F440299

General Info

Members Datasets Scaffolds Average Seq Length
422 234 844 109

Family's Representative Sequence

Representative Sequence 3300025961|Ga0207712_10200387|Ga0207712_102003872
Length 125
Sequence VSKLPSAARVPSGGDPFEALGDPNRRAIVELLVPGGRSVQEIADALPISRPAVSRHLRLLKQAGLVREEPVGTRRIYRLHDEGIEAVRAYLERVWGEAAARFTLVASNTTPGSGPGRATLLVTRT

Samples

Sample ID Description Type Environment
1 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
59 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
62 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
82 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
95 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
136 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
137 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
138 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
139 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
140 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
141 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
142 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
143 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
144 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
145 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
146 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
147 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
148 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
149 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
150 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
151 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
152 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
153 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
154 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
155 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
156 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
157 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
158 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
159 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
160 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
161 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
162 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
163 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
164 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
165 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
166 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
167 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
168 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
169 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
170 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
171 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
172 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
173 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
174 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
175 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
176 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
177 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
178 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
179 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
180 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
181 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
182 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
183 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
184 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
185 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
186 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
187 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
188 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
189 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
190 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
191 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
192 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
193 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
194 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
195 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
196 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
197 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
198 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
199 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
200 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
201 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
202 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
203 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
204 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
212 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
213 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
214 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
215 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
216 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
217 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
218 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
219 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
