Ga0068862_100421903 3300005844 Bacteria 1252
107 Ga0070717_10002369 3300006028 Bacteria 13286
108 Ga0070717_10016003 3300006028 Bacteria 5807
109 Ga0070717_10070932 3300006028 Bacteria 2905
110 Ga0070717_10092255 3300006028 Bacteria 2558
111 Ga0070717_10219987 3300006028 Bacteria 1669
112 Ga0070717_10363525 3300006028 Bacteria 1296
113 Ga0070717_10515394 3300006028 Unclassified 1081
114 Ga0070717_10561416 3300006028 Bacteria 1034
115 Ga0070715_10045095 3300006163 Bacteria 1868
116 Ga0070715_10072217 3300006163 Bacteria 1544
117 Ga0070715_10566624 3300006163 Bacteria 661
118 Ga0070716_100014543 3300006173 Bacteria 4032
119 Ga0070716_100019252 3300006173 Bacteria 3565
120 Ga0070716_100041130 3300006173 Bacteria 2574
121 Ga0070712_100000780 3300006175 Bacteria 18819
122 Ga0070712_100008838 3300006175 Bacteria 6343
123 Ga0070712_100079657 3300006175 Bacteria 2368
124 Ga0070712_100142085 3300006175 Bacteria 1833
125 Ga0070712_100423908 3300006175 Bacteria 1103
126 Ga0097621_100001100 3300006237 Bacteria 18890
127 Ga0097621_100063505 3300006237 Bacteria 3035
128 Ga0068871_100111672 3300006358 Bacteria 2299
129 Ga0075434_100377800 3300006871 Bacteria 1438
130 Ga0068865_100015126 3300006881 Bacteria 4916
131 Ga0075435_100014849 3300007076 Bacteria 5840
132 Ga0099795_10037392 3300007788 Unclassified 1708
133 Ga0105250_10084355 3300009092 Bacteria 1289
134 Ga0105240_10198499 3300009093 Bacteria 2353
135 Ga0105245_10001900 3300009098 Bacteria 18993
136 Ga0105245_10006049 3300009098 Bacteria 10639
137 Ga0105245_10206483 3300009098 Bacteria 1889
138 Ga0105245_10581111 3300009098 Bacteria 1145
139 Ga0105247_10000903 3300009101 Bacteria 22344
140 Ga0105247_10329054 3300009101 Unclassified 1068
141 Ga0105241_10001381 3300009174 Bacteria 18535
142 Ga0105241_10314408 3300009174 Bacteria 1348
143 Ga0105242_10023224 3300009176 Unclassified 4889
144 Ga0105242_10252683 3300009176 Bacteria 1589
145 Ga0105248_10038199 3300009177 Bacteria 5373
146 Ga0105248_10192760 3300009177 Bacteria 2296
147 Ga0105248_10436186 3300009177 Bacteria 1476
148 Ga0105237_10018546 3300009545 Bacteria 7199
149 Ga0105249_10113306 3300009553 Bacteria 2566
150 Ga0105249_10274508 3300009553 Unclassified 1681
151 Ga0099796_10064792 3300010159 Unclassified 1305
152 Ga0105239_10029583 3300010375 Bacteria 6023
153 Ga0105239_10366911 3300010375 Bacteria 1627
154 Ga0105246_10000750 3300011119 Bacteria 18492
155 Ga0157373_10006392 3300013100 Bacteria 8802
156 Ga0157371_10007759 3300013102 Bacteria 8628
157 Ga0157370_10451907 3300013104 Unclassified 1181
158 Ga0157369_10248467 3300013105 Unclassified 1857
159 Ga0157374_10145880 3300013296 Bacteria 2299
160 Ga0157374_10154847 3300013296 Unclassified 2230
161 Ga0157378_10000411 3300013297 Bacteria 42281
162 Ga0157378_10130819 3300013297 Bacteria 2323
163 Ga0163162_10108674 3300013306 Unclassified 2870
164 Ga0163162_10204937 3300013306 Bacteria 2101
165 Ga0163162_10308618 3300013306 Bacteria 1714
166 Ga0157372_10004071 3300013307 Bacteria 15674
167 Ga0157372_10156184 3300013307 Bacteria 2635
168 Ga0157372_10183978 3300013307 Bacteria 2419
169 Ga0157372_10314696 3300013307 Bacteria 1822
170 Ga0163163_10075151 3300014325 Bacteria 3372
171 Ga0163163_10139028 3300014325 Bacteria 2470
172 Ga0157377_10001207 3300014745 Bacteria 11008
173 Ga0157379_10002043 3300014968 Bacteria 16758
174 Ga0157379_10004106 3300014968 Bacteria 12424
175 Ga0157376_10014082 3300014969 Bacteria 5989
176 Ga0157376_10021292 3300014969 Bacteria 5035
177 Ga0163161_10003449 3300017792 Bacteria 11078
178 Ga0213876_10049080 3300021384 Bacteria 2230
179 Ga0213876_10127695 3300021384 Bacteria 1351
180 Ga0224570_100452 3300022730 Bacteria 3223
181 Ga0224570_108151 3300022730 Unclassified 648
182 Ga0224569_107221 3300022732 Unclassified 806
183 Ga0224569_107319 3300022732 Unclassified 799
184 Ga0224572_1071110 3300024225 Unclassified 643
185 Ga0228598_1000536 3300024227 Bacteria 7896
186 Ga0207697_10003737 3300025315 Bacteria 7445
187 Ga0207656_10003649 3300025321 Bacteria 5319
188 Ga0207682_10070647 3300025893 Unclassified 1479
189 Ga0207692_10016345 3300025898 Bacteria 3284
190 Ga0207692_10038197 3300025898 Bacteria 2354
191 Ga0207692_10284977 3300025898 Bacteria 1001
192 Ga0207642_10029547 3300025899 Bacteria 2271
193 Ga0207688_10005673 3300025901 Bacteria 6788
194 Ga0207680_10007582 3300025903 Bacteria 5298
195 Ga0207647_10007354 3300025904 Bacteria 7961
196 Ga0207699_10004663 3300025906 Bacteria 6555
197 Ga0207699_10020398 3300025906 Bacteria 3552
198 Ga0207699_10038327 3300025906 Bacteria 2746
199 Ga0207699_10365009 3300025906 Bacteria 1022
200 Ga0207645_10000011 3300025907 Bacteria 132246
201 Ga0207643_10000185 3300025908 Bacteria 42810
202 Ga0207684_10000081 3300025910 Bacteria 178619
203 Ga0207684_10025073 3300025910 Bacteria 5082
204 Ga0207684_10148863 3300025910 Bacteria 2014
205 Ga0207654_10246313 3300025911 Bacteria 1196
206 Ga0207707_10017723 3300025912 Bacteria 6213
207 Ga0207695_10153177 3300025913 Bacteria 2243
208 Ga0207695_10197937 3300025913 Bacteria 1925
209 Ga0207671_10132005 3300025914 Bacteria 1918
210 Ga0207693_10000191 3300025915 Bacteria 56013
