F440296

General Info

Members Datasets Scaffolds Average Seq Length
422 215 844 344

Family's Representative Sequence

Representative Sequence 3300025941|Ga0207711_10314641|Ga0207711_103146411
Length 379
Sequence MSGRAHTKNTPTTVSWGIHTRHDDTPRQSTQPAEPPRLTAALGSVTLAPAIAQTPATPAQISPVPTPRDWSRPEPVQYPDPDIIALDPRFRRYIVGNTVIRRLHIGTLWAEGPAWNGVGRYLVWSDIPNNVQMRWIEEDGRVTVFRNPSGYSNGNTFDYEGRQLSCEHGGRRVVRYETNGTVTVIAEKFQGKRLSSPNDIVVHPDGGIWFTDPTYGINGNYEGFKGEKELKEAVYRADPKTGQLDKVTDDVGGPNGICFSPDYKKLYVADTGMPRDIKVWDVDGKAIRNGKRLVQLDIPGTGAPSAADGIRCDVDGNIWAGARPGVQIVAPTGERIGMIRLPETCANVCFGGLRRNRLFMAASQSLYVVYVETTGAHIA

Samples

Sample ID Description Type Environment
1 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
56 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
93 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
94 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
134 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
138 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
139 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
140 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
141 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
142 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
143 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
144 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
145 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
146 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
147 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
148 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
149 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
150 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
151 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
152 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
153 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
154 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
155 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
156 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
157 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
158 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
159 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
160 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
161 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
162 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
163 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
164 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
165 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
166 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
167 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
168 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
169 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
170 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
171 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
172 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
173 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
174 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
175 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
176 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
177 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
178 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
179 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
180 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
181 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
182 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
191 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
192 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
193 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
194 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
195 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
196 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
197 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
198 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
200 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
201 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
202 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
203 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
204 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
205 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
206 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
207 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
208 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
209 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
210 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