220 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
221 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
222 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
223 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
224 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
225 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
226 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
227 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
228 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
229 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
230 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
231 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
232 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
233 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
234 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.71
Nodule 0
Rhizoplane 12.56
Rhizosphere 84.83
Stem 0
Stem Tuber 0
Unclassified 22.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207712_10200387 3300025961 Bacteria 1582
2 JGI25407J50210_10034417 3300003373 Bacteria 1306
3 Ga0070676_10391075 3300005328 Unclassified 965
4 Ga0070683_100152331 3300005329 Bacteria 2192
5 Ga0070683_100389854 3300005329 Bacteria 1328
6 Ga0070683_100665303 3300005329 Bacteria 997
7 Ga0070683_101422170 3300005329 Unclassified 666
8 Ga0070690_101086629 3300005330 Unclassified 634
9 Ga0070680_101158605 3300005336 Bacteria 668
10 Ga0070682_100254082 3300005337 Unclassified 1269
11 Ga0070682_100389094 3300005337 Unclassified 1051
12 Ga0070682_101159911 3300005337 Unclassified 650
13 Ga0068868_100203568 3300005338 Bacteria 1651
14 Ga0068868_100543067 3300005338 Bacteria 1023
15 Ga0068868_101167344 3300005338 Bacteria 711
16 Ga0070660_100149198 3300005339 Bacteria 1879
17 Ga0070660_101261808 3300005339 Bacteria 627
18 Ga0070689_100862850 3300005340 Unclassified 799
19 Ga0070687_100005981 3300005343 Bacteria 4954
20 Ga0070687_100010330 3300005343 Bacteria 4035
21 Ga0070692_10133978 3300005345 Bacteria 1395
22 Ga0070692_10471115 3300005345 Bacteria 808
23 Ga0070668_100793781 3300005347 Bacteria 841
24 Ga0070675_100567903 3300005354 Bacteria 1027
25 Ga0070671_101075448 3300005355 Unclassified 706
26 Ga0070674_101855028 3300005356 Bacteria 547
27 Ga0070688_100228013 3300005365 Bacteria 1316
28 Ga0070659_100102961 3300005366 Bacteria 2299
29 Ga0070659_101089455 3300005366 Bacteria 704
30 Ga0070667_100698058 3300005367 Bacteria 939
31 Ga0070703_10079797 3300005406 Bacteria 1112
32 Ga0070709_10828008 3300005434 Bacteria 728
33 Ga0070710_10787883 3300005437 Bacteria 678
34 Ga0070701_10010828 3300005438 Bacteria 4049
35 Ga0070701_10223099 3300005438 Unclassified 1125
36 Ga0070711_101877079 3300005439 Unclassified 526
37 Ga0070705_100055577 3300005440 Bacteria 2327
38 Ga0070705_100259225 3300005440 Bacteria 1225
39 Ga0070694_100546382 3300005444 Unclassified 927
40 Ga0070694_101036581 3300005444 Bacteria 682
41 Ga0070708_100436013 3300005445 Unclassified 1236
42 Ga0070678_100130858 3300005456 Bacteria 1993
43 Ga0070678_100259860 3300005456 Bacteria 1460
44 Ga0070678_101034313 3300005456 Bacteria 756
45 Ga0070662_100062806 3300005457 Bacteria 2715
46 Ga0070662_100415465 3300005457 Bacteria 1112
47 Ga0068867_100025537 3300005459 Bacteria 4239
48 Ga0068867_100167987 3300005459 Bacteria 1735
49 Ga0070685_10258999 3300005466 Unclassified 1156
50 Ga0070698_100720041 3300005471 Bacteria 940
51 Ga0070699_100804539 3300005518 Bacteria 860
52 Ga0070679_101133495 3300005530 Bacteria 727
53 Ga0070684_100032458 3300005535 Bacteria 4450
54 Ga0070684_100549951 3300005535 Unclassified 1071
55 Ga0070697_100051120 3300005536 Bacteria 3357
56 Ga0070672_101433281 3300005543 Bacteria 618
57 Ga0070686_100028076 3300005544 Bacteria 3410
58 Ga0070686_100129443 3300005544 Bacteria 1743
59 Ga0070686_100682366 3300005544 Bacteria 817
60 Ga0070686_100981408 3300005544 Bacteria 692
61 Ga0070695_100003181 3300005545 Bacteria 9575
62 Ga0070695_100217635 3300005545 Bacteria 1374
63 Ga0070695_100883365 3300005545 Bacteria 721
64 Ga0070696_100017524 3300005546 Bacteria 4835
65 Ga0070696_100206545 3300005546 Bacteria 1468
66 Ga0070696_100593993 3300005546 Bacteria 892
67 Ga0070693_100162966 3300005547 Bacteria 1422
68 Ga0070704_100036566 3300005549 Bacteria 3348
69 Ga0070704_101201550 3300005549 Bacteria 691
70 Ga0070704_101480316 3300005549 Bacteria 624
71 Ga0068855_101776775 3300005563 Bacteria 627
72 Ga0070664_101054038 3300005564 Bacteria 765
73 Ga0070664_101556347 3300005564 Unclassified 626
74 Ga0068857_100863941 3300005577 Unclassified 866
75 Ga0068854_100205100 3300005578 Bacteria 1552
76 Ga0068856_100678358 3300005614 Bacteria 1051
77 Ga0070702_100001294 3300005615 Bacteria 10138
78 Ga0070702_100113006 3300005615 Bacteria 1687
79 Ga0070702_100772578 3300005615 Bacteria 740
80 Ga0068859_100478387 3300005617 Bacteria 1341
81 Ga0068864_100251228 3300005618 Bacteria 1642
82 Ga0068864_100372912 3300005618 Bacteria 1351
83 Ga0068864_100429752 3300005618 Unclassified 1260
84 Ga0068866_10026958 3300005718 Bacteria 2720
85 Ga0068866_11058309 3300005718 Bacteria 579
86 Ga0068861_100113798 3300005719 Bacteria 2171
87 Ga0068861_101105908 3300005719 Bacteria 762