211 Ga0207693_10009709 3300025915 Bacteria 7834
212 Ga0207693_10020239 3300025915 Bacteria 5293
213 Ga0207693_10356284 3300025915 Bacteria 1145
214 Ga0207663_10005262 3300025916 Bacteria 6515
215 Ga0207663_10006472 3300025916 Bacteria 5994
216 Ga0207663_10009210 3300025916 Bacteria 5208
217 Ga0207663_10039784 3300025916 Bacteria 2852
218 Ga0207663_10148469 3300025916 Bacteria 1642
219 Ga0207663_10389731 3300025916 Bacteria 1063
220 Ga0207663_10797252 3300025916 Bacteria 752
221 Ga0207662_10002009 3300025918 Bacteria 10055
222 Ga0207657_10000505 3300025919 Bacteria 41238
223 Ga0207652_10361711 3300025921 Bacteria 1310
224 Ga0207646_10002622 3300025922 Bacteria 21121
225 Ga0207646_10266624 3300025922 Bacteria 1548
226 Ga0207646_10372457 3300025922 Bacteria 1290
227 Ga0207646_11168056 3300025922 Unclassified 676
228 Ga0207681_10113096 3300025923 Bacteria 1978
229 Ga0207694_10725691 3300025924 Unclassified 838
230 Ga0207650_10000336 3300025925 Bacteria 45514
231 Ga0207659_10014180 3300025926 Bacteria 5131
232 Ga0207687_10008478 3300025927 Bacteria 6720
233 Ga0207687_10041220 3300025927 Bacteria 3169
234 Ga0207687_10095570 3300025927 Bacteria 2176
235 Ga0207700_10000358 3300025928 Bacteria 26677
236 Ga0207700_10001527 3300025928 Bacteria 13113
237 Ga0207700_10027786 3300025928 Bacteria 3967
238 Ga0207700_10064027 3300025928 Bacteria 2799
239 Ga0207700_10077140 3300025928 Bacteria 2588
240 Ga0207700_10101140 3300025928 Bacteria 2299
241 Ga0207700_10290255 3300025928 Bacteria 1409
242 Ga0207700_10472805 3300025928 Bacteria 1107
243 Ga0207700_10781327 3300025928 Bacteria 854
244 Ga0207664_10000320 3300025929 Bacteria 35727
245 Ga0207664_10008569 3300025929 Bacteria 7144
246 Ga0207664_10087436 3300025929 Bacteria 2548
247 Ga0207664_10088467 3300025929 Bacteria 2534
248 Ga0207664_10133914 3300025929 Unclassified 2089
249 Ga0207664_10170015 3300025929 Bacteria 1865
250 Ga0207664_10248209 3300025929 Bacteria 1552
251 Ga0207664_10507209 3300025929 Bacteria 1080
252 Ga0207664_10761516 3300025929 Unclassified 871
253 Ga0207644_10010589 3300025931 Bacteria 6079
254 Ga0207690_10067511 3300025932 Bacteria 2453
255 Ga0207706_10000747 3300025933 Bacteria 33873
256 Ga0207686_10012405 3300025934 Unclassified 4687
257 Ga0207686_10250192 3300025934 Unclassified 1294
258 Ga0207669_10011301 3300025937 Bacteria 4339
259 Ga0207704_10059148 3300025938 Bacteria 2364
260 Ga0207665_10013441 3300025939 Bacteria 5383
261 Ga0207665_10023087 3300025939 Bacteria 4098
262 Ga0207665_10031634 3300025939 Bacteria 3501
263 Ga0207665_10088409 3300025939 Unclassified 2143
264 Ga0207691_10000476 3300025940 Bacteria 39750
265 Ga0207711_10023734 3300025941 Bacteria 5135
266 Ga0207689_10000194 3300025942 Bacteria 53148
267 Ga0207661_10005547 3300025944 Bacteria 8902
268 Ga0207679_10001049 3300025945 Bacteria 17586
269 Ga0207667_10207902 3300025949 Unclassified 2006
270 Ga0207651_10000446 3300025960 Bacteria 17458
271 Ga0207712_10035606 3300025961 Bacteria 3384
272 Ga0207668_10069577 3300025972 Bacteria 2506
273 Ga0207640_10020949 3300025981 Bacteria 3888
274 Ga0207658_10012570 3300025986 Bacteria 5778
275 Ga0207677_10037631 3300026023 Bacteria 3164
276 Ga0207677_10077895 3300026023 Unclassified 2365
277 Ga0207677_10150764 3300026023 Bacteria 1793
278 Ga0207703_10143715 3300026035 Bacteria 2073
279 Ga0207703_10702984 3300026035 Unclassified 961
280 Ga0207639_10072298 3300026041 Bacteria 2700
281 Ga0207678_10001308 3300026067 Bacteria 23081
282 Ga0207702_10006499 3300026078 Bacteria 10064
283 Ga0207702_10209632 3300026078 Bacteria 1811
284 Ga0207641_10000316 3300026088 Bacteria 59952
285 Ga0207648_10000690 3300026089 Bacteria 37808
286 Ga0207676_10000107 3300026095 Bacteria 74255
287 Ga0207674_10000034 3300026116 Bacteria 137337
288 Ga0207675_100040371 3300026118 Bacteria 4358
289 Ga0207683_10000674 3300026121 Bacteria 31299
290 Ga0207698_10136827 3300026142 Bacteria 2103
291 Ga0265354_1012159 3300028016 Bacteria 817
292 Ga0265356_1000192 3300028017 Bacteria 11540
293 Ga0268266_10056986 3300028379 Bacteria 3361
294 Ga0268265_10021898 3300028380 Bacteria 4484
295 Ga0268264_10059533 3300028381 Bacteria 3200
296 Ga0265338_10000863 3300028800 Bacteria 51343
297 Ga0265338_10061753 3300028800 Bacteria 3282
298 Ga0265338_10108129 3300028800 Bacteria 2247
299 Ga0265338_10149935 3300028800 Bacteria 1813
300 Ga0265338_10544805 3300028800 Unclassified 813
301 Ga0265762_1000209 3300030760 Bacteria 9385
302 Ga0265762_1002708 3300030760 Bacteria 3170
303 Ga0265762_1026208 3300030760 Unclassified 1090
304 Ga0265763_1004423 3300030763 Bacteria 1151
305 Ga0265760_10000151 3300031090 Bacteria 17947
306 Ga0265760_10000746 3300031090 Bacteria 9303
307 Ga0265760_10001574 3300031090 Bacteria 6720
308 Ga0265760_10028610 3300031090 Unclassified 1636
309 Ga0265325_10025116 3300031241 Bacteria 3237
310 Ga0265340_10267656 3300031247 Unclassified 760
311 Ga0265339_10019904 3300031249 Bacteria 3929
312 Ga0265316_10153356 3300031344 Bacteria 1725
313 Ga0265316_10569145 3300031344 Unclassified 805
314 Ga0316214_1006653 3300033545 Bacteria 1530
315 Ga0316212_1001581 3300033547 Bacteria 3125
316 Ga0316212_1018960 3300033547 Unclassified 966