211 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
212 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
213 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
214 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
215 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.47
Nodule 0
Rhizoplane 1.66
Rhizosphere 95.97
Stem 0
Stem Tuber 0
Unclassified 5.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207711_10314641 3300025941 Bacteria 1446
2 Ga0065712_10001835 3300005290 Bacteria 8344
3 Ga0065712_10089113 3300005290 Unclassified 2486
4 Ga0065715_10133808 3300005293 Bacteria 1948
5 Ga0065707_10092578 3300005295 Bacteria 3741
6 Ga0070658_10011057 3300005327 Bacteria 7235
7 Ga0070676_10218291 3300005328 Bacteria 1258
8 Ga0070690_100015845 3300005330 Unclassified 4504
9 Ga0070670_100007925 3300005331 Bacteria 9038
10 Ga0070670_100069224 3300005331 Bacteria 3029
11 Ga0070670_100095786 3300005331 Bacteria 2553
12 Ga0070670_100459704 3300005331 Bacteria 1129
13 Ga0070677_10002144 3300005333 Bacteria 6303
14 Ga0068869_100010340 3300005334 Bacteria 6084
15 Ga0068869_100099551 3300005334 Bacteria 2197
16 Ga0068869_100105364 3300005334 Bacteria 2138
17 Ga0070666_10015355 3300005335 Bacteria 4883
18 Ga0068868_100087192 3300005338 Bacteria 2510
19 Ga0070660_100061574 3300005339 Bacteria 2914
20 Ga0070689_100112127 3300005340 Bacteria 2170
21 Ga0070687_100129748 3300005343 Unclassified 1454
22 Ga0070669_100005946 3300005353 Bacteria 8803
23 Ga0070669_100054616 3300005353 Bacteria 2926
24 Ga0070669_100109083 3300005353 Unclassified 2098
25 Ga0070669_100161238 3300005353 Bacteria 1743
26 Ga0070675_100140154 3300005354 Bacteria 2066
27 Ga0070674_100094879 3300005356 Bacteria 2161
28 Ga0070673_100021985 3300005364 Bacteria 4635
29 Ga0070688_100006973 3300005365 Bacteria 6072
30 Ga0070688_100055335 3300005365 Bacteria 2488
31 Ga0070688_100122710 3300005365 Bacteria 1742
32 Ga0070659_100001968 3300005366 Bacteria 14670
33 Ga0070667_100083616 3300005367 Bacteria 2735
34 Ga0070667_100086201 3300005367 Bacteria 2694
35 Ga0070694_100006529 3300005444 Bacteria 7082
36 Ga0070694_100287842 3300005444 Bacteria 1255
37 Ga0070678_100027266 3300005456 Unclassified 3878
38 Ga0070678_100088828 3300005456 Bacteria 2364
39 Ga0070678_100091328 3300005456 Bacteria 2336
40 Ga0070678_100181854 3300005456 Bacteria 1722
41 Ga0070662_100019568 3300005457 Bacteria 4597
42 Ga0070662_100416480 3300005457 Bacteria 1111
43 Ga0070681_10000925 3300005458 Bacteria 24771
44 Ga0070681_10008162 3300005458 Bacteria 10249
45 Ga0070681_10036806 3300005458 Bacteria 4914
46 Ga0068867_100150619 3300005459 Unclassified 1827
47 Ga0070706_100213317 3300005467 Bacteria 1802
48 Ga0070707_100111009 3300005468 Bacteria 2659
49 Ga0070698_100287891 3300005471 Bacteria 1574
50 Ga0070699_100055076 3300005518 Bacteria 3444
51 Ga0070679_100002189 3300005530 Bacteria 17645
52 Ga0070679_100003569 3300005530 Bacteria 14244
53 Ga0070684_100000512 3300005535 Bacteria 26647
54 Ga0070697_100009452 3300005536 Bacteria 7616
55 Ga0068853_100007276 3300005539 Bacteria 8862
56 Ga0070672_100204536 3300005543 Bacteria 1652
57 Ga0070686_100041493 3300005544 Unclassified 2877
58 Ga0070695_100088093 3300005545 Bacteria 2066
59 Ga0070696_100058234 3300005546 Bacteria 2698
60 Ga0070665_100020103 3300005548 Bacteria 6703
61 Ga0070665_100037679 3300005548 Bacteria 4861
62 Ga0070665_100075937 3300005548 Bacteria 3367
63 Ga0070704_100152989 3300005549 Bacteria 1816
64 Ga0068855_100083793 3300005563 Bacteria 3693
65 Ga0070664_100001957 3300005564 Bacteria 16519
66 Ga0070664_100029745 3300005564 Unclassified 4555
67 Ga0070664_100110774 3300005564 Bacteria 2396
68 Ga0068857_100007514 3300005577 Bacteria 9378
69 Ga0068857_100016350 3300005577 Bacteria 6500
70 Ga0068856_100001491 3300005614 Bacteria 24484
71 Ga0068852_100001554 3300005616 Bacteria 15598
72 Ga0068852_100194256 3300005616 Unclassified 1917
73 Ga0068859_100033999 3300005617 Bacteria 5118
74 Ga0068859_100062369 3300005617 Bacteria 3758
75 Ga0068864_100031797 3300005618 Bacteria 4479
76 Ga0068864_100058501 3300005618 Bacteria 3332
77 Ga0068864_100237997 3300005618 Bacteria 1686
78 Ga0068861_100071214 3300005719 Bacteria 2694
79 Ga0068861_100192085 3300005719 Unclassified 1708
80 Ga0068870_10031268 3300005840 Bacteria 2696
81 Ga0068863_100013927 3300005841 Bacteria 7753
82 Ga0068863_100074264 3300005841 Bacteria 3217
83 Ga0068858_100004180 3300005842 Bacteria 14208
84 Ga0068858_100004919 3300005842 Bacteria 13088
85 Ga0068858_100011536 3300005842 Bacteria 8337
86 Ga0068858_100033475 3300005842 Bacteria 4768
87 Ga0068858_100113501 3300005842 Bacteria 2531
88 Ga0068858_100118706 3300005842 Bacteria 2472