88 Ga0068870_10046274 3300005840 Bacteria 2280
89 Ga0068870_11106291 3300005840 Bacteria 570
90 Ga0068863_100216097 3300005841 Bacteria 1846
91 Ga0068858_100259838 3300005842 Bacteria 1650
92 Ga0068858_100628453 3300005842 Bacteria 1043
93 Ga0068860_100048197 3300005843 Bacteria 4060
94 Ga0068860_101124043 3300005843 Bacteria 805
95 Ga0068860_101504070 3300005843 Bacteria 695
96 Ga0068862_100277684 3300005844 Bacteria 1534
97 Ga0081538_10002488 3300005981 Bacteria 17969
98 Ga0081538_10002643 3300005981 Bacteria 17296
99 Ga0081538_10039191 3300005981 Bacteria 3043
100 Ga0081540_1002827 3300005983 Bacteria 14051
101 Ga0081539_10009417 3300005985 Bacteria 8170
102 Ga0081539_10018254 3300005985 Bacteria 4878
103 Ga0075432_10248206 3300006058 Bacteria 721
104 Ga0070715_10246162 3300006163 Unclassified 932
105 Ga0097621_100126071 3300006237 Bacteria 2175
106 Ga0097621_100797079 3300006237 Unclassified 875
107 Ga0097621_101121857 3300006237 Bacteria 739
108 Ga0068871_101326981 3300006358 Unclassified 677
109 Ga0075428_100247167 3300006844 Bacteria 1923
110 Ga0075433_10550302 3300006852 Bacteria 1014
111 Ga0075434_100160030 3300006871 Bacteria 2271
112 Ga0068865_100028799 3300006881 Bacteria 3679
113 Ga0068865_101406186 3300006881 Unclassified 623
114 Ga0097620_100478381 3300006931 Bacteria 1341
115 Ga0111539_10086298 3300009094 Bacteria 3688
116 Ga0105245_10013793 3300009098 Bacteria 7038
117 Ga0105245_10092056 3300009098 Bacteria 2792
118 Ga0105245_10403391 3300009098 Unclassified 1367
119 Ga0105245_10858700 3300009098 Bacteria 948
120 Ga0105247_10848161 3300009101 Bacteria 701
121 Ga0105243_10033561 3300009148 Bacteria 3969
122 Ga0105243_10201677 3300009148 Bacteria 1745
123 Ga0105243_10350234 3300009148 Bacteria 1356
124 Ga0105243_10447938 3300009148 Bacteria 1211
125 Ga0105243_11845571 3300009148 Bacteria 636
126 Ga0105243_12456704 3300009148 Unclassified 560
127 Ga0105241_10321231 3300009174 Bacteria 1335
128 Ga0105242_10427523 3300009176 Bacteria 1242
129 Ga0105242_10464626 3300009176 Bacteria 1196
130 Ga0105242_11227272 3300009176 Unclassified 770
131 Ga0105248_10115783 3300009177 Bacteria 3023
132 Ga0105248_10286501 3300009177 Bacteria 1855
133 Ga0105238_10091829 3300009551 Bacteria 3023
134 Ga0105238_11110188 3300009551 Unclassified 814
135 Ga0105249_10132155 3300009553 Bacteria 2384
136 Ga0105249_10515170 3300009553 Bacteria 1243
137 Ga0105249_11583272 3300009553 Unclassified 728
138 Ga0105239_10672298 3300010375 Unclassified 1183
139 Ga0105239_12685602 3300010375 Bacteria 581
140 Ga0105246_10574190 3300011119 Unclassified 970
141 Ga0157342_1025533 3300012507 Bacteria 714
142 Ga0157338_1050877 3300012515 Bacteria 594
143 Ga0157374_10741716 3300013296 Unclassified 996
144 Ga0157374_11949404 3300013296 Bacteria 613
145 Ga0157378_10040071 3300013297 Bacteria 4154
146 Ga0157378_10645640 3300013297 Bacteria 1073
147 Ga0157378_11495117 3300013297 Bacteria 720
148 Ga0163162_10414182 3300013306 Unclassified 1480
149 Ga0163162_11200900 3300013306 Bacteria 861
150 Ga0157375_10271998 3300013308 Bacteria 1856
151 Ga0157375_10411485 3300013308 Bacteria 1519
152 Ga0157375_11545836 3300013308 Unclassified 784
153 Ga0163163_10250918 3300014325 Bacteria 1820
154 Ga0163163_10539580 3300014325 Bacteria 1229
155 Ga0157380_10016188 3300014326 Bacteria 5494
156 Ga0157380_11431645 3300014326 Bacteria 742
157 Ga0182008_10037772 3300014497 Bacteria 2415
158 Ga0157377_10013976 3300014745 Bacteria 4077
159 Ga0157379_10049856 3300014968 Bacteria 3738
160 Ga0157379_10198904 3300014968 Bacteria 1812
161 Ga0157379_11137106 3300014968 Bacteria 749
162 Ga0157376_10631195 3300014969 Bacteria 1070
163 Ga0163161_10203178 3300017792 Bacteria 1528
164 Ga0163161_10911303 3300017792 Bacteria 745
165 Ga0213875_10083722 3300021388 Bacteria 1488
166 Ga0207653_10027007 3300025885 Bacteria 1842
167 Ga0207642_10187127 3300025899 Unclassified 1133
168 Ga0207642_10633448 3300025899 Bacteria 668
169 Ga0207643_10255570 3300025908 Bacteria 1080
170 Ga0207684_10692069 3300025910 Unclassified 867
171 Ga0207693_10496336 3300025915 Bacteria 953
172 Ga0207663_10315700 3300025916 Bacteria 1173
173 Ga0207663_11337819 3300025916 Unclassified 577
174 Ga0207662_10023806 3300025918 Bacteria 3521
175 Ga0207657_10038508 3300025919 Bacteria 4256
176 Ga0207657_10746534 3300025919 Unclassified 758
177 Ga0207646_11399349 3300025922 Bacteria 608
178 Ga0207650_10760256 3300025925 Bacteria 820
179 Ga0207659_10180376 3300025926 Bacteria 1673
180 Ga0207687_10032216 3300025927 Bacteria 3549
181 Ga0207687_10132521 3300025927 Bacteria 1881
182 Ga0207687_10380032 3300025927 Unclassified 1157
183 Ga0207700_11423108 3300025928 Bacteria 616
184 Ga0207690_10664548 3300025932 Bacteria 855
185 Ga0207706_10738190 3300025933 Bacteria 839
186 Ga0207706_10787572 3300025933 Bacteria 808
187 Ga0207686_10487297 3300025934 Bacteria 954
188 Ga0207686_10660198 3300025934 Bacteria 828
189 Ga0207709_10618281 3300025935 Bacteria 859
190 Ga0207709_11494900 3300025935 Unclassified 560
191 Ga0207670_11035527 3300025936 Unclassified 691
192 Ga0207704_10159135 3300025938 Bacteria 1605
193 Ga0207665_11216522 3300025939 Unclassified 601
194 Ga0207711_10721736 3300025941 Unclassified 929