317 Ga0373926_0043501 3300035083 Bacteria 1607
318 Ga0373934_0004385 3300035086 Bacteria 5214
319 Ga0373944_0015985 3300035089 Bacteria 2111
320 Ga0373923_0003853 3300035111 Bacteria 4884
321 Ga0373923_0128190 3300035111 Unclassified 1138
322 Ga0373936_0007249 3300035113 Bacteria 4171
323 Ga0373936_0041541 3300035113 Bacteria 1845
324 Ga0373945_0087432 3300035116 Unclassified 1202
325 Ga0373953_0010054 3300035117 Bacteria 3279
326 Ga0373954_0020121 3300035118 Bacteria 3016
327 Ga0373956_0101077 3300035119 Bacteria 1337
328 Ga0373957_0031849 3300035120 Bacteria 1939
329 Ga0373943_0004633 3300035170 Bacteria 6216
330 Ga0373943_0057756 3300035170 Bacteria 1929
331 Ga0373943_0285378 3300035170 Bacteria 934
332 Ga0373946_0045435 3300035171 Bacteria 1817
333 Ga0373946_0151017 3300035171 Bacteria 1084
334 Ga0373955_0188351 3300035172 Bacteria 1226
335 Ga0373955_0218132 3300035172 Unclassified 1139
336 Ga0373955_0263238 3300035172 Bacteria 1035
337 Ga0373955_0599203 3300035172 Unclassified 675
338 Ga0373924_0008174 3300035410 Bacteria 3793
339 Ga0373931_0104556 3300035691 Bacteria 1597
340 Ga0373935_0025491 3300035692 Unclassified 3644
341 Ga0373935_0051891 3300035692 Bacteria 2605
342 Ga0373935_0111164 3300035692 Bacteria 1819
343 Ga0373927_0000062 3300035695 Bacteria 77303
344 Ga0373927_0019005 3300035695 Bacteria 4508
345 Ga0373947_0000539 3300035725 Bacteria 22153
346 Ga0373947_0110248 3300035725 Unclassified 1738
347 Ga0373947_0705510 3300035725 Unclassified 688
348 Ga0373947_0844090 3300035725 Unclassified 625
349 Ga0373937_0011606 3300036401 Bacteria 7738
350 Ga0373937_0060774 3300036401 Bacteria 3472
351 Ga0373937_0321484 3300036401 Unclassified 1464
352 Ga0373937_0498961 3300036401 Bacteria 1156
353 Ga0373925_0001460 3300037068 Bacteria 20404
354 Ga0373925_0013393 3300037068 Bacteria 5935
355 Ga0373925_0026745 3300037068 Bacteria 4223
356 Ga0436365_0510483 3300039437 Bacteria 2542
357 Ga0436365_1934391 3300039437 Bacteria 1528
358 Ga0436363_0290563 3300039450 Bacteria 1123
359 Ga0436362_1226293 3300039453 Bacteria 6161
360 Ga0466967_0174983 3300045976 Bacteria 2022
361 Ga0495629_0127838 3300046459 Bacteria 1770
362 Ga0495641_0270402 3300046461 Unclassified 765
363 Ga0495653_0087938 3300046463 Bacteria 2281
364 Ga0495580_0010415 3300046472 Bacteria 7246
365 Ga0495580_0025716 3300046472 Bacteria 4300
366 Ga0495580_0037587 3300046472 Unclassified 3472
367 Ga0495580_0183623 3300046472 Bacteria 1444
368 Ga0495580_0293758 3300046472 Bacteria 1107
369 Ga0495580_0340483 3300046472 Bacteria 1017
370 Ga0495582_0021931 3300046473 Unclassified 3494
371 Ga0495582_0026853 3300046473 Bacteria 3155
372 Ga0495664_0009882 3300046477 Bacteria 5351
373 Ga0495628_0267694 3300046516 Unclassified 1272
374 Ga0495630_0006985 3300046517 Bacteria 8050
375 Ga0495652_0312953 3300046529 Bacteria 1137
376 Ga0495665_0127432 3300046531 Unclassified 1333
377 Ga0495640_0284842 3300046533 Bacteria 1029
378 Ga0495645_0210203 3300046543 Unclassified 1314
379 Ga0495635_0133105 3300046663 Bacteria 1695
380 Ga0495657_0112350 3300046675 Bacteria 1725
381 Ga0495623_0253076 3300046679 Bacteria 990
382 Ga0495646_0052754 3300046680 Bacteria 2455
383 Ga0495647_0136837 3300046681 Bacteria 1042
384 Ga0495624_0033868 3300046690 Bacteria 3308
385 Ga0495581_0026118 3300047315 Bacteria 3388
386 Ga0495674_0009986 3300047319 Bacteria 8995
387 Ga0495674_0013514 3300047319 Bacteria 7676
388 Ga0495676_0109980 3300047321 Bacteria 2024
389 Ga0495684_0303784 3300047471 Bacteria 1145
390 Ga0495602_0025150 3300048088 Bacteria 5765
391 Ga0495602_0032541 3300048088 Bacteria 4908
392 Ga0495614_0213589 3300048089 Bacteria 875
393 Ga0496100_0747254 3300048903 Unclassified 765
394 Ga0496101_0068198 3300048904 Bacteria 2600
395 Ga0496102_0037057 3300048905 Bacteria 4398
396 Ga0496102_0056498 3300048905 Bacteria 3581
397 Ga0496102_0209591 3300048905 Bacteria 1837
398 Ga0496103_0004482 3300048906 Bacteria 8464
399 Ga0496104_0006518 3300048907 Bacteria 10268
400 Ga0496104_0380734 3300048907 Unclassified 1323
401 Ga0496106_0360198 3300048909 Bacteria 1168
402 Ga0496107_0027203 3300048910 Bacteria 4061
403 Ga0496108_0000364 3300048911 Bacteria 38115
404 Ga0496109_0000083 3300048912 Bacteria 96495
405 Ga0496110_0000236 3300048913 Bacteria 35769
406 Ga0496111_0008193 3300048914 Bacteria 6908
407 Ga0496111_0236821 3300048914 Bacteria 1356
408 Ga0496112_0000033 3300048915 Bacteria 112312
409 Ga0496112_0042146 3300048915 Bacteria 4466
410 Ga0496112_0123674 3300048915 Bacteria 2558
411 Ga0496113_0004588 3300048916 Bacteria 8517
412 Ga0496114_0468494 3300048917 Bacteria 1115
413 Ga0496115_0006102 3300048918 Bacteria 8805
414 nmdc:mga0rr50_943236_c1 3300050513 Bacteria 736
415 nmdc:mga08x19_19007_c1 3300050514 Bacteria 4214
416 nmdc:mga08x19_232018_c1 3300050514 Bacteria 1270
417 nmdc:mga08x19_274843_c1 3300050514 Unclassified 1166
418 Ga0495601_0086469 3300053077 Unclassified 2015
419 Ga0495612_0079687 3300053078 Bacteria 1375
420 Ga0495612_0122156 3300053078 Bacteria 1121
421 Ga0495612_0425583 3300053078 Unclassified 605
422 Ga0495619_0508608 3300053085 Unclassified 828
423 Ga0500590_103724 3300053148 Bacteria 1361