89 Ga0068858_100201508 3300005842 Bacteria 1882
90 Ga0068858_100226452 3300005842 Bacteria 1772
91 Ga0068858_100260262 3300005842 Bacteria 1649
92 Ga0068860_100021462 3300005843 Bacteria 6253
93 Ga0068860_100170022 3300005843 Bacteria 2105
94 Ga0068862_100011786 3300005844 Bacteria 7218
95 Ga0075432_10013156 3300006058 Bacteria 2811
96 Ga0075427_10002265 3300006194 Bacteria 2565
97 Ga0097621_100002394 3300006237 Bacteria 12852
98 Ga0097621_100040268 3300006237 Bacteria 3756
99 Ga0097621_100080455 3300006237 Bacteria 2710
100 Ga0097621_100096826 3300006237 Bacteria 2476
101 Ga0097621_100141826 3300006237 Bacteria 2054
102 Ga0068871_100002413 3300006358 Bacteria 12752
103 Ga0068871_100004062 3300006358 Bacteria 10123
104 Ga0068871_100101308 3300006358 Bacteria 2413
105 Ga0068871_100126061 3300006358 Bacteria 2167
106 Ga0068871_100208158 3300006358 Bacteria 1691
107 Ga0068871_100396153 3300006358 Bacteria 1229
108 Ga0075428_100024020 3300006844 Bacteria 6747
109 Ga0075428_100033955 3300006844 Bacteria 5628
110 Ga0075428_100072485 3300006844 Bacteria 3762
111 Ga0075428_100279245 3300006844 Bacteria 1797
112 Ga0075430_100002918 3300006846 Bacteria 14299
113 Ga0075430_100021420 3300006846 Bacteria 5495
114 Ga0075430_100042088 3300006846 Bacteria 3863
115 Ga0075431_100030429 3300006847 Bacteria 5561
116 Ga0075431_100031438 3300006847 Bacteria 5468
117 Ga0075431_100041140 3300006847 Bacteria 4765
118 Ga0075431_100118851 3300006847 Bacteria 2727
119 Ga0075431_100188318 3300006847 Bacteria 2115
120 Ga0075433_10021723 3300006852 Bacteria 5384
121 Ga0075433_10026675 3300006852 Bacteria 4895
122 Ga0075433_10048111 3300006852 Bacteria 3708
123 Ga0075434_100013521 3300006871 Bacteria 7773
124 Ga0075434_100018180 3300006871 Bacteria 6786
125 Ga0075434_100087233 3300006871 Bacteria 3121
126 Ga0075434_100088719 3300006871 Bacteria 3094
127 Ga0075429_100046472 3300006880 Bacteria 3777
128 Ga0075429_100094499 3300006880 Bacteria 2607
129 Ga0068865_100004129 3300006881 Bacteria 8733
130 Ga0068865_100047223 3300006881 Bacteria 2957
131 Ga0068865_100187334 3300006881 Bacteria 1597
132 Ga0097620_100034000 3300006931 Bacteria 5118
133 Ga0097620_100062368 3300006931 Bacteria 3758
134 Ga0105240_10002125 3300009093 Bacteria 32374
135 Ga0105240_10024748 3300009093 Bacteria 7907
136 Ga0105240_10093486 3300009093 Bacteria 3670
137 Ga0105240_10121592 3300009093 Bacteria 3143
138 Ga0111539_10001258 3300009094 Bacteria 33783
139 Ga0111539_10019086 3300009094 Bacteria 8472
140 Ga0111539_10065776 3300009094 Bacteria 4283
141 Ga0111539_10066080 3300009094 Bacteria 4271
142 Ga0111539_10107430 3300009094 Bacteria 3275
143 Ga0111539_10135214 3300009094 Bacteria 2887
144 Ga0105245_10006911 3300009098 Bacteria 9951
145 Ga0105247_10146732 3300009101 Bacteria 1551
146 Ga0114129_10009035 3300009147 Bacteria 14202
147 Ga0114129_10086055 3300009147 Bacteria 4360
148 Ga0114129_10164770 3300009147 Bacteria 3026
149 Ga0114129_10180808 3300009147 Bacteria 2870
150 Ga0114129_10185910 3300009147 Bacteria 2824
151 Ga0114129_10209097 3300009147 Bacteria 2639
152 Ga0114129_10227781 3300009147 Bacteria 2511
153 Ga0114129_10364731 3300009147 Bacteria 1911
154 Ga0114129_10624744 3300009147 Bacteria 1393
155 Ga0105241_10000274 3300009174 Bacteria 38434
156 Ga0105242_10014487 3300009176 Bacteria 6109
157 Ga0105242_10019441 3300009176 Bacteria 5322
158 Ga0105242_10065147 3300009176 Bacteria 3006
159 Ga0105242_10085486 3300009176 Bacteria 2645
160 Ga0105248_10020283 3300009177 Bacteria 7364
161 Ga0105248_10055378 3300009177 Bacteria 4448
162 Ga0105248_10107722 3300009177 Bacteria 3142
163 Ga0105248_10114800 3300009177 Bacteria 3037
164 Ga0105248_10199095 3300009177 Bacteria 2257
165 Ga0105248_10309176 3300009177 Bacteria 1780
166 Ga0105238_10001362 3300009551 Bacteria 24547
167 Ga0105249_10069933 3300009553 Unclassified 3240
168 Ga0105249_10103538 3300009553 Bacteria 2681
169 Ga0105239_10006978 3300010375 Bacteria 13013
170 Ga0105246_10022052 3300011119 Unclassified 4107
171 Ga0157373_10036639 3300013100 Bacteria 3520
172 Ga0157370_10014218 3300013104 Bacteria 8155
173 Ga0157369_10015100 3300013105 Bacteria 8715
174 Ga0157378_10032826 3300013297 Bacteria 4589
175 Ga0163162_10002604 3300013306 Bacteria 17098
176 Ga0163162_10075408 3300013306 Bacteria 3433
177 Ga0163162_10186699 3300013306 Bacteria 2200
178 Ga0163162_10350477 3300013306 Bacteria 1609
179 Ga0157372_10003114 3300013307 Bacteria 17883
180 Ga0157375_10108742 3300013308 Bacteria 2868
181 Ga0157375_10309146 3300013308 Bacteria 1745
182 Ga0163163_10006172 3300014325 Bacteria 10445
183 Ga0163163_10008661 3300014325 Bacteria 9047
184 Ga0163163_10009318 3300014325 Bacteria 8757