195 Ga0207661_10141488 3300025944 Bacteria 2071
196 Ga0207661_10589767 3300025944 Unclassified 1020
197 Ga0207661_10932246 3300025944 Unclassified 800
198 Ga0207679_10113924 3300025945 Unclassified 2140
199 Ga0207679_10886369 3300025945 Bacteria 816
200 Ga0207712_10357959 3300025961 Unclassified 1215
201 Ga0207712_11332290 3300025961 Bacteria 642
202 Ga0207668_11342086 3300025972 Unclassified 644
203 Ga0207640_10366216 3300025981 Bacteria 1163
204 Ga0207640_10953823 3300025981 Unclassified 752
205 Ga0207658_11895751 3300025986 Bacteria 543
206 Ga0207677_10432826 3300026023 Bacteria 1123
207 Ga0207677_10960622 3300026023 Bacteria 773
208 Ga0207703_10692766 3300026035 Bacteria 969
209 Ga0207703_11088859 3300026035 Bacteria 767
210 Ga0207639_11043047 3300026041 Unclassified 766
211 Ga0207678_10177881 3300026067 Bacteria 1817
212 Ga0207708_10384806 3300026075 Bacteria 1157
213 Ga0207702_10680756 3300026078 Unclassified 1013
214 Ga0207641_11034091 3300026088 Unclassified 819
215 Ga0207648_10002384 3300026089 Bacteria 20232
216 Ga0207648_10149143 3300026089 Bacteria 2063
217 Ga0207676_10022616 3300026095 Bacteria 4625
218 Ga0207676_10229049 3300026095 Bacteria 1660
219 Ga0207676_10648744 3300026095 Unclassified 1018
220 Ga0207674_11891941 3300026116 Unclassified 563
221 Ga0207675_100345322 3300026118 Bacteria 1457
222 Ga0207683_10666858 3300026121 Bacteria 964
223 Ga0207428_10227570 3300027907 Bacteria 1396
224 Ga0268264_10854602 3300028381 Unclassified 911
225 Ga0265318_10095504 3300028577 Unclassified 1094
226 Ga0307513_10062577 3300031456 Bacteria 3932
227 Ga0307408_102194017 3300031548 Bacteria 534
228 Ga0307410_10067712 3300031852 Bacteria 2464
229 Ga0307410_10212263 3300031852 Bacteria 1484
230 Ga0307406_10094624 3300031901 Bacteria 2020
231 Ga0307406_10839899 3300031901 Bacteria 778
232 Ga0307406_10938423 3300031901 Bacteria 739
233 Ga0307406_11573489 3300031901 Bacteria 580
234 Ga0307407_10081242 3300031903 Bacteria 1961
235 Ga0307407_10105356 3300031903 Bacteria 1759
236 Ga0307407_10383634 3300031903 Bacteria 1004
237 Ga0307407_10620426 3300031903 Bacteria 807
238 Ga0307412_10521640 3300031911 Bacteria 993
239 Ga0307412_11117196 3300031911 Bacteria 702
240 Ga0307412_12074160 3300031911 Bacteria 527
241 Ga0307409_100005081 3300031995 Bacteria 7504
242 Ga0307409_100220976 3300031995 Bacteria 1710
243 Ga0307409_100499248 3300031995 Bacteria 1184
244 Ga0307409_102491834 3300031995 Bacteria 546
245 Ga0307416_100015135 3300032002 Bacteria 5314
246 Ga0307416_100643249 3300032002 Bacteria 1144
247 Ga0307416_102231567 3300032002 Bacteria 648
248 Ga0307414_10570543 3300032004 Bacteria 1011
249 Ga0307411_10400294 3300032005 Bacteria 1135
250 Ga0307411_11367700 3300032005 Bacteria 647
251 Ga0307415_100004231 3300032126 Bacteria 7419
252 Ga0307415_100197428 3300032126 Bacteria 1593
253 Ga0307415_100876438 3300032126 Bacteria 826
254 Ga0307415_101269283 3300032126 Bacteria 696
255 Ga0373941_0151994 3300035115 Bacteria 850
256 Ga0373942_0140170 3300035207 Bacteria 769
257 Ga0373961_0191451 3300035241 Bacteria 717
258 Ga0373962_0059961 3300035242 Bacteria 1115
259 Ga0373931_0062419 3300035691 Bacteria 2012
260 Ga0373931_0079112 3300035691 Bacteria 1810
261 Ga0373933_0192855 3300035724 Bacteria 1302
262 Ga0373933_0247566 3300035724 Unclassified 1147
263 Ga0436364_0304945 3300037853 Unclassified 592
264 Ga0436364_0948634 3300037853 Bacteria 2140
265 Ga0436365_0028854 3300039437 Unclassified 666
266 Ga0436363_0791901 3300039450 Bacteria 619
267 Ga0451853_0315734 3300041512 Bacteria 724
268 Ga0451853_1311589 3300041512 Unclassified 564
269 Ga0450916_062333 3300042530 Bacteria 608
270 Ga0466967_1017839 3300045976 Bacteria 825
271 Ga0495592_0553789 3300046454 Bacteria 707
272 Ga0495603_0599811 3300046455 Bacteria 630
273 Ga0495603_0735764 3300046455 Archaea 564
274 Ga0495629_0089088 3300046459 Unclassified 2153
275 Ga0495629_0322609 3300046459 Bacteria 1056
276 Ga0495641_0228861 3300046461 Bacteria 834
277 Ga0495641_0546256 3300046461 Bacteria 529
278 Ga0495651_0133659 3300046462 Bacteria 1808
279 Ga0495653_0061138 3300046463 Unclassified 2851
280 Ga0495653_0180494 3300046463 Unclassified 1449
281 Ga0495653_0383051 3300046463 Unclassified 898
282 Ga0495662_0534098 3300046476 Bacteria 575
283 Ga0495664_0201286 3300046477 Bacteria 1206
284 Ga0495608_0005606 3300046511 Bacteria 8970
285 Ga0495608_0272356 3300046511 Bacteria 1052
286 Ga0495618_0334472 3300046514 Bacteria 936
287 Ga0495618_0388948 3300046514 Bacteria 855
288 Ga0495618_0473673 3300046514 Bacteria 758
289 Ga0495630_0221725 3300046517 Bacteria 1444
290 Ga0495630_0434175 3300046517 Bacteria 1006
291 Ga0495630_0579961 3300046517 Bacteria 860
292 Ga0495630_1202898 3300046517 Unclassified 573
293 Ga0495652_0261279 3300046529 Bacteria 1278
294 Ga0495652_0268352 3300046529 Bacteria 1256
295 Ga0495586_0237185 3300046535 Bacteria 1039
296 Ga0495587_0841521 3300046536 Unclassified 500
297 Ga0495667_0553409 3300046559 Unclassified 719
298 Ga0495635_0417728 3300046663 Bacteria 889
299 Ga0495635_0682931 3300046663 Bacteria 667
300 Ga0495657_0037188 3300046675 Unclassified 3357
301 Ga0495657_0318406 3300046675 Bacteria 925