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046461 Ga0495641_0270402 Ga0495641_0270402_226_720 158
2 3300025928 Ga0207700_10290255 Ga0207700_102902552 160
3 3300006028 Ga0070717_10561416 Ga0070717_105614161 163
4 3300035116 Ga0373945_0087432 Ga0373945_0087432_644_1186 163
5 3300036401 Ga0373937_0498961 Ga0373937_0498961_427_993 163
6 3300046675 Ga0495657_0112350 Ga0495657_0112350_424_990 163
7 3300050514 nmdc:mga08x19_274843_c1 nmdc:mga08x19_274843_c1_52_612 163
8 3300014969 Ga0157376_10021292 Ga0157376_100212925 164
9 3300005435 Ga0070714_100044108 Ga0070714_1000441083 165
10 3300025912 Ga0207707_10017723 Ga0207707_100177233 165
11 3300025929 Ga0207664_10088467 Ga0207664_100884673 165
12 3300036401 Ga0373937_0321484 Ga0373937_0321484_837_1448 165
13 3300046472 Ga0495580_0340483 Ga0495580_0340483_377_943 165
14 3300005434 Ga0070709_10112534 Ga0070709_101125342 166
15 3300031090 Ga0265760_10028610 Ga0265760_100286101 166
16 3300013307 Ga0157372_10183978 Ga0157372_101839783 167
17 3300005467 Ga0070706_100126319 Ga0070706_1001263192 168
18 3300025910 Ga0207684_10148863 Ga0207684_101488632 168
19 3300028800 Ga0265338_10061753 Ga0265338_100617531 168
20 3300031241 Ga0265325_10025116 Ga0265325_100251162 168
21 3300005530 Ga0070679_100481168 Ga0070679_1004811682 169
22 3300025921 Ga0207652_10361711 Ga0207652_103617112 169
23 3300025939 Ga0207665_10088409 Ga0207665_100884092 169
24 3300035172 Ga0373955_0599203 Ga0373955_0599203_37_648 169
25 3300005434 Ga0070709_10095085 Ga0070709_100950852 170
26 3300005434 Ga0070709_10190093 Ga0070709_101900932 170
27 3300005435 Ga0070714_100062288 Ga0070714_1000622882 170
28 3300005435 Ga0070714_100065488 Ga0070714_1000654882 170
29 3300005436 Ga0070713_100000060 Ga0070713_10000006015 170
30 3300005437 Ga0070710_10119727 Ga0070710_101197272 170
31 3300005439 Ga0070711_100000525 Ga0070711_1000005254 170
32 3300006028 Ga0070717_10016003 Ga0070717_100160032 170
33 3300006163 Ga0070715_10045095 Ga0070715_100450952 170
34 3300006175 Ga0070712_100000780 Ga0070712_1000007809 170
35 3300025898 Ga0207692_10038197 Ga0207692_100381972 170
36 3300025906 Ga0207699_10020398 Ga0207699_100203983 170
37 3300025915 Ga0207693_10000191 Ga0207693_1000019121 170
38 3300025916 Ga0207663_10006472 Ga0207663_100064726 170
39 3300025928 Ga0207700_10000358 Ga0207700_100003589 170
40 3300025929 Ga0207664_10170015 Ga0207664_101700152 170
41 3300025929 Ga0207664_10248209 Ga0207664_102482092 170
42 3300035111 Ga0373923_0128190 Ga0373923_0128190_443_1006 170
43 3300035113 Ga0373936_0041541 Ga0373936_0041541_332_895 170
44 3300035692 Ga0373935_0025491 Ga0373935_0025491_808_1371 170
45 3300035725 Ga0373947_0110248 Ga0373947_0110248_241_804 170
46 3300035725 Ga0373947_0844090 Ga0373947_0844090_43_606 170
47 3300037068 Ga0373925_0026745 Ga0373925_0026745_688_1251 170
48 3300046459 Ga0495629_0127838 Ga0495629_0127838_1069_1632 170
49 3300046472 Ga0495580_0010415 Ga0495580_0010415_4757_5320 170
50 3300046473 Ga0495582_0021931 Ga0495582_0021931_2919_3482 170
51 3300046543 Ga0495645_0210203 Ga0495645_0210203_717_1280 170
52 3300046681 Ga0495647_0136837 Ga0495647_0136837_428_991 170
53 3300047319 Ga0495674_0009986 Ga0495674_0009986_1130_1693 170
54 3300048907 Ga0496104_0380734 Ga0496104_0380734_86_649 170
55 3300048918 Ga0496115_0006102 Ga0496115_0006102_4856_5419 170
56 3300053077 Ga0495601_0086469 Ga0495601_0086469_926_1489 170
57 3300053078 Ga0495612_0079687 Ga0495612_0079687_411_974 170
58 3300053085 Ga0495619_0508608 Ga0495619_0508608_102_665 170
59 3300005458 Ga0070681_10023131 Ga0070681_100231314 171
60 3300006028 Ga0070717_10070932 Ga0070717_100709323 171
61 3300006028 Ga0070717_10515394 Ga0070717_105153942 171
62 3300009093 Ga0105240_10198499 Ga0105240_101984992 171
63 3300013104 Ga0157370_10451907 Ga0157370_104519072 171
64 3300025913 Ga0207695_10153177 Ga0207695_101531772 171
65 3300025924 Ga0207694_10725691 Ga0207694_107256911 171
66 3300025928 Ga0207700_10027786 Ga0207700_100277862 171
67 3300048915 Ga0496112_0042146 Ga0496112_0042146_749_1312 171
68 3300035172 Ga0373955_0188351 Ga0373955_0188351_136_714 173
69 3300025928 Ga0207700_10781327 Ga0207700_107813271 174
70 3300005436 Ga0070713_100775052 Ga0070713_1007750521 177
71 3300006028 Ga0070717_10002369 Ga0070717_100023697 177
72 3300006163 Ga0070715_10566624 Ga0070715_105666241 177
73 3300022732 Ga0224569_107319 Ga0224569_1073191 177
74 3300031344 Ga0265316_10153356 Ga0265316_101533562 177
75 3300039450 Ga0436363_0290563 Ga0436363_0290563_149_721 177
76 3300005435 Ga0070714_100000299 Ga0070714_10000029924 179
77 3300021384 Ga0213876_10127695 Ga0213876_101276952 179
78 3300033547 Ga0316212_1018960 Ga0316212_10189601 179
79 3300039437 Ga0436365_1934391 Ga0436365_1934391_354_917 179
80 3300039453 Ga0436362_1226293 Ga0436362_1226293_4199_4762 179
81 3300005468 Ga0070707_100143895 Ga0070707_1001438952 180
82 3300005844 Ga0068862_100421903 Ga0068862_1004219032 180
83 3300009092 Ga0105250_10084355 Ga0105250_100843552 180
84 3300009098 Ga0105245_10581111 Ga0105245_105811111 180
85 3300009553 Ga0105249_10274508 Ga0105249_102745082 180
86 3300025898 Ga0207692_10016345 Ga0207692_100163454 180
87 3300025927 Ga0207687_10095570 Ga0207687_100955702 180
88 3300028800 Ga0265338_10000863 Ga0265338_1000086342 180
89 3300028800 Ga0265338_10149935 Ga0265338_101499352 180
90 3300030763 Ga0265763_1004423 Ga0265763_10044232 180
91 3300031249 Ga0265339_10019904 Ga0265339_100199042 180
92 3300031344 Ga0265316_10569145 Ga0265316_105691451 180
93 3300005435 Ga0070714_100300506 Ga0070714_1003005062 181
94 3300005471 Ga0070698_101012508 Ga0070698_1010125081 181
95 3300005518 Ga0070699_100013644 Ga0070699_1000136445 181
96 3300006028 Ga0070717_10219987 Ga0070717_102199872 181
97 3300007788 Ga0099795_10037392 Ga0099795_100373922 181
98 3300010159 Ga0099796_10064792 Ga0099796_100647922 181
99 3300025922 Ga0207646_10266624 Ga0207646_102666242 181
100 3300025928 Ga0207700_10472805 Ga0207700_104728052 181
101 3300025929 Ga0207664_10133914 Ga0207664_101339142 181
102 3300030760 Ga0265762_1000209 Ga0265762_10002096 181
103 3300048914 Ga0496111_0236821 Ga0496111_0236821_216_776 181
104 3300050513 nmdc:mga0rr50_943236_c1 nmdc:mga0rr50_943236_c1_72_632 181
105 3300050514 nmdc:mga08x19_19007_c1 nmdc:mga08x19_19007_c1_614_1174 181
106 3300005439 Ga0070711_100420330 Ga0070711_1004203302 182