185 Ga0163163_10021238 3300014325 Bacteria 6123
186 Ga0163163_10034604 3300014325 Bacteria 4895
187 Ga0163163_10039025 3300014325 Bacteria 4632
188 Ga0163163_10052637 3300014325 Bacteria 4017
189 Ga0163163_10058705 3300014325 Bacteria 3804
190 Ga0163163_10197117 3300014325 Bacteria 2062
191 Ga0163163_10407184 3300014325 Bacteria 1419
192 Ga0157380_10012710 3300014326 Bacteria 6114
193 Ga0157380_10060491 3300014326 Bacteria 3027
194 Ga0157380_10108884 3300014326 Bacteria 2323
195 Ga0157380_10146659 3300014326 Bacteria 2034
196 Ga0157377_10009489 3300014745 Unclassified 4776
197 Ga0157377_10028108 3300014745 Bacteria 3025
198 Ga0157379_10028601 3300014968 Bacteria 4957
199 Ga0157379_10149988 3300014968 Bacteria 2103
200 Ga0157376_10024535 3300014969 Bacteria 4737
201 Ga0157376_10034236 3300014969 Unclassified 4100
202 Ga0157376_10056907 3300014969 Bacteria 3269
203 Ga0163161_10019921 3300017792 Unclassified 4705
204 Ga0163161_10361218 3300017792 Bacteria 1157
205 Ga0213876_10032102 3300021384 Bacteria 2770
206 Ga0213876_10064142 3300021384 Bacteria 1939
207 Ga0213875_10008581 3300021388 Bacteria 5224
208 Ga0207697_10016332 3300025315 Unclassified 3057
209 Ga0207682_10001355 3300025893 Bacteria 11309
210 Ga0207692_10132632 3300025898 Bacteria 1409
211 Ga0207688_10007906 3300025901 Bacteria 5788
212 Ga0207680_10007125 3300025903 Bacteria 5436
213 Ga0207680_10064331 3300025903 Bacteria 2248
214 Ga0207680_10185459 3300025903 Bacteria 1409
215 Ga0207643_10004490 3300025908 Bacteria 7500
216 Ga0207643_10009832 3300025908 Bacteria 5138
217 Ga0207707_10001108 3300025912 Bacteria 25593
218 Ga0207707_10267127 3300025912 Bacteria 1483
219 Ga0207695_10001924 3300025913 Bacteria 32293
220 Ga0207695_10004795 3300025913 Bacteria 18302
221 Ga0207695_10030007 3300025913 Bacteria 5995
222 Ga0207662_10038813 3300025918 Bacteria 2791
223 Ga0207662_10151223 3300025918 Bacteria 1476
224 Ga0207657_10013380 3300025919 Bacteria 8051
225 Ga0207649_10065744 3300025920 Bacteria 2297
226 Ga0207652_10001647 3300025921 Bacteria 19598
227 Ga0207652_10012830 3300025921 Bacteria 6775
228 Ga0207646_10094573 3300025922 Bacteria 2676
229 Ga0207681_10028296 3300025923 Bacteria 3630
230 Ga0207681_10102213 3300025923 Unclassified 2069
231 Ga0207681_10184790 3300025923 Bacteria 1590
232 Ga0207694_10000893 3300025924 Bacteria 26464
233 Ga0207650_10012703 3300025925 Bacteria 5814
234 Ga0207659_10040074 3300025926 Bacteria 3273
235 Ga0207687_10011540 3300025927 Bacteria 5775
236 Ga0207690_10009627 3300025932 Bacteria 5735
237 Ga0207706_10013870 3300025933 Bacteria 7309
238 Ga0207706_10028076 3300025933 Bacteria 5028
239 Ga0207706_10105126 3300025933 Bacteria 2484
240 Ga0207706_10122078 3300025933 Bacteria 2291
241 Ga0207686_10015880 3300025934 Bacteria 4219
242 Ga0207686_10051548 3300025934 Bacteria 2564
243 Ga0207686_10111418 3300025934 Bacteria 1846
244 Ga0207686_10116525 3300025934 Bacteria 1811
245 Ga0207704_10052669 3300025938 Bacteria 2468
246 Ga0207691_10086768 3300025940 Bacteria 2808
247 Ga0207691_10267580 3300025940 Bacteria 1472
248 Ga0207711_10064193 3300025941 Bacteria 3171
249 Ga0207711_10139700 3300025941 Bacteria 2178
250 Ga0207711_10144372 3300025941 Bacteria 2143
251 Ga0207689_10019466 3300025942 Bacteria 5721
252 Ga0207689_10044093 3300025942 Bacteria 3687
253 Ga0207689_10241812 3300025942 Bacteria 1492
254 Ga0207661_10005109 3300025944 Bacteria 9214
255 Ga0207661_10148481 3300025944 Bacteria 2025
256 Ga0207679_10102832 3300025945 Bacteria 2238
257 Ga0207667_10001907 3300025949 Bacteria 26176
258 Ga0207667_10331072 3300025949 Bacteria 1555
259 Ga0207712_10157318 3300025961 Bacteria 1762
260 Ga0207703_10007384 3300026035 Bacteria 8731
261 Ga0207703_10013310 3300026035 Bacteria 6409
262 Ga0207703_10028841 3300026035 Bacteria 4379
263 Ga0207703_10091659 3300026035 Bacteria 2557
264 Ga0207703_10264690 3300026035 Bacteria 1555
265 Ga0207703_10286501 3300026035 Bacteria 1498
266 Ga0207639_10040638 3300026041 Bacteria 3472
267 Ga0207702_10008009 3300026078 Bacteria 8950
268 Ga0207641_10054020 3300026088 Bacteria 3407
269 Ga0207641_10122988 3300026088 Bacteria 2319
270 Ga0207641_10152196 3300026088 Bacteria 2096
271 Ga0207648_10065624 3300026089 Unclassified 3165
272 Ga0207676_10064870 3300026095 Bacteria 2906
273 Ga0207676_10245485 3300026095 Bacteria 1609
274 Ga0207674_10000024 3300026116 Bacteria 156174
275 Ga0207674_10000042 3300026116 Bacteria 126790
276 Ga0207675_100031004 3300026118 Unclassified 4979
277 Ga0207675_100087646 3300026118 Bacteria 2923
278 Ga0207675_100544673 3300026118 Bacteria 1159
279 Ga0207683_10046571 3300026121 Bacteria 3796
280 Ga0207683_10068149 3300026121 Bacteria 3141