302 Ga0495599_0715740 3300046678 Bacteria 576
303 Ga0495599_0718566 3300046678 Unclassified 575
304 Ga0495658_1049805 3300046683 Bacteria 520
305 Ga0495613_0204943 3300046689 Bacteria 1389
306 Ga0495613_1115311 3300046689 Unclassified 503
307 Ga0495600_0079237 3300046809 Bacteria 2145
308 Ga0495600_0133102 3300046809 Bacteria 1616
309 Ga0495581_0624141 3300047315 Unclassified 624
310 Ga0495604_0471025 3300047317 Bacteria 818
311 Ga0495604_0977485 3300047317 Bacteria 525
312 Ga0495674_0474457 3300047319 Bacteria 1003
313 Ga0495676_0164633 3300047321 Bacteria 1566
314 Ga0495680_0401816 3300047322 Bacteria 946
315 Ga0495680_0426905 3300047322 Bacteria 911
316 Ga0495680_1038053 3300047322 Bacteria 521
317 Ga0495684_0606159 3300047471 Bacteria 738
318 Ga0495602_0161959 3300048088 Bacteria 1746
319 Ga0496100_0365483 3300048903 Unclassified 1093
320 Ga0496100_1054150 3300048903 Bacteria 640
321 Ga0496100_1133515 3300048903 Unclassified 617
322 Ga0496101_0098751 3300048904 Bacteria 2182
323 Ga0496101_0114024 3300048904 Bacteria 2037
324 Ga0496102_0004646 3300048905 Bacteria 11623
325 Ga0496102_0446096 3300048905 Bacteria 1214
326 Ga0496102_0674496 3300048905 Unclassified 957
327 Ga0496103_0010329 3300048906 Bacteria 5524
328 Ga0496103_0406793 3300048906 Bacteria 874
329 Ga0496104_0066605 3300048907 Bacteria 3419
330 Ga0496104_0246864 3300048907 Bacteria 1698
331 Ga0496105_0110369 3300048908 Bacteria 2270
332 Ga0496105_0134308 3300048908 Bacteria 2039
333 Ga0496105_0377955 3300048908 Bacteria 1128
334 Ga0496105_0645414 3300048908 Bacteria 817
335 Ga0496106_0108303 3300048909 Bacteria 2161
336 Ga0496106_0392485 3300048909 Unclassified 1115
337 Ga0496106_1268742 3300048909 Bacteria 573
338 Ga0496107_0015024 3300048910 Bacteria 5424
339 Ga0496107_0112780 3300048910 Bacteria 1999
340 Ga0496107_0253952 3300048910 Bacteria 1308
341 Ga0496107_0423868 3300048910 Unclassified 989
342 Ga0496108_0026969 3300048911 Bacteria 4741
343 Ga0496108_0046531 3300048911 Bacteria 3625
344 Ga0496108_0872057 3300048911 Bacteria 774
345 Ga0496108_1589689 3300048911 Unclassified 541
346 Ga0496109_0023707 3300048912 Bacteria 5447
347 Ga0496109_0043588 3300048912 Bacteria 4067
348 Ga0496109_0447511 3300048912 Bacteria 1220
349 Ga0496109_0455880 3300048912 Bacteria 1208
350 Ga0496109_0670302 3300048912 Unclassified 974
351 Ga0496109_0899480 3300048912 Unclassified 823
352 Ga0496109_1699427 3300048912 Unclassified 565
353 Ga0496109_2067036 3300048912 Unclassified 501
354 Ga0496110_0031283 3300048913 Bacteria 4591
355 Ga0496110_0272784 3300048913 Bacteria 1540
356 Ga0496110_0760665 3300048913 Bacteria 872
357 Ga0496110_1043477 3300048913 Unclassified 725
358 Ga0496111_0002073 3300048914 Bacteria 11948
359 Ga0496111_0264251 3300048914 Bacteria 1277
360 Ga0496111_0742536 3300048914 Unclassified 712
361 Ga0496111_0984966 3300048914 Unclassified 605
362 Ga0496112_0026120 3300048915 Bacteria 5614
363 Ga0496112_0877103 3300048915 Bacteria 820
364 Ga0496112_1367075 3300048915 Unclassified 623
365 Ga0496113_0062950 3300048916 Bacteria 2803
366 Ga0496113_0370450 3300048916 Bacteria 1149
367 Ga0496113_0732168 3300048916 Bacteria 788
368 Ga0496113_0812153 3300048916 Bacteria 743
369 Ga0496114_0347652 3300048917 Bacteria 1311
370 Ga0496114_1148172 3300048917 Unclassified 662
371 Ga0496115_0023714 3300048918 Bacteria 4762
372 Ga0501292_094641 3300049515 Bacteria 585
373 Ga0501031_0040033 3300049568 Bacteria 3060
374 Ga0501036_0178098 3300049572 Bacteria 1790
375 Ga0501038_0603433 3300049574 Bacteria 830
376 Ga0501039_0426286 3300049575 Unclassified 1042
377 Ga0501039_1015139 3300049575 Bacteria 644
378 Ga0501040_0176809 3300049576 Bacteria 1512
379 Ga0501040_0274479 3300049576 Unclassified 1204
380 Ga0501042_0121894 3300049578 Bacteria 1877
381 Ga0501048_1363019 3300049582 Bacteria 510
382 Ga0501067_0142773 3300049583 Bacteria 1334
383 Ga0501068_0567273 3300049584 Bacteria 739
384 Ga0501071_1149980 3300049587 Bacteria 600
385 Ga0501075_0136658 3300049591 Bacteria 1867
386 Ga0501075_0668544 3300049591 Unclassified 792
387 Ga0501075_1186983 3300049591 Unclassified 579
388 Ga0501077_0656021 3300049593 Unclassified 674
389 Ga0501207_115619 3300049654 Bacteria 552
390 Ga0501233_091757 3300049668 Bacteria 794
391 Ga0501081_0645149 3300049743 Bacteria 794
392 Ga0501035_0176664 3300049822 Bacteria 1842
393 Ga0501035_1051081 3300049822 Unclassified 638
394 nmdc:mga05p37_2245234_c1 3300050507 Unclassified 505
395 nmdc:mga08y16_409629_c1 3300050511 Bacteria 1387
396 nmdc:mga0rr50_915687_c1 3300050513 Bacteria 747
397 nmdc:mga08x19_1213975_c1 3300050514 Bacteria 535
398 nmdc:mga08x19_949159_c1 3300050514 Unclassified 611
399 nmdc:mga0a205_217507_c1 3300050515 Bacteria 1797
400 nmdc:mga0a205_334414_c1 3300050515 Bacteria 1384
401 nmdc:mga0a205_418902_c1 3300050515 Bacteria 1201
402 Ga0495601_0028881 3300053077 Bacteria 3438
403 Ga0495601_0108500 3300053077 Bacteria 1796
404 Ga0495601_0173607 3300053077 Bacteria 1409
405 Ga0495612_0353437 3300053078 Bacteria 664
406 Ga0500635_0039841 3300053080 Bacteria 1565
407 Ga0495595_0018583 3300053084 Bacteria 3006
408 Ga0495595_0022892 3300053084 Bacteria 2747
409 Ga0495595_0124411 3300053084 Bacteria 1258
