F440184

General Info

Members Datasets Scaffolds Average Seq Length
422 164 844 230

Family's Representative Sequence

Representative Sequence 3300005331|Ga0070670_100068780|Ga0070670_1000687805
Length 232
Sequence MMKPSFDSFAEPKTDRRKFLLGLLFCSAAGVAAFRKPSKHLDYLGHNKLEALVPKTIGKWNFVAASGLVVPPDDQLLRAIYSNMLTRVYWDGVNPAVMLLIAQSGSQTGFLQIHRPETCYTAGGYRLSAMVPHTIQVGQQQLVANSLDATAGTGNTEHVVYWTRIGNQMPKTWREQKLAVAEQNLQGIVPDAILVRVSSVNDDGDAARAAIDSFVQAMIASVPKSSRSVFLV

Samples

Sample ID Description Type Environment
1 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
57 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
58 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
69 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
108 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
109 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
110 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
111 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
112 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
113 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
114 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
115 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
116 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
117 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
118 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
119 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
120 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
121 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
122 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
123 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
124 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
125 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
126 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
127 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
128 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
129 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
130 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
131 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
132 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
133 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
134 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
135 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
136 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
137 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
138 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
139 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
140 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
141 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
142 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
143 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
144 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
145 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
146 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
147 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
148 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
149 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
150 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
151 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
152 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
153 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
154 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
155 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
156 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
157 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
158 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
159 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
160 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
161 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
162 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
163 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
164 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.76
Metatranscriptomes 0
Isolates 0.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.37
Rhizosphere 97.16
Stem 0
Stem Tuber 0
Unclassified 39.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070670_100068780 3300005331 Unclassified 3039