281 Ga0207683_10117799 3300026121 Bacteria 2382
282 Ga0207683_10304755 3300026121 Bacteria 1457
283 Ga0207698_10000863 3300026142 Bacteria 17608
284 Ga0207698_10173423 3300026142 Bacteria 1902
285 Ga0207698_10193052 3300026142 Unclassified 1816
286 Ga0209998_10014667 3300027717 Bacteria 1637
287 Ga0207428_10001554 3300027907 Bacteria 23983
288 Ga0207428_10051045 3300027907 Bacteria 3307
289 Ga0268266_10032819 3300028379 Bacteria 4412
290 Ga0268266_10077086 3300028379 Bacteria 2898
291 Ga0268265_10084054 3300028380 Bacteria 2522
292 Ga0268265_10139461 3300028380 Bacteria 2028
293 Ga0268264_10007474 3300028381 Bacteria 9117
294 Ga0268264_10053574 3300028381 Unclassified 3366
295 Ga0268264_10234368 3300028381 Bacteria 1697
296 Ga0307515_10120315 3300028794 Bacteria 2980
297 Ga0265320_10110294 3300031240 Bacteria 1261
298 Ga0373926_0070598 3300035083 Bacteria 1283
299 Ga0373934_0028574 3300035086 Bacteria 2175
300 Ga0373936_0052579 3300035113 Bacteria 1651
301 Ga0373956_0073369 3300035119 Bacteria 1564
302 Ga0373924_0099046 3300035410 Bacteria 1253
303 Ga0373935_0202242 3300035692 Bacteria 1373
304 Ga0373927_0003810 3300035695 Bacteria 10699
305 Ga0373933_0121243 3300035724 Bacteria 1638
306 Ga0373947_0129632 3300035725 Bacteria 1609
307 Ga0373947_0193203 3300035725 Bacteria 1329
308 Ga0373937_0004906 3300036401 Bacteria 11375
309 Ga0373937_0015870 3300036401 Bacteria 6678
310 Ga0373937_0021428 3300036401 Bacteria 5802
311 Ga0373937_0242582 3300036401 Bacteria 1698
312 Ga0373937_0267825 3300036401 Bacteria 1612
313 Ga0373925_0023514 3300037068 Bacteria 4497
314 Ga0436364_0478948 3300037853 Bacteria 1948
315 Ga0436364_1276518 3300037853 Bacteria 11504
316 Ga0436365_0142992 3300039437 Bacteria 22239
317 Ga0436365_1651146 3300039437 Bacteria 2146
318 Ga0439446_0019006 3300042156 Bacteria 1930
319 Ga0439434_0021585 3300042435 Bacteria 1934
320 Ga0439435_0013326 3300042436 Bacteria 2008
321 Ga0439435_0046257 3300042436 Bacteria 1232
322 Ga0451576_0099233 3300045051 Unclassified 3029
323 Ga0451576_0241584 3300045051 Bacteria 1887
324 Ga0495580_0115159 3300046472 Bacteria 1867
325 Ga0495608_0002722 3300046511 Bacteria 12703
326 Ga0495628_0039748 3300046516 Bacteria 3761
327 Ga0495628_0119595 3300046516 Bacteria 2022
328 Ga0495630_0079952 3300046517 Bacteria 2466
329 Ga0495640_0081506 3300046533 Bacteria 2151
330 Ga0495640_0208211 3300046533 Bacteria 1237
331 Ga0495586_0142670 3300046535 Bacteria 1345
332 Ga0495645_0005151 3300046543 Bacteria 8953
333 Ga0495645_0035123 3300046543 Bacteria 3655
334 Ga0495667_0001047 3300046559 Bacteria 17950
335 Ga0495635_0024735 3300046663 Bacteria 4186
336 Ga0495657_0042815 3300046675 Bacteria 3089
337 Ga0495623_0123706 3300046679 Bacteria 1555
338 Ga0495658_0041608 3300046683 Bacteria 2561
339 Ga0495669_0009955 3300046684 Bacteria 4021
340 Ga0495613_0000464 3300046689 Bacteria 34669
341 Ga0495613_0227387 3300046689 Bacteria 1308
342 Ga0495581_0089781 3300047315 Bacteria 1782
343 Ga0495604_0027087 3300047317 Bacteria 4560
344 Ga0495674_0008569 3300047319 Bacteria 9732
345 Ga0495674_0114725 3300047319 Bacteria 2281
346 Ga0495674_0287112 3300047319 Bacteria 1347
347 Ga0495680_0079803 3300047322 Bacteria 2474
348 Ga0495684_0000393 3300047471 Bacteria 35739
349 Ga0495684_0074011 3300047471 Bacteria 2588
350 Ga0495602_0266006 3300048088 Bacteria 1270
351 Ga0496101_0002230 3300048904 Bacteria 11843
352 Ga0496104_0064130 3300048907 Bacteria 3486
353 Ga0496108_0095745 3300048911 Bacteria 2528
354 Ga0496112_0174366 3300048915 Bacteria 2115
355 Ga0496112_0409646 3300048915 Bacteria 1295
356 Ga0496113_0013672 3300048916 Bacteria 5511
357 Ga0496114_0045249 3300048917 Bacteria 3655
358 Ga0501033_0123767 3300049570 Bacteria 1875
359 Ga0501036_0164694 3300049572 Bacteria 1869
360 Ga0501039_0062929 3300049575 Bacteria 2875
361 Ga0501040_0012747 3300049576 Bacteria 5518
362 Ga0501040_0040906 3300049576 Bacteria 3156
363 Ga0501041_0003266 3300049577 Bacteria 9322
364 Ga0501041_0108420 3300049577 Bacteria 1722
365 Ga0501042_0000922 3300049578 Bacteria 16518
366 Ga0501046_0048284 3300049580 Bacteria 3372
367 Ga0501048_0040979 3300049582 Bacteria 3317
368 Ga0501068_0005899 3300049584 Bacteria 6725
369 Ga0501072_0014455 3300049588 Bacteria 6048
370 Ga0501072_0020158 3300049588 Bacteria 5163
371 Ga0501072_0026971 3300049588 Bacteria 4483
372 Ga0501076_0000375 3300049592 Bacteria 27876
373 Ga0501076_0014016 3300049592 Bacteria 6025
374 Ga0501077_0034738 3300049593 Bacteria 3209
375 Ga0501249_007227 3300049679 Bacteria 2293
376 Ga0501079_0006730 3300049741 Bacteria 8649
377 Ga0501080_0258170 3300049742 Bacteria 1588
378 Ga0501081_0000177 3300049743 Bacteria 30145