410 Ga0495595_0161634 3300053084 Unclassified 1105
411 Ga0495619_0022995 3300053085 Unclassified 3992
412 Ga0495619_0069757 3300053085 Bacteria 2350
413 Ga0495619_0224336 3300053085 Bacteria 1302
414 Ga0495619_0230919 3300053085 Bacteria 1282
415 Ga0495619_0232968 3300053085 Bacteria 1276
416 Ga0495619_0482323 3300053085 Unclassified 853
417 Ga0500651_0000214 3300053093 Bacteria 36274
418 Ga0500652_005429 3300053131 Bacteria 4012
419 Ga0501084_0014163 3300054114 Bacteria 6604
420 Ga0501084_1878675 3300054114 Bacteria 500
421 Ga0501082_1412777 3300060353 Bacteria 608
422 Ga0530510_0810980 3300061734 Bacteria 714
423 Ga0207712_10200387
424 JGI25407J50210_10034417
425 Ga0070676_10391075
426 Ga0070683_100152331
427 Ga0070683_100389854
428 Ga0070683_100665303
429 Ga0070683_101422170
430 Ga0070690_101086629
431 Ga0070680_101158605
432 Ga0070682_100254082
433 Ga0070682_100389094
434 Ga0070682_101159911
435 Ga0068868_100203568
436 Ga0068868_100543067
437 Ga0068868_101167344
438 Ga0070660_100149198
439 Ga0070660_101261808
440 Ga0070689_100862850
441 Ga0070687_100005981
442 Ga0070687_100010330
443 Ga0070692_10133978
444 Ga0070692_10471115
445 Ga0070668_100793781
446 Ga0070675_100567903
447 Ga0070671_101075448
448 Ga0070674_101855028
449 Ga0070688_100228013
450 Ga0070659_100102961
451 Ga0070659_101089455
452 Ga0070667_100698058
453 Ga0070703_10079797
454 Ga0070709_10828008
455 Ga0070710_10787883
456 Ga0070701_10010828
457 Ga0070701_10223099
458 Ga0070711_101877079
459 Ga0070705_100055577
460 Ga0070705_100259225
461 Ga0070694_100546382
462 Ga0070694_101036581
463 Ga0070708_100436013
464 Ga0070678_100130858
465 Ga0070678_100259860
466 Ga0070678_101034313
467 Ga0070662_100062806
468 Ga0070662_100415465
469 Ga0068867_100025537
470 Ga0068867_100167987
471 Ga0070685_10258999
472 Ga0070698_100720041
473 Ga0070699_100804539
474 Ga0070679_101133495
475 Ga0070684_100032458
476 Ga0070684_100549951
477 Ga0070697_100051120
478 Ga0070672_101433281
479 Ga0070686_100028076
480 Ga0070686_100129443
481 Ga0070686_100682366
482 Ga0070686_100981408
483 Ga0070695_100003181
484 Ga0070695_100217635
485 Ga0070695_100883365
486 Ga0070696_100017524
487 Ga0070696_100206545
488 Ga0070696_100593993
489 Ga0070693_100162966
490 Ga0070704_100036566
491 Ga0070704_101201550
492 Ga0070704_101480316
493 Ga0068855_101776775
494 Ga0070664_101054038
495 Ga0070664_101556347
496 Ga0068857_100863941
497 Ga0068854_100205100
498 Ga0068856_100678358
499 Ga0070702_100001294
500 Ga0070702_100113006
501 Ga0070702_100772578
502 Ga0068859_100478387
503 Ga0068864_100251228
504 Ga0068864_100372912
505 Ga0068864_100429752
506 Ga0068866_10026958
507 Ga0068866_11058309
508 Ga0068861_100113798
509 Ga0068861_101105908
510 Ga0068870_10046274
511 Ga0068870_11106291
512 Ga0068863_100216097
513 Ga0068858_100259838
514 Ga0068858_100628453
515 Ga0068860_100048197
516 Ga0068860_101124043
517 Ga0068860_101504070
518 Ga0068862_100277684
519 Ga0081538_10002488
520 Ga0081538_10002643
521 Ga0081538_10039191
522 Ga0081540_1002827
523 Ga0081539_10009417
524 Ga0081539_10018254
525 Ga0075432_10248206
526 Ga0070715_10246162
527 Ga0097621_100126071
528 Ga0097621_100797079
529 Ga0097621_101121857
530 Ga0068871_101326981
531 Ga0075428_100247167
532 Ga0075433_10550302
533 Ga0075434_100160030
534 Ga0068865_100028799
535 Ga0068865_101406186
536 Ga0097620_100478381
537 Ga0111539_10086298
538 Ga0105245_10013793
539 Ga0105245_10092056
540 Ga0105245_10403391
541 Ga0105245_10858700
542 Ga0105247_10848161
543 Ga0105243_10033561
544 Ga0105243_10201677
545 Ga0105243_10350234
546 Ga0105243_10447938
547 Ga0105243_11845571
548 Ga0105243_12456704
549 Ga0105241_10321231
550 Ga0105242_10427523
551 Ga0105242_10464626
552 Ga0105242_11227272
553 Ga0105248_10115783
554 Ga0105248_10286501
555 Ga0105238_10091829
556 Ga0105238_11110188
557 Ga0105249_10132155
558 Ga0105249_10515170
559 Ga0105249_11583272
560 Ga0105239_10672298
561 Ga0105239_12685602
562 Ga0105246_10574190
563 Ga0157342_1025533
564 Ga0157338_1050877
565 Ga0157374_10741716
566 Ga0157374_11949404
567 Ga0157378_10040071
568 Ga0157378_10645640
569 Ga0157378_11495117
570 Ga0163162_10414182
571 Ga0163162_11200900
572 Ga0157375_10271998
573 Ga0157375_10411485
574 Ga0157375_11545836
575 Ga0163163_10250918
576 Ga0163163_10539580
577 Ga0157380_10016188
578 Ga0157380_11431645
579 Ga0182008_10037772
580 Ga0157377_10013976
581 Ga0157379_10049856
582 Ga0157379_10198904
583 Ga0157379_11137106
584 Ga0157376_10631195
585 Ga0163161_10203178
586 Ga0163161_10911303
587 Ga0213875_10083722
588 Ga0207653_10027007
589 Ga0207642_10187127
590 Ga0207642_10633448
591 Ga0207643_10255570
592 Ga0207684_10692069
593 Ga0207693_10496336
594 Ga0207663_10315700
595 Ga0207663_11337819
596 Ga0207662_10023806
597 Ga0207657_10038508
598 Ga0207657_10746534
599 Ga0207646_11399349
600 Ga0207650_10760256
601 Ga0207659_10180376
602 Ga0207687_10032216
603 Ga0207687_10132521
604 Ga0207687_10380032
605 Ga0207700_11423108
606 Ga0207690_10664548
607 Ga0207706_10738190
608 Ga0207706_10787572
609 Ga0207686_10487297
610 Ga0207686_10660198
611 Ga0207709_10618281
612 Ga0207709_11494900
613 Ga0207670_11035527
614 Ga0207704_10159135
615 Ga0207665_11216522