107 3300005445 Ga0070708_100000347 Ga0070708_10000034718 182
108 3300005467 Ga0070706_100004125 Ga0070706_1000041254 182
109 3300005467 Ga0070706_100037294 Ga0070706_1000372944 182
110 3300005468 Ga0070707_100002300 Ga0070707_10000230010 182
111 3300005471 Ga0070698_100009673 Ga0070698_1000096735 182
112 3300005471 Ga0070698_100026328 Ga0070698_1000263285 182
113 3300005518 Ga0070699_100000343 Ga0070699_10000034340 182
114 3300005536 Ga0070697_100000960 Ga0070697_10000096015 182
115 3300006028 Ga0070717_10092255 Ga0070717_100922552 182
116 3300006175 Ga0070712_100079657 Ga0070712_1000796572 182
117 3300006175 Ga0070712_100423908 Ga0070712_1004239082 182
118 3300025910 Ga0207684_10000081 Ga0207684_10000081109 182
119 3300025915 Ga0207693_10356284 Ga0207693_103562842 182
120 3300025916 Ga0207663_10009210 Ga0207663_100092102 182
121 3300025916 Ga0207663_10389731 Ga0207663_103897311 182
122 3300025922 Ga0207646_10002622 Ga0207646_1000262212 182
123 3300025929 Ga0207664_10000320 Ga0207664_1000032025 182
124 3300026078 Ga0207702_10006499 Ga0207702_100064997 182
125 3300035086 Ga0373934_0004385 Ga0373934_0004385_3987_4553 182
126 3300035089 Ga0373944_0015985 Ga0373944_0015985_597_1163 182
127 3300035111 Ga0373923_0003853 Ga0373923_0003853_1072_1638 182
128 3300035113 Ga0373936_0007249 Ga0373936_0007249_1147_1713 182
129 3300035117 Ga0373953_0010054 Ga0373953_0010054_1643_2209 182
130 3300035118 Ga0373954_0020121 Ga0373954_0020121_634_1200 182
131 3300035119 Ga0373956_0101077 Ga0373956_0101077_261_827 182
132 3300035120 Ga0373957_0031849 Ga0373957_0031849_1278_1844 182
133 3300035170 Ga0373943_0004633 Ga0373943_0004633_1472_2038 182
134 3300035171 Ga0373946_0045435 Ga0373946_0045435_135_701 182
135 3300035172 Ga0373955_0263238 Ga0373955_0263238_336_902 182
136 3300035410 Ga0373924_0008174 Ga0373924_0008174_1974_2540 182
137 3300035692 Ga0373935_0051891 Ga0373935_0051891_1137_1703 182
138 3300035695 Ga0373927_0000062 Ga0373927_0000062_61574_62140 182
139 3300035725 Ga0373947_0000539 Ga0373947_0000539_20917_21483 182
140 3300036401 Ga0373937_0060774 Ga0373937_0060774_452_1018 182
141 3300037068 Ga0373925_0013393 Ga0373925_0013393_1213_1779 182
142 3300046463 Ga0495653_0087938 Ga0495653_0087938_1294_1860 182
143 3300046472 Ga0495580_0183623 Ga0495580_0183623_208_774 182
144 3300046472 Ga0495580_0293758 Ga0495580_0293758_12_578 182
145 3300046477 Ga0495664_0009882 Ga0495664_0009882_3580_4146 182
146 3300046516 Ga0495628_0267694 Ga0495628_0267694_177_743 182
147 3300046517 Ga0495630_0006985 Ga0495630_0006985_5152_5718 182
148 3300046529 Ga0495652_0312953 Ga0495652_0312953_383_949 182
149 3300046531 Ga0495665_0127432 Ga0495665_0127432_172_738 182
150 3300046533 Ga0495640_0284842 Ga0495640_0284842_453_1019 182
151 3300046663 Ga0495635_0133105 Ga0495635_0133105_413_979 182
152 3300046680 Ga0495646_0052754 Ga0495646_0052754_1251_1817 182
153 3300046690 Ga0495624_0033868 Ga0495624_0033868_1500_2066 182
154 3300047319 Ga0495674_0013514 Ga0495674_0013514_7066_7632 182
155 3300047321 Ga0495676_0109980 Ga0495676_0109980_41_607 182
156 3300047471 Ga0495684_0303784 Ga0495684_0303784_229_795 182
157 3300048088 Ga0495602_0032541 Ga0495602_0032541_2870_3436 182
158 3300053078 Ga0495612_0122156 Ga0495612_0122156_529_1095 182
159 3300003320 rootH2_10158254 rootH2_101582543 183
160 3300005335 Ga0070666_10021347 Ga0070666_100213472 183
161 3300005338 Ga0068868_100011081 Ga0068868_1000110819 183
162 3300005434 Ga0070709_10050956 Ga0070709_100509562 183
163 3300005435 Ga0070714_100004403 Ga0070714_1000044035 183
164 3300005436 Ga0070713_100016622 Ga0070713_1000166227 183
165 3300005436 Ga0070713_100021298 Ga0070713_1000212985 183
166 3300005439 Ga0070711_100142251 Ga0070711_1001422512 183
167 3300005459 Ga0068867_100573599 Ga0068867_1005735991 183
168 3300005842 Ga0068858_100064473 Ga0068858_1000644735 183
169 3300006028 Ga0070717_10363525 Ga0070717_103635252 183
170 3300006237 Ga0097621_100001100 Ga0097621_1000011009 183
171 3300009098 Ga0105245_10001900 Ga0105245_100019008 183
172 3300009176 Ga0105242_10023224 Ga0105242_100232249 183
173 3300009177 Ga0105248_10038199 Ga0105248_100381992 183
174 3300010375 Ga0105239_10366911 Ga0105239_103669112 183
175 3300013296 Ga0157374_10154847 Ga0157374_101548472 183
176 3300013297 Ga0157378_10000411 Ga0157378_100004114 183
177 3300013306 Ga0163162_10204937 Ga0163162_102049372 183
178 3300013307 Ga0157372_10314696 Ga0157372_103146963 183
179 3300022730 Ga0224570_108151 Ga0224570_1081511 183
180 3300022732 Ga0224569_107221 Ga0224569_1072211 183
181 3300025916 Ga0207663_10797252 Ga0207663_107972522 183
182 3300025927 Ga0207687_10008478 Ga0207687_100084788 183
183 3300025928 Ga0207700_10001527 Ga0207700_100015277 183
184 3300025929 Ga0207664_10008569 Ga0207664_100085692 183
185 3300025934 Ga0207686_10012405 Ga0207686_100124051 183
186 3300026023 Ga0207677_10150764 Ga0207677_101507642 183
187 3300026035 Ga0207703_10702984 Ga0207703_107029841 183
188 3300053148 Ga0500590_103724 Ga0500590_103724_369_926 183
189 3300000546 LJNas_1000008 LJNas_10000082 184
190 3300022730 Ga0224570_100452 Ga0224570_1004523 184
191 3300024225 Ga0224572_1071110 Ga0224572_10711101 184
192 3300024227 Ga0228598_1000536 Ga0228598_10005365 184
193 3300025914 Ga0207671_10132005 Ga0207671_101320052 184
194 3300028016 Ga0265354_1012159 Ga0265354_10121592 184
195 3300028017 Ga0265356_1000192 Ga0265356_10001923 184
196 3300028800 Ga0265338_10544805 Ga0265338_105448051 184
197 3300030760 Ga0265762_1026208 Ga0265762_10262082 184
198 3300031090 Ga0265760_10000151 Ga0265760_100001517 184
199 3300031090 Ga0265760_10000746 Ga0265760_100007465 184
200 3300031090 Ga0265760_10001574 Ga0265760_100015746 184
201 3300031247 Ga0265340_10267656 Ga0265340_102676561 184
202 3300033545 Ga0316214_1006653 Ga0316214_10066532 184
203 3300050514 nmdc:mga08x19_232018_c1 nmdc:mga08x19_232018_c1_365_925 184
204 3300005434 Ga0070709_10006124 Ga0070709_100061243 185
205 3300005435 Ga0070714_100075297 Ga0070714_1000752972 185
206 3300005435 Ga0070714_100298567 Ga0070714_1002985672 185
207 3300005435 Ga0070714_100876516 Ga0070714_1008765161 185
208 3300005436 Ga0070713_100130484 Ga0070713_1001304841 185
209 3300005436 Ga0070713_100296387 Ga0070713_1002963872 185
210 3300005436 Ga0070713_100371334 Ga0070713_1003713341 185
211 3300005437 Ga0070710_10246312 Ga0070710_102463121 185