379 Ga0501081_0137386 3300049743 Bacteria 1750
380 Ga0501035_0060701 3300049822 Bacteria 3366
381 Ga0501045_0013857 3300049824 Bacteria 5702
382 nmdc:mga05p37_13645_c1 3300050507 Bacteria 9735
383 nmdc:mga05p37_311881_c1 3300050507 Bacteria 1864
384 nmdc:mga09592_39083_c1 3300050508 Bacteria 3985
385 nmdc:mga0qj67_133899_c1 3300050509 Bacteria 2008
386 nmdc:mga0qj67_188086_c1 3300050509 Bacteria 1678
387 nmdc:mga06r32_39369_c1 3300050510 Bacteria 4484
388 nmdc:mga06r32_452849_c1 3300050510 Bacteria 1263
389 nmdc:mga06r32_49428_c1 3300050510 Bacteria 4021
390 nmdc:mga08y16_108767_c1 3300050511 Bacteria 2886
391 nmdc:mga08y16_143134_c1 3300050511 Bacteria 2486
392 nmdc:mga08y16_178042_c1 3300050511 Bacteria 2208
393 nmdc:mga08y16_244046_c1 3300050511 Bacteria 1856
394 nmdc:mga08y16_252637_c1 3300050511 Bacteria 1822
395 nmdc:mga08y16_30382_c1 3300050511 Bacteria 5687
396 nmdc:mga08y16_61570_c1 3300050511 Bacteria 3919
397 nmdc:mga08y16_7761_c1 3300050511 Bacteria 11241
398 nmdc:mga08y16_8428_c1 3300050511 Bacteria 10792
399 nmdc:mga0n895_101041_c1 3300050512 Bacteria 2894
400 nmdc:mga0n895_121461_c1 3300050512 Bacteria 2633
401 nmdc:mga0n895_13176_c1 3300050512 Bacteria 7448
402 nmdc:mga0n895_73329_c1 3300050512 Unclassified 3398
403 nmdc:mga0n895_83405_c1 3300050512 Bacteria 3188
404 nmdc:mga0rr50_19552_c1 3300050513 Bacteria 4575
405 nmdc:mga0rr50_63570_c1 3300050513 Unclassified 2787
406 nmdc:mga0a205_384836_c1 3300050515 Unclassified 1268
407 nmdc:mga0a205_51_c1 3300050515 Bacteria 33871
408 Ga0495601_0116473 3300053077 Bacteria 1733
409 Ga0495595_0096061 3300053084 Bacteria 1426
410 Ga0495619_0002779 3300053085 Bacteria 11420
411 Ga0495619_0026760 3300053085 Bacteria 3713
412 Ga0495619_0042858 3300053085 Bacteria 2965
413 Ga0495619_0189933 3300053085 Bacteria 1422
414 Ga0500562_007513 3300053108 Bacteria 2749
415 Ga0500568_0008326 3300053139 Bacteria 5010
416 Ga0501084_0070960 3300054114 Bacteria 2916
417 Ga0501084_0111814 3300054114 Bacteria 2295
418 Ga0501084_0154972 3300054114 Bacteria 1932
419 Ga0501082_0002450 3300060353 Bacteria 16285
420 Ga0501082_0371405 3300060353 Bacteria 1248
421 Ga0530510_0003574 3300061734 Bacteria 10706
422 Ga0530510_0101932 3300061734 Bacteria 2099
423 Ga0207711_10314641
424 Ga0065712_10001835
425 Ga0065712_10089113
426 Ga0065715_10133808
427 Ga0065707_10092578
428 Ga0070658_10011057
429 Ga0070676_10218291
430 Ga0070690_100015845
431 Ga0070670_100007925
432 Ga0070670_100069224
433 Ga0070670_100095786
434 Ga0070670_100459704
435 Ga0070677_10002144
436 Ga0068869_100010340
437 Ga0068869_100099551
438 Ga0068869_100105364
439 Ga0070666_10015355
440 Ga0068868_100087192
441 Ga0070660_100061574
442 Ga0070689_100112127
443 Ga0070687_100129748
444 Ga0070669_100005946
445 Ga0070669_100054616
446 Ga0070669_100109083
447 Ga0070669_100161238
448 Ga0070675_100140154
449 Ga0070674_100094879
450 Ga0070673_100021985
451 Ga0070688_100006973
452 Ga0070688_100055335
453 Ga0070688_100122710
454 Ga0070659_100001968
455 Ga0070667_100083616
456 Ga0070667_100086201
457 Ga0070694_100006529
458 Ga0070694_100287842
459 Ga0070678_100027266
460 Ga0070678_100088828
461 Ga0070678_100091328
462 Ga0070678_100181854
463 Ga0070662_100019568
464 Ga0070662_100416480
465 Ga0070681_10000925
466 Ga0070681_10008162
467 Ga0070681_10036806
468 Ga0068867_100150619
469 Ga0070706_100213317
470 Ga0070707_100111009
471 Ga0070698_100287891
472 Ga0070699_100055076
473 Ga0070679_100002189
474 Ga0070679_100003569
475 Ga0070684_100000512
476 Ga0070697_100009452
477 Ga0068853_100007276
478 Ga0070672_100204536
479 Ga0070686_100041493
480 Ga0070695_100088093
481 Ga0070696_100058234
482 Ga0070665_100020103
483 Ga0070665_100037679
484 Ga0070665_100075937
485 Ga0070704_100152989
486 Ga0068855_100083793
487 Ga0070664_100001957
488 Ga0070664_100029745
489 Ga0070664_100110774
490 Ga0068857_100007514
491 Ga0068857_100016350
492 Ga0068856_100001491
493 Ga0068852_100001554
494 Ga0068852_100194256
495 Ga0068859_100033999
496 Ga0068859_100062369
497 Ga0068864_100031797
498 Ga0068864_100058501
499 Ga0068864_100237997
500 Ga0068861_100071214
501 Ga0068861_100192085
502 Ga0068870_10031268
503 Ga0068863_100013927
504 Ga0068863_100074264
505 Ga0068858_100004180
506 Ga0068858_100004919
507 Ga0068858_100011536
508 Ga0068858_100033475
509 Ga0068858_100113501
510 Ga0068858_100118706
511 Ga0068858_100201508
512 Ga0068858_100226452
513 Ga0068858_100260262
514 Ga0068860_100021462
515 Ga0068860_100170022
516 Ga0068862_100011786
517 Ga0075432_10013156
518 Ga0075427_10002265
519 Ga0097621_100002394
520 Ga0097621_100040268
521 Ga0097621_100080455
522 Ga0097621_100096826
523 Ga0097621_100141826
524 Ga0068871_100002413