616 Ga0207711_10721736
617 Ga0207661_10141488
618 Ga0207661_10589767
619 Ga0207661_10932246
620 Ga0207679_10113924
621 Ga0207679_10886369
622 Ga0207712_10357959
623 Ga0207712_11332290
624 Ga0207668_11342086
625 Ga0207640_10366216
626 Ga0207640_10953823
627 Ga0207658_11895751
628 Ga0207677_10432826
629 Ga0207677_10960622
630 Ga0207703_10692766
631 Ga0207703_11088859
632 Ga0207639_11043047
633 Ga0207678_10177881
634 Ga0207708_10384806
635 Ga0207702_10680756
636 Ga0207641_11034091
637 Ga0207648_10002384
638 Ga0207648_10149143
639 Ga0207676_10022616
640 Ga0207676_10229049
641 Ga0207676_10648744
642 Ga0207674_11891941
643 Ga0207675_100345322
644 Ga0207683_10666858
645 Ga0207428_10227570
646 Ga0268264_10854602
647 Ga0265318_10095504
648 Ga0307513_10062577
649 Ga0307408_102194017
650 Ga0307410_10067712
651 Ga0307410_10212263
652 Ga0307406_10094624
653 Ga0307406_10839899
654 Ga0307406_10938423
655 Ga0307406_11573489
656 Ga0307407_10081242
657 Ga0307407_10105356
658 Ga0307407_10383634
659 Ga0307407_10620426
660 Ga0307412_10521640
661 Ga0307412_11117196
662 Ga0307412_12074160
663 Ga0307409_100005081
664 Ga0307409_100220976
665 Ga0307409_100499248
666 Ga0307409_102491834
667 Ga0307416_100015135
668 Ga0307416_100643249
669 Ga0307416_102231567
670 Ga0307414_10570543
671 Ga0307411_10400294
672 Ga0307411_11367700
673 Ga0307415_100004231
674 Ga0307415_100197428
675 Ga0307415_100876438
676 Ga0307415_101269283
677 Ga0373941_0151994
678 Ga0373942_0140170
679 Ga0373961_0191451
680 Ga0373962_0059961
681 Ga0373931_0062419
682 Ga0373931_0079112
683 Ga0373933_0192855
684 Ga0373933_0247566
685 Ga0436364_0304945
686 Ga0436364_0948634
687 Ga0436365_0028854
688 Ga0436363_0791901
689 Ga0451853_0315734
690 Ga0451853_1311589
691 Ga0450916_062333
692 Ga0466967_1017839
693 Ga0495592_0553789
694 Ga0495603_0599811
695 Ga0495603_0735764
696 Ga0495629_0089088
697 Ga0495629_0322609
698 Ga0495641_0228861
699 Ga0495641_0546256
700 Ga0495651_0133659
701 Ga0495653_0061138
702 Ga0495653_0180494
703 Ga0495653_0383051
704 Ga0495662_0534098
705 Ga0495664_0201286
706 Ga0495608_0005606
707 Ga0495608_0272356
708 Ga0495618_0334472
709 Ga0495618_0388948
710 Ga0495618_0473673
711 Ga0495630_0221725
712 Ga0495630_0434175
713 Ga0495630_0579961
714 Ga0495630_1202898
715 Ga0495652_0261279
716 Ga0495652_0268352
717 Ga0495586_0237185
718 Ga0495587_0841521
719 Ga0495667_0553409
720 Ga0495635_0417728
721 Ga0495635_0682931
722 Ga0495657_0037188
723 Ga0495657_0318406
724 Ga0495599_0715740
725 Ga0495599_0718566
726 Ga0495658_1049805
727 Ga0495613_0204943
728 Ga0495613_1115311
729 Ga0495600_0079237
730 Ga0495600_0133102
731 Ga0495581_0624141
732 Ga0495604_0471025
733 Ga0495604_0977485
734 Ga0495674_0474457
735 Ga0495676_0164633
736 Ga0495680_0401816
737 Ga0495680_0426905
738 Ga0495680_1038053
739 Ga0495684_0606159
740 Ga0495602_0161959
741 Ga0496100_0365483
742 Ga0496100_1054150
743 Ga0496100_1133515
744 Ga0496101_0098751
745 Ga0496101_0114024
746 Ga0496102_0004646
747 Ga0496102_0446096
748 Ga0496102_0674496
749 Ga0496103_0010329
750 Ga0496103_0406793
751 Ga0496104_0066605
752 Ga0496104_0246864
753 Ga0496105_0110369
754 Ga0496105_0134308
755 Ga0496105_0377955
756 Ga0496105_0645414
757 Ga0496106_0108303
758 Ga0496106_0392485
759 Ga0496106_1268742
760 Ga0496107_0015024
761 Ga0496107_0112780
762 Ga0496107_0253952
763 Ga0496107_0423868
764 Ga0496108_0026969
765 Ga0496108_0046531
766 Ga0496108_0872057
767 Ga0496108_1589689
768 Ga0496109_0023707
769 Ga0496109_0043588
770 Ga0496109_0447511
771 Ga0496109_0455880
772 Ga0496109_0670302
773 Ga0496109_0899480
774 Ga0496109_1699427
775 Ga0496109_2067036
776 Ga0496110_0031283
777 Ga0496110_0272784
778 Ga0496110_0760665
779 Ga0496110_1043477
780 Ga0496111_0002073
781 Ga0496111_0264251
782 Ga0496111_0742536
783 Ga0496111_0984966
784 Ga0496112_0026120
785 Ga0496112_0877103
786 Ga0496112_1367075
787 Ga0496113_0062950
788 Ga0496113_0370450
789 Ga0496113_0732168
790 Ga0496113_0812153
791 Ga0496114_0347652
792 Ga0496114_1148172
793 Ga0496115_0023714
794 Ga0501292_094641
795 Ga0501031_0040033
796 Ga0501036_0178098
797 Ga0501038_0603433
798 Ga0501039_0426286
799 Ga0501039_1015139
800 Ga0501040_0176809
801 Ga0501040_0274479
802 Ga0501042_0121894
803 Ga0501048_1363019
804 Ga0501067_0142773
805 Ga0501068_0567273
806 Ga0501071_1149980
807 Ga0501075_0136658
808 Ga0501075_0668544
809 Ga0501075_1186983
810 Ga0501077_0656021
811 Ga0501207_115619
812 Ga0501233_091757
813 Ga0501081_0645149
814 Ga0501035_0176664
815 Ga0501035_1051081
816 nmdc:mga05p37_2245234_c1
817 nmdc:mga08y16_409629_c1
818 nmdc:mga0rr50_915687_c1
819 nmdc:mga08x19_1213975_c1
820 nmdc:mga08x19_949159_c1
821 nmdc:mga0a205_217507_c1
822 nmdc:mga0a205_334414_c1
823 nmdc:mga0a205_418902_c1
824 Ga0495601_0028881
825 Ga0495601_0108500
826 Ga0495601_0173607
827 Ga0495612_0353437
828 Ga0500635_0039841
829 Ga0495595_0018583
830 Ga0495595_0022892
831 Ga0495595_0124411
832 Ga0495595_0161634
833 Ga0495619_0022995
834 Ga0495619_0069757
835 Ga0495619_0224336
836 Ga0495619_0230919
837 Ga0495619_0232968
838 Ga0495619_0482323
839 Ga0500651_0000214
840 Ga0500652_005429
841 Ga0501084_0014163
842 Ga0501084_1878675
843 Ga0501082_1412777
844 Ga0530510_0810980