212 3300005439 Ga0070711_100002974 Ga0070711_1000029745 185
213 3300005439 Ga0070711_100113674 Ga0070711_1001136742 185
214 3300005445 Ga0070708_100002534 Ga0070708_10000253411 185
215 3300005445 Ga0070708_100006847 Ga0070708_10000684711 185
216 3300005467 Ga0070706_100031570 Ga0070706_1000315702 185
217 3300005468 Ga0070707_100037541 Ga0070707_1000375415 185
218 3300005471 Ga0070698_100071655 Ga0070698_1000716552 185
219 3300005536 Ga0070697_100002199 Ga0070697_10000219918 185
220 3300005536 Ga0070697_100015775 Ga0070697_1000157757 185
221 3300005614 Ga0068856_100253398 Ga0068856_1002533982 185
222 3300006173 Ga0070716_100014543 Ga0070716_1000145433 185
223 3300006173 Ga0070716_100019252 Ga0070716_1000192522 185
224 3300006175 Ga0070712_100008838 Ga0070712_1000088385 185
225 3300006175 Ga0070712_100142085 Ga0070712_1001420852 185
226 3300006871 Ga0075434_100377800 Ga0075434_1003778002 185
227 3300007076 Ga0075435_100014849 Ga0075435_1000148498 185
228 3300013307 Ga0157372_10156184 Ga0157372_101561842 185
229 3300021384 Ga0213876_10049080 Ga0213876_100490802 185
230 3300025898 Ga0207692_10284977 Ga0207692_102849771 185
231 3300025906 Ga0207699_10004663 Ga0207699_100046633 185
232 3300025906 Ga0207699_10038327 Ga0207699_100383273 185
233 3300025906 Ga0207699_10365009 Ga0207699_103650092 185
234 3300025910 Ga0207684_10025073 Ga0207684_100250732 185
235 3300025913 Ga0207695_10197937 Ga0207695_101979373 185
236 3300025915 Ga0207693_10009709 Ga0207693_100097093 185
237 3300025915 Ga0207693_10020239 Ga0207693_100202396 185
238 3300025916 Ga0207663_10005262 Ga0207663_100052624 185
239 3300025916 Ga0207663_10039784 Ga0207663_100397842 185
240 3300025916 Ga0207663_10148469 Ga0207663_101484692 185
241 3300025922 Ga0207646_10372457 Ga0207646_103724572 185
242 3300025922 Ga0207646_11168056 Ga0207646_111680561 185
243 3300025928 Ga0207700_10064027 Ga0207700_100640273 185
244 3300025928 Ga0207700_10077140 Ga0207700_100771402 185
245 3300025928 Ga0207700_10101140 Ga0207700_101011402 185
246 3300025929 Ga0207664_10087436 Ga0207664_100874363 185
247 3300025929 Ga0207664_10507209 Ga0207664_105072091 185
248 3300025929 Ga0207664_10761516 Ga0207664_107615162 185
249 3300025939 Ga0207665_10013441 Ga0207665_100134417 185
250 3300025939 Ga0207665_10023087 Ga0207665_100230872 185
251 3300026078 Ga0207702_10209632 Ga0207702_102096322 185
252 3300028800 Ga0265338_10108129 Ga0265338_101081293 185
253 3300035083 Ga0373926_0043501 Ga0373926_0043501_471_1043 185
254 3300035170 Ga0373943_0057756 Ga0373943_0057756_700_1272 185
255 3300035170 Ga0373943_0285378 Ga0373943_0285378_211_768 185
256 3300035171 Ga0373946_0151017 Ga0373946_0151017_472_1044 185
257 3300035172 Ga0373955_0218132 Ga0373955_0218132_73_630 185
258 3300035692 Ga0373935_0111164 Ga0373935_0111164_340_912 185
259 3300035695 Ga0373927_0019005 Ga0373927_0019005_751_1323 185
260 3300035725 Ga0373947_0705510 Ga0373947_0705510_38_595 185
261 3300036401 Ga0373937_0011606 Ga0373937_0011606_6223_6780 185
262 3300037068 Ga0373925_0001460 Ga0373925_0001460_17265_17837 185
263 3300039437 Ga0436365_0510483 Ga0436365_0510483_1187_1753 185
264 3300046472 Ga0495580_0025716 Ga0495580_0025716_929_1501 185
265 3300046472 Ga0495580_0037587 Ga0495580_0037587_976_1542 185
266 3300046473 Ga0495582_0026853 Ga0495582_0026853_2004_2576 185
267 3300046679 Ga0495623_0253076 Ga0495623_0253076_272_835 185
268 3300047315 Ga0495581_0026118 Ga0495581_0026118_2433_3005 185
269 3300048088 Ga0495602_0025150 Ga0495602_0025150_993_1550 185
270 3300048089 Ga0495614_0213589 Ga0495614_0213589_93_665 185
271 3300048905 Ga0496102_0056498 Ga0496102_0056498_1849_2409 185
272 3300053078 Ga0495612_0425583 Ga0495612_0425583_10_567 185
273 3300005841 Ga0068863_100477766 Ga0068863_1004777662 186
274 3300005843 Ga0068860_100493253 Ga0068860_1004932531 186
275 3300006163 Ga0070715_10072217 Ga0070715_100722173 186
276 3300006173 Ga0070716_100041130 Ga0070716_1000411302 186
277 3300009098 Ga0105245_10206483 Ga0105245_102064832 186
278 3300009101 Ga0105247_10329054 Ga0105247_103290542 186
279 3300009174 Ga0105241_10314408 Ga0105241_103144083 186
280 3300009177 Ga0105248_10436186 Ga0105248_104361862 186
281 3300013306 Ga0163162_10308618 Ga0163162_103086182 186
282 3300014968 Ga0157379_10004106 Ga0157379_100041067 186
283 3300025911 Ga0207654_10246313 Ga0207654_102463132 186
284 3300025939 Ga0207665_10031634 Ga0207665_100316344 186
285 3300030760 Ga0265762_1002708 Ga0265762_10027084 186
286 3300033547 Ga0316212_1001581 Ga0316212_10015812 186
287 3300035691 Ga0373931_0104556 Ga0373931_0104556_971_1534 186
288 3300048904 Ga0496101_0068198 Ga0496101_0068198_1249_1812 186
289 3300048905 Ga0496102_0209591 Ga0496102_0209591_1233_1796 186
290 3300048906 Ga0496103_0004482 Ga0496103_0004482_2459_3022 186
291 3300048907 Ga0496104_0006518 Ga0496104_0006518_7963_8526 186
292 3300048909 Ga0496106_0360198 Ga0496106_0360198_306_869 186
293 3300048910 Ga0496107_0027203 Ga0496107_0027203_2996_3559 186
294 3300013100 Ga0157373_10006392 Ga0157373_100063925 188
295 3300045976 Ga0466967_0174983 Ga0466967_0174983_1090_1656 188
296 3300005331 Ga0070670_100110609 Ga0070670_1001106092 190
297 3300005334 Ga0068869_100124999 Ga0068869_1001249992 190
298 3300005338 Ga0068868_100030310 Ga0068868_1000303104 190
299 3300013306 Ga0163162_10108674 Ga0163162_101086745 190
300 3300014325 Ga0163163_10139028 Ga0163163_101390282 190
301 3300026023 Ga0207677_10077895 Ga0207677_100778952 190
302 3300048915 Ga0496112_0123674 Ga0496112_0123674_1212_1802 190
303 2162886012 MBSR1b_contig_14265637 MBSR1b_0382.00006390 195
304 3300001978 JGI24747J21853_1003750 JGI24747J21853_10037502 195
305 3300001990 JGI24737J22298_10009731 JGI24737J22298_100097312 195
306 3300001991 JGI24743J22301_10000415 JGI24743J22301_100004155 195
307 3300002073 JGI24745J21846_1005447 JGI24745J21846_10054471 195
308 3300002074 JGI24748J21848_1002984 JGI24748J21848_10029842 195
309 3300002459 JGI24751J29686_10003600 JGI24751J29686_100036002 195
310 3300005290 Ga0065712_10079928 Ga0065712_100799283 195
311 3300005293 Ga0065715_10090939 Ga0065715_100909393 195
312 3300005328 Ga0070676_10007823 Ga0070676_100078235 195
313 3300005329 Ga0070683_100001062 Ga0070683_10000106213 195
314 3300005330 Ga0070690_100044956 Ga0070690_1000449562 195
315 3300005331 Ga0070670_100038427 Ga0070670_1000384274 195
316 3300005333 Ga0070677_10012694 Ga0070677_100126942 195