2 JGI24735J21928_10053489 3300002067 Unclassified 1164
3 rootL2_10178467 3300003322 Unclassified 1407
4 Ga0070658_10014784 3300005327 Bacteria 6256
5 Ga0070658_10027650 3300005327 Bacteria 4550
6 Ga0070658_10070176 3300005327 Bacteria 2868
7 Ga0070658_10595383 3300005327 Unclassified 958
8 Ga0070658_10616455 3300005327 Unclassified 941
9 Ga0070676_10345848 3300005328 Bacteria 1021
10 Ga0070683_100016104 3300005329 Bacteria 6581
11 Ga0070690_100078798 3300005330 Bacteria 2153
12 Ga0070670_100000482 3300005331 Bacteria 32026
13 Ga0070670_100013946 3300005331 Bacteria 6892
14 Ga0070670_100120620 3300005331 Bacteria 2262
15 Ga0070670_100308247 3300005331 Unclassified 1385
16 Ga0070677_10219894 3300005333 Unclassified 927
17 Ga0070666_10025157 3300005335 Unclassified 3880
18 Ga0070666_10027996 3300005335 Unclassified 3695
19 Ga0070666_10044734 3300005335 Unclassified 2967
20 Ga0070666_10184203 3300005335 Bacteria 1465
21 Ga0070680_100035425 3300005336 Bacteria 4029
22 Ga0068868_100068952 3300005338 Bacteria 2817
23 Ga0068868_100079365 3300005338 Unclassified 2629
24 Ga0068868_100321489 3300005338 Unclassified 1318
25 Ga0070660_100007812 3300005339 Bacteria 7459
26 Ga0070660_100011819 3300005339 Bacteria 6220
27 Ga0070660_100019162 3300005339 Bacteria 5009
28 Ga0070660_100079348 3300005339 Unclassified 2575
29 Ga0070660_100085989 3300005339 Unclassified 2474
30 Ga0070660_100245774 3300005339 Unclassified 1458
31 Ga0070660_100272305 3300005339 Bacteria 1384
32 Ga0070661_100002823 3300005344 Bacteria 11943
33 Ga0070661_100003992 3300005344 Bacteria 10146
34 Ga0070661_100104388 3300005344 Bacteria 2111
35 Ga0070661_100272873 3300005344 Unclassified 1310
36 Ga0070661_100283564 3300005344 Bacteria 1285
37 Ga0070692_10020700 3300005345 Bacteria 3191
38 Ga0070675_100000877 3300005354 Bacteria 21384
39 Ga0070675_100002093 3300005354 Bacteria 14774
40 Ga0070671_100000585 3300005355 Bacteria 25984
41 Ga0070671_100003827 3300005355 Bacteria 11819
42 Ga0070671_100037502 3300005355 Bacteria 4020
43 Ga0070671_100045653 3300005355 Bacteria 3643
44 Ga0070671_100289257 3300005355 Bacteria 1394
45 Ga0070674_100234510 3300005356 Unclassified 1434
46 Ga0070673_100004985 3300005364 Bacteria 8465
47 Ga0070673_100100294 3300005364 Unclassified 2383
48 Ga0070673_100169667 3300005364 Unclassified 1861
49 Ga0070659_100007018 3300005366 Bacteria 8158
50 Ga0070659_100012286 3300005366 Bacteria 6349
51 Ga0070667_100003311 3300005367 Bacteria 13770
52 Ga0070667_100081475 3300005367 Bacteria 2770
53 Ga0070667_100226411 3300005367 Bacteria 1666
54 Ga0070714_100120757 3300005435 Unclassified 2331
55 Ga0070714_100156329 3300005435 Unclassified 2059
56 Ga0070714_100299145 3300005435 Unclassified 1499
57 Ga0070713_100123284 3300005436 Unclassified 2276
58 Ga0070663_100062121 3300005455 Unclassified 2692
59 Ga0070663_100357632 3300005455 Unclassified 1184
60 Ga0070663_100617790 3300005455 Unclassified 913
61 Ga0070678_100011216 3300005456 Bacteria 5518
62 Ga0070678_100060622 3300005456 Unclassified 2786
63 Ga0070678_100085251 3300005456 Bacteria 2407
64 Ga0070678_100129322 3300005456 Bacteria 2004
65 Ga0070662_100017163 3300005457 Unclassified 4873
66 Ga0070662_100037197 3300005457 Unclassified 3450
67 Ga0070662_100057498 3300005457 Unclassified 2826
68 Ga0070662_100064145 3300005457 Unclassified 2689
69 Ga0070662_100098222 3300005457 Unclassified 2211
70 Ga0070662_100129167 3300005457 Bacteria 1946
71 Ga0068867_100097902 3300005459 Unclassified 2236
72 Ga0070685_10363933 3300005466 Unclassified 992
73 Ga0070679_100042382 3300005530 Bacteria 4532
74 Ga0070684_100868430 3300005535 Unclassified 845
75 Ga0068853_100046247 3300005539 Unclassified 3731
76 Ga0070672_100001022 3300005543 Bacteria 17006
77 Ga0070672_100031012 3300005543 Unclassified 4021
78 Ga0070672_100117629 3300005543 Unclassified 2173
79 Ga0070672_100434695 3300005543 Bacteria 1129
80 Ga0070665_100001865 3300005548 Bacteria 23913
81 Ga0070665_100032641 3300005548 Bacteria 5240
82 Ga0070665_100155454 3300005548 Unclassified 2289
83 Ga0068855_100005824 3300005563 Bacteria 15041
84 Ga0068855_100006659 3300005563 Bacteria 14033
85 Ga0068855_100019199 3300005563 Bacteria 8215