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01022

HTH_5

Bacterial regulatory protein, arsR family

22

68

0.98

PF12840

HTH_20

Helix-turn-helix domain

20

69

0.97

PF01978

TrmB

Sugar-specific transcriptional regulator TrmB

24

82

0.9

PF13412

HTH_24

Winged helix-turn-helix DNA-binding

22

67

0.86

PF09339

HTH_IclR

IclR helix-turn-helix domain

27

70

0.85

PF12802

MarR_2

MarR family

26

76

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
2p4w-assembly1.cif.gz_A crystal structure of heat shock regulator from pyrococcus furiosus 0.9722 11 73
4lb5-assembly1.cif.gz_A-2 crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.9448 19 73
6j0e-assembly1.cif.gz_B structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression 0.9419 11 82
4awx-assembly1.cif.gz_B moonlighting functions of feoc in the regulation of ferrous iron transport in feo 0.937 19 74
4lb5-assembly1.cif.gz_B crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.9234 22 73
ID Description Score Start End Superfamily
2p4wB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9728 11 73 1.10.10.10
af_Q58793_322_389_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9721 14 76 1.10.10.10
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9639 16 72 1.10.10.10
af_I6Y1A7_25_116_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9474 10 85 1.10.10.10
af_Q58793_245_317_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9449 9 75 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A0H5CYU2-F1-model_v4 Transcriptional regulator, ArsR family 0.9888 11 91 GO:0003700
AF-K2AR67-F1-model_v4 HTH arsR-type domain-containing protein 0.9832 10 88 GO:0003700
AF-A0A1Y4RKQ4-F1-model_v4 HTH arsR-type domain-containing protein 0.9813 11 91 GO:0003700
AF-A0A0R2IM56-F1-model_v4 deleted 0.9789 11 88
AF-A0A4Q1B365-F1-model_v4 ArsR family transcriptional regulator 0.9781 11 89 GO:0003677
GO:0003700
GO:0046686

Map