317 3300005335 Ga0070666_10030043 Ga0070666_100300433 195
318 3300005337 Ga0070682_100065562 Ga0070682_1000655622 195
319 3300005339 Ga0070660_100002753 Ga0070660_1000027537 195
320 3300005340 Ga0070689_100003567 Ga0070689_1000035677 195
321 3300005343 Ga0070687_100014805 Ga0070687_1000148053 195
322 3300005344 Ga0070661_100038895 Ga0070661_1000388952 195
323 3300005347 Ga0070668_100000767 Ga0070668_1000007676 195
324 3300005354 Ga0070675_100072045 Ga0070675_1000720453 195
325 3300005355 Ga0070671_100025349 Ga0070671_1000253494 195
326 3300005365 Ga0070688_100000794 Ga0070688_1000007948 195
327 3300005366 Ga0070659_100009140 Ga0070659_1000091405 195
328 3300005455 Ga0070663_100060576 Ga0070663_1000605762 195
329 3300005456 Ga0070678_100015838 Ga0070678_1000158383 195
330 3300005457 Ga0070662_100007780 Ga0070662_1000077806 195
331 3300005459 Ga0068867_100061822 Ga0068867_1000618222 195
332 3300005466 Ga0070685_10034904 Ga0070685_100349042 195
333 3300005535 Ga0070684_100004290 Ga0070684_10000429011 195
334 3300005539 Ga0068853_100001951 Ga0068853_1000019519 195
335 3300005544 Ga0070686_100001352 Ga0070686_1000013529 195
336 3300005547 Ga0070693_100010426 Ga0070693_1000104263 195
337 3300005563 Ga0068855_100042369 Ga0068855_1000423693 195
338 3300005577 Ga0068857_100000637 Ga0068857_1000006374 195
339 3300005615 Ga0070702_100005694 Ga0070702_1000056945 195
340 3300005616 Ga0068852_100001238 Ga0068852_10000123812 195
341 3300005718 Ga0068866_10003074 Ga0068866_100030745 195
342 3300005719 Ga0068861_100530404 Ga0068861_1005304042 195
343 3300005834 Ga0068851_10002917 Ga0068851_100029172 195
344 3300005840 Ga0068870_10118368 Ga0068870_101183682 195
345 3300005843 Ga0068860_100059507 Ga0068860_1000595072 195
346 3300005844 Ga0068862_100026020 Ga0068862_1000260203 195
347 3300006237 Ga0097621_100063505 Ga0097621_1000635053 195
348 3300006358 Ga0068871_100111672 Ga0068871_1001116722 195
349 3300006881 Ga0068865_100015126 Ga0068865_1000151262 195
350 3300009098 Ga0105245_10006049 Ga0105245_100060497 195
351 3300009101 Ga0105247_10000903 Ga0105247_100009035 195
352 3300009174 Ga0105241_10001381 Ga0105241_1000138111 195
353 3300009176 Ga0105242_10252683 Ga0105242_102526832 195
354 3300009177 Ga0105248_10192760 Ga0105248_101927603 195
355 3300009545 Ga0105237_10018546 Ga0105237_100185465 195
356 3300009553 Ga0105249_10113306 Ga0105249_101133062 195
357 3300010375 Ga0105239_10029583 Ga0105239_100295833 195
358 3300011119 Ga0105246_10000750 Ga0105246_1000075010 195
359 3300013102 Ga0157371_10007759 Ga0157371_100077593 195
360 3300013105 Ga0157369_10248467 Ga0157369_102484671 195
361 3300013296 Ga0157374_10145880 Ga0157374_101458802 195
362 3300013297 Ga0157378_10130819 Ga0157378_101308192 195
363 3300013307 Ga0157372_10004071 Ga0157372_100040717 195
364 3300014325 Ga0163163_10075151 Ga0163163_100751512 195
365 3300014745 Ga0157377_10001207 Ga0157377_100012077 195
366 3300014968 Ga0157379_10002043 Ga0157379_1000204312 195
367 3300014969 Ga0157376_10014082 Ga0157376_100140824 195
368 3300017792 Ga0163161_10003449 Ga0163161_100034494 195
369 3300025315 Ga0207697_10003737 Ga0207697_100037372 195
370 3300025321 Ga0207656_10003649 Ga0207656_100036494 195
371 3300025893 Ga0207682_10070647 Ga0207682_100706471 195
372 3300025899 Ga0207642_10029547 Ga0207642_100295472 195
373 3300025901 Ga0207688_10005673 Ga0207688_100056733 195
374 3300025903 Ga0207680_10007582 Ga0207680_100075823 195
375 3300025904 Ga0207647_10007354 Ga0207647_100073543 195
376 3300025907 Ga0207645_10000011 Ga0207645_1000001186 195
377 3300025908 Ga0207643_10000185 Ga0207643_1000018533 195
378 3300025918 Ga0207662_10002009 Ga0207662_100020097 195
379 3300025919 Ga0207657_10000505 Ga0207657_1000050520 195
380 3300025923 Ga0207681_10113096 Ga0207681_101130962 195
381 3300025925 Ga0207650_10000336 Ga0207650_1000033620 195
382 3300025926 Ga0207659_10014180 Ga0207659_100141802 195
383 3300025927 Ga0207687_10041220 Ga0207687_100412202 195
384 3300025931 Ga0207644_10010589 Ga0207644_100105892 195
385 3300025932 Ga0207690_10067511 Ga0207690_100675112 195
386 3300025933 Ga0207706_10000747 Ga0207706_1000074720 195
387 3300025934 Ga0207686_10250192 Ga0207686_102501922 195
388 3300025937 Ga0207669_10011301 Ga0207669_100113014 195
389 3300025938 Ga0207704_10059148 Ga0207704_100591481 195
390 3300025940 Ga0207691_10000476 Ga0207691_1000047621 195
391 3300025941 Ga0207711_10023734 Ga0207711_100237345 195
392 3300025942 Ga0207689_10000194 Ga0207689_100001947 195
393 3300025944 Ga0207661_10005547 Ga0207661_100055479 195
394 3300025945 Ga0207679_10001049 Ga0207679_1000104914 195
395 3300025949 Ga0207667_10207902 Ga0207667_102079021 195
396 3300025960 Ga0207651_10000446 Ga0207651_100004464 195
397 3300025961 Ga0207712_10035606 Ga0207712_100356063 195
398 3300025972 Ga0207668_10069577 Ga0207668_100695773 195
399 3300025981 Ga0207640_10020949 Ga0207640_100209493 195
400 3300025986 Ga0207658_10012570 Ga0207658_100125702 195
401 3300026023 Ga0207677_10037631 Ga0207677_100376312 195
402 3300026035 Ga0207703_10143715 Ga0207703_101437152 195
403 3300026041 Ga0207639_10072298 Ga0207639_100722982 195
404 3300026067 Ga0207678_10001308 Ga0207678_100013087 195
405 3300026088 Ga0207641_10000316 Ga0207641_1000031619 195
406 3300026089 Ga0207648_10000690 Ga0207648_100006908 195
407 3300026095 Ga0207676_10000107 Ga0207676_1000010730 195
408 3300026116 Ga0207674_10000034 Ga0207674_1000003491 195
409 3300026118 Ga0207675_100040371 Ga0207675_1000403715 195
410 3300026121 Ga0207683_10000674 Ga0207683_1000067415 195
411 3300026142 Ga0207698_10136827 Ga0207698_101368272 195
412 3300028379 Ga0268266_10056986 Ga0268266_100569863 195
413 3300028380 Ga0268265_10021898 Ga0268265_100218984 195
414 3300028381 Ga0268264_10059533 Ga0268264_100595333 195
415 3300048903 Ga0496100_0747254 Ga0496100_0747254_107_694 195
416 3300048905 Ga0496102_0037057 Ga0496102_0037057_1249_1836 195
417 3300048911 Ga0496108_0000364 Ga0496108_0000364_1909_2496 195
418 3300048912 Ga0496109_0000083 Ga0496109_0000083_50703_51290 195
419 3300048913 Ga0496110_0000236 Ga0496110_0000236_6086_6673 195
420 3300048914 Ga0496111_0008193 Ga0496111_0008193_3414_4001 195
421 3300048915 Ga0496112_0000033 Ga0496112_0000033_43812_44399 195
422 3300048916 Ga0496113_0004588 Ga0496113_0004588_5973_6560 195
423 3300048917 Ga0496114_0468494 Ga0496114_0468494_273_860 195