525 Ga0068871_100004062
526 Ga0068871_100101308
527 Ga0068871_100126061
528 Ga0068871_100208158
529 Ga0068871_100396153
530 Ga0075428_100024020
531 Ga0075428_100033955
532 Ga0075428_100072485
533 Ga0075428_100279245
534 Ga0075430_100002918
535 Ga0075430_100021420
536 Ga0075430_100042088
537 Ga0075431_100030429
538 Ga0075431_100031438
539 Ga0075431_100041140
540 Ga0075431_100118851
541 Ga0075431_100188318
542 Ga0075433_10021723
543 Ga0075433_10026675
544 Ga0075433_10048111
545 Ga0075434_100013521
546 Ga0075434_100018180
547 Ga0075434_100087233
548 Ga0075434_100088719
549 Ga0075429_100046472
550 Ga0075429_100094499
551 Ga0068865_100004129
552 Ga0068865_100047223
553 Ga0068865_100187334
554 Ga0097620_100034000
555 Ga0097620_100062368
556 Ga0105240_10002125
557 Ga0105240_10024748
558 Ga0105240_10093486
559 Ga0105240_10121592
560 Ga0111539_10001258
561 Ga0111539_10019086
562 Ga0111539_10065776
563 Ga0111539_10066080
564 Ga0111539_10107430
565 Ga0111539_10135214
566 Ga0105245_10006911
567 Ga0105247_10146732
568 Ga0114129_10009035
569 Ga0114129_10086055
570 Ga0114129_10164770
571 Ga0114129_10180808
572 Ga0114129_10185910
573 Ga0114129_10209097
574 Ga0114129_10227781
575 Ga0114129_10364731
576 Ga0114129_10624744
577 Ga0105241_10000274
578 Ga0105242_10014487
579 Ga0105242_10019441
580 Ga0105242_10065147
581 Ga0105242_10085486
582 Ga0105248_10020283
583 Ga0105248_10055378
584 Ga0105248_10107722
585 Ga0105248_10114800
586 Ga0105248_10199095
587 Ga0105248_10309176
588 Ga0105238_10001362
589 Ga0105249_10069933
590 Ga0105249_10103538
591 Ga0105239_10006978
592 Ga0105246_10022052
593 Ga0157373_10036639
594 Ga0157370_10014218
595 Ga0157369_10015100
596 Ga0157378_10032826
597 Ga0163162_10002604
598 Ga0163162_10075408
599 Ga0163162_10186699
600 Ga0163162_10350477
601 Ga0157372_10003114
602 Ga0157375_10108742
603 Ga0157375_10309146
604 Ga0163163_10006172
605 Ga0163163_10008661
606 Ga0163163_10009318
607 Ga0163163_10021238
608 Ga0163163_10034604
609 Ga0163163_10039025
610 Ga0163163_10052637
611 Ga0163163_10058705
612 Ga0163163_10197117
613 Ga0163163_10407184
614 Ga0157380_10012710
615 Ga0157380_10060491
616 Ga0157380_10108884
617 Ga0157380_10146659
618 Ga0157377_10009489
619 Ga0157377_10028108
620 Ga0157379_10028601
621 Ga0157379_10149988
622 Ga0157376_10024535
623 Ga0157376_10034236
624 Ga0157376_10056907
625 Ga0163161_10019921
626 Ga0163161_10361218
627 Ga0213876_10032102
628 Ga0213876_10064142
629 Ga0213875_10008581
630 Ga0207697_10016332
631 Ga0207682_10001355
632 Ga0207692_10132632
633 Ga0207688_10007906
634 Ga0207680_10007125
635 Ga0207680_10064331
636 Ga0207680_10185459
637 Ga0207643_10004490
638 Ga0207643_10009832
639 Ga0207707_10001108
640 Ga0207707_10267127
641 Ga0207695_10001924
642 Ga0207695_10004795
643 Ga0207695_10030007
644 Ga0207662_10038813
645 Ga0207662_10151223
646 Ga0207657_10013380
647 Ga0207649_10065744
648 Ga0207652_10001647
649 Ga0207652_10012830
650 Ga0207646_10094573
651 Ga0207681_10028296
652 Ga0207681_10102213
653 Ga0207681_10184790
654 Ga0207694_10000893
655 Ga0207650_10012703
656 Ga0207659_10040074
657 Ga0207687_10011540
658 Ga0207690_10009627
659 Ga0207706_10013870
660 Ga0207706_10028076
661 Ga0207706_10105126
662 Ga0207706_10122078
663 Ga0207686_10015880
664 Ga0207686_10051548
665 Ga0207686_10111418
666 Ga0207686_10116525
667 Ga0207704_10052669
668 Ga0207691_10086768
669 Ga0207691_10267580
670 Ga0207711_10064193
671 Ga0207711_10139700
672 Ga0207711_10144372
673 Ga0207689_10019466
674 Ga0207689_10044093
675 Ga0207689_10241812
676 Ga0207661_10005109
677 Ga0207661_10148481
678 Ga0207679_10102832
679 Ga0207667_10001907
680 Ga0207667_10331072
681 Ga0207712_10157318
682 Ga0207703_10007384
683 Ga0207703_10013310
684 Ga0207703_10028841
685 Ga0207703_10091659
686 Ga0207703_10264690
687 Ga0207703_10286501
688 Ga0207639_10040638
689 Ga0207702_10008009
690 Ga0207641_10054020
691 Ga0207641_10122988
692 Ga0207641_10152196
693 Ga0207648_10065624
694 Ga0207676_10064870
695 Ga0207676_10245485
696 Ga0207674_10000024
697 Ga0207674_10000042
698 Ga0207675_100031004
699 Ga0207675_100087646
700 Ga0207675_100544673
701 Ga0207683_10046571
702 Ga0207683_10068149
703 Ga0207683_10117799
704 Ga0207683_10304755
705 Ga0207698_10000863
706 Ga0207698_10173423
707 Ga0207698_10193052
708 Ga0209998_10014667
709 Ga0207428_10001554
710 Ga0207428_10051045
711 Ga0268266_10032819
712 Ga0268266_10077086
713 Ga0268265_10084054
714 Ga0268265_10139461
715 Ga0268264_10007474
716 Ga0268264_10053574
717 Ga0268264_10234368
718 Ga0307515_10120315
719 Ga0265320_10110294
720 Ga0373926_0070598
721 Ga0373934_0028574
722 Ga0373936_0052579
723 Ga0373956_0073369
724 Ga0373924_0099046
725 Ga0373935_0202242
726 Ga0373927_0003810
727 Ga0373933_0121243
728 Ga0373947_0129632
729 Ga0373947_0193203
730 Ga0373937_0004906
731 Ga0373937_0015870
732 Ga0373937_0021428
733 Ga0373937_0242582
734 Ga0373937_0267825
735 Ga0373925_0023514
736 Ga0436364_0478948
737 Ga0436364_1276518
738 Ga0436365_0142992
739 Ga0436365_1651146
740 Ga0439446_0019006
741 Ga0439434_0021585
742 Ga0439435_0013326
743 Ga0439435_0046257
744 Ga0451576_0099233
745 Ga0451576_0241584
746 Ga0495580_0115159
747 Ga0495608_0002722
748 Ga0495628_0039748
749 Ga0495628_0119595
750 Ga0495630_0079952
751 Ga0495640_0081506
752 Ga0495640_0208211
753 Ga0495586_0142670
754 Ga0495645_0005151
755 Ga0495645_0035123
756 Ga0495667_0001047
757 Ga0495635_0024735
758 Ga0495657_0042815
759 Ga0495623_0123706
760 Ga0495658_0041608
761 Ga0495669_0009955
762 Ga0495613_0000464
763 Ga0495613_0227387
764 Ga0495581_0089781
765 Ga0495604_0027087
766 Ga0495674_0008569
767 Ga0495674_0114725
768 Ga0495674_0287112
769 Ga0495680_0079803
770 Ga0495684_0000393
771 Ga0495684_0074011
772 Ga0495602_0266006
773 Ga0496101_0002230
774 Ga0496104_0064130
775 Ga0496108_0095745
776 Ga0496112_0174366
777 Ga0496112_0409646
778 Ga0496113_0013672
779 Ga0496114_0045249
780 Ga0501033_0123767
781 Ga0501036_0164694
782 Ga0501039_0062929
783 Ga0501040_0012747
784 Ga0501040_0040906
785 Ga0501041_0003266
786 Ga0501041_0108420
787 Ga0501042_0000922
788 Ga0501046_0048284
789 Ga0501048_0040979
790 Ga0501068_0005899
791 Ga0501072_0014455
792 Ga0501072_0020158
793 Ga0501072_0026971
794 Ga0501076_0000375
795 Ga0501076_0014016
796 Ga0501077_0034738
797 Ga0501249_007227
798 Ga0501079_0006730
799 Ga0501080_0258170
800 Ga0501081_0000177
801 Ga0501081_0137386
802 Ga0501035_0060701
803 Ga0501045_0013857
804 nmdc:mga05p37_13645_c1
805 nmdc:mga05p37_311881_c1
806 nmdc:mga09592_39083_c1
807 nmdc:mga0qj67_133899_c1
808 nmdc:mga0qj67_188086_c1
809 nmdc:mga06r32_39369_c1
810 nmdc:mga06r32_452849_c1
811 nmdc:mga06r32_49428_c1
812 nmdc:mga08y16_108767_c1
813 nmdc:mga08y16_143134_c1
814 nmdc:mga08y16_178042_c1
815 nmdc:mga08y16_244046_c1
816 nmdc:mga08y16_252637_c1
817 nmdc:mga08y16_30382_c1
818 nmdc:mga08y16_61570_c1
819 nmdc:mga08y16_7761_c1
820 nmdc:mga08y16_8428_c1
821 nmdc:mga0n895_101041_c1
822 nmdc:mga0n895_121461_c1
823 nmdc:mga0n895_13176_c1
824 nmdc:mga0n895_73329_c1
825 nmdc:mga0n895_83405_c1
826 nmdc:mga0rr50_19552_c1
827 nmdc:mga0rr50_63570_c1
828 nmdc:mga0a205_384836_c1
829 nmdc:mga0a205_51_c1
830 Ga0495601_0116473
831 Ga0495595_0096061
832 Ga0495619_0002779
833 Ga0495619_0026760
834 Ga0495619_0042858
835 Ga0495619_0189933
836 Ga0500562_007513
837 Ga0500568_0008326
838 Ga0501084_0070960
839 Ga0501084_0111814
840 Ga0501084_0154972
841 Ga0501082_0002450
842 Ga0501082_0371405
843 Ga0530510_0003574
844 Ga0530510_0101932

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08450

SGL

SMP-30/Gluconolactonase/LRE-like region

109

364

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3e5z-assembly2.cif.gz_B x-ray structure of the putative gluconolactonase in protein family pf08450. northeast structural genomics consortium target drr130. 0.9397 54 349
3e5z-assembly2.cif.gz_B x-ray structure of the putative gluconolactonase in protein family pf08450. northeast structural genomics consortium target drr130. 0.9334 54 349
3dr2-assembly1.cif.gz_B structural and functional analyses of xc5397 from xanthomonas campestris: a gluconolactonase important in glucose secondary metabolic pathways 0.9233 38 342
3dr2-assembly1.cif.gz_A structural and functional analyses of xc5397 from xanthomonas campestris: a gluconolactonase important in glucose secondary metabolic pathways 0.917 38 342
3dr2-assembly1.cif.gz_B structural and functional analyses of xc5397 from xanthomonas campestris: a gluconolactonase important in glucose secondary metabolic pathways 0.9113 38 342
ID Description Score Start End Superfamily
3e5zB00 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.9391 54 349 2.120.10.30
3e5zB00 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.9328 54 349 2.120.10.30
3dr2A00 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.917 38 342 2.120.10.30
3dr2A00 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.9021 38 342 2.120.10.30
af_F1RAG3_871_1134_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.8367 81 315 2.120.10.30
ID Description Score Start End GO Terms
AF-A0A2V8GQ13-F1-model_v4 Gluconolactonase 0.9944 127 350 GO:0016787
AF-A0A2V8GQ13-F1-model_v4 Gluconolactonase 0.99 127 350 GO:0016787
AF-A0A439ZKL5-F1-model_v4 deleted 0.9886 72 183
AF-A0A349THR4-F1-model_v4 Gluconolactonase 0.9881 47 350 GO:0016787
GO:0046872
AF-A0A359GTZ4-F1-model_v4 Gluconolactonase 0.9856 264 350 GO:0016787

Map