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13442

Cytochrome_CBB3

Cytochrome C oxidase, cbb3-type, subunit III

83

165

0.74

PF00034

Cytochrom_C

Cytochrome c

85

169

0.69

Structural Annotation

Top 5 Hits

ID Description Score Start End
6loe-assembly1.cif.gz_E cryo-em structure of the dithionite-reduced photosynthetic alternative complex iii from roseiflexus castenholzii 0.7824 62 157
6lod-assembly1.cif.gz_E cryo-em structure of the air-oxidized photosynthetic alternative complex iii from roseiflexus castenholzii 0.7684 62 157
2gc4-assembly1.cif.gz_D structural comparison of the oxidized ternary electron transfer complex of methylamine dehydrogenase, amicyanin and cytochrome c551i from paracoccus denitrificans with the substrate-reduced, copper free complex at 1.9 a resolution. 0.7489 65 153
5mxy-assembly1.cif.gz_A kustc0563 c-type cytochrome 0.7396 72 153
6tp9-assembly4.cif.gz_K c-type cytochrome nirc 0.7349 112 157
ID Description Score Start End Superfamily
af_P9WP35_148_241_1.10.760.10 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.7282 70 153 1.10.760.10
4eifA00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.7274 72 152 1.10.760.10
1h9yA01 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.706 66 151 1.10.760.10
2zboK00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.6883 70 155 1.10.760.10
2c8sA00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.6877 67 153 1.10.760.10
ID Description Score Start End GO Terms
AF-A0A2V9S9M6-F1-model_v4 Cytochrome c domain-containing protein 0.9225 89 167 GO:0009055
GO:0020037
AF-A0A257UKT7-F1-model_v4 Cytochrome c domain-containing protein 0.9166 44 165 GO:0009055
GO:0020037
GO:0046872
AF-A0A2V5P7I6-F1-model_v4 Cytochrome c domain-containing protein 0.9066 72 165 GO:0009055
GO:0020037
GO:0046872
AF-A0A2V9XRI2-F1-model_v4 Cytochrome c domain-containing protein 0.8835 57 162 GO:0009055
GO:0020037
GO:0046872
AF-T1BQH8-F1-model_v4 Cytochrome C class I protein 0.8792 28 164 GO:0009055
GO:0020037
GO:0046872

Feature Viewer

pLDDT pTM Quality
80.92 0.66 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map