86 Ga0068855_100199319 3300005563 Unclassified 2254
87 Ga0068855_100356827 3300005563 Unclassified 1609
88 Ga0068855_100665269 3300005563 Unclassified 1117
89 Ga0070664_100000161 3300005564 Bacteria 46245
90 Ga0070664_100012603 3300005564 Bacteria 6880
91 Ga0070664_100079788 3300005564 Unclassified 2818
92 Ga0070664_100086527 3300005564 Unclassified 2708
93 Ga0070664_100316931 3300005564 Bacteria 1412
94 Ga0070664_100339857 3300005564 Bacteria 1363
95 Ga0068857_100360380 3300005577 Bacteria 1348
96 Ga0068857_100594760 3300005577 Unclassified 1045
97 Ga0068854_100012828 3300005578 Bacteria 5489
98 Ga0068854_100111384 3300005578 Bacteria 2065
99 Ga0068854_100296963 3300005578 Unclassified 1306
100 Ga0068856_100010684 3300005614 Bacteria 8919
101 Ga0068856_100023749 3300005614 Bacteria 5963
102 Ga0068856_100122888 3300005614 Bacteria 2598
103 Ga0068852_100014915 3300005616 Bacteria 6005
104 Ga0068852_100199957 3300005616 Unclassified 1891
105 Ga0068852_100340190 3300005616 Unclassified 1462
106 Ga0068852_101001457 3300005616 Unclassified 854
107 Ga0068859_101067235 3300005617 Unclassified 888
108 Ga0068864_100048368 3300005618 Unclassified 3656
109 Ga0068864_100107289 3300005618 Unclassified 2484
110 Ga0068864_100134729 3300005618 Unclassified 2223
111 Ga0068864_100210423 3300005618 Bacteria 1790
112 Ga0068866_10039294 3300005718 Bacteria 2336
113 Ga0068863_100068000 3300005841 Bacteria 3370
114 Ga0068863_100265535 3300005841 Bacteria 1660
115 Ga0068858_100070725 3300005842 Unclassified 3234
116 Ga0068858_100096630 3300005842 Bacteria 2753
117 Ga0068862_100096682 3300005844 Unclassified 2578
118 Ga0081539_10066111 3300005985 Bacteria 1961
119 Ga0070717_10439113 3300006028 Unclassified 1175
120 Ga0097621_100013198 3300006237 Bacteria 6146
121 Ga0097621_100030868 3300006237 Bacteria 4246
122 Ga0097621_100735381 3300006237 Bacteria 910
123 Ga0068871_100137333 3300006358 Unclassified 2077
124 Ga0068871_100156692 3300006358 Bacteria 1945
125 Ga0068865_100009762 3300006881 Bacteria 5956
126 Ga0097620_101067107 3300006931 Unclassified 888
127 Ga0105240_10154718 3300009093 Unclassified 2728
128 Ga0105240_10180308 3300009093 Unclassified 2493
129 Ga0105243_11008688 3300009148 Unclassified 835
130 Ga0105248_10000864 3300009177 Bacteria 34121
131 Ga0105248_10001731 3300009177 Bacteria 24252
132 Ga0105248_10030620 3300009177 Bacteria 6009
133 Ga0105248_10079884 3300009177 Bacteria 3676
134 Ga0105248_10082992 3300009177 Unclassified 3605
135 Ga0105238_10482303 3300009551 Unclassified 1239
136 Ga0105239_10833286 3300010375 Bacteria 1057
137 Ga0105246_10541509 3300011119 Bacteria 996
138 Ga0157373_10108143 3300013100 Bacteria 1955
139 Ga0157373_10457406 3300013100 Bacteria 919
140 Ga0157371_10263852 3300013102 Bacteria 1242
141 Ga0157370_10077871 3300013104 Unclassified 3123
142 Ga0157370_10127572 3300013104 Bacteria 2375
143 Ga0157370_10382004 3300013104 Bacteria 1297
144 Ga0157369_10002126 3300013105 Bacteria 23887
145 Ga0157369_10071353 3300013105 Unclassified 3729
146 Ga0157369_10103523 3300013105 Unclassified 3032
147 Ga0157369_10154858 3300013105 Unclassified 2421
148 Ga0157369_10210256 3300013105 Unclassified 2039
149 Ga0157369_10269826 3300013105 Unclassified 1773
150 Ga0157369_10578249 3300013105 Bacteria 1160
151 Ga0157374_10004774 3300013296 Bacteria 11366
152 Ga0157374_10057816 3300013296 Bacteria 3623
153 Ga0157378_10090576 3300013297 Bacteria 2779
154 Ga0157378_10127820 3300013297 Bacteria 2349
155 Ga0163162_10019694 3300013306 Bacteria 6623
156 Ga0163162_10025893 3300013306 Bacteria 5797
157 Ga0163162_10066915 3300013306 Unclassified 3643
158 Ga0157372_10099622 3300013307 Unclassified 3315
159 Ga0157375_10011719 3300013308 Bacteria 7750
160 Ga0157375_10108944 3300013308 Bacteria 2865
161 Ga0157375_10221272 3300013308 Bacteria 2051
162 Ga0157375_11049418 3300013308 Unclassified 953
163 Ga0163163_10074390 3300014325 Unclassified 3389
164 Ga0163163_10390601 3300014325 Unclassified 1449
165 Ga0157379_10652903 3300014968 Unclassified 985
166 Ga0163161_10234795 3300017792 Unclassified 1424
167 Ga0207682_10251212 3300025893 Unclassified 823
168 Ga0207642_10027086 3300025899 Bacteria 2343
169 Ga0207680_10016580 3300025903 Unclassified 3872
170 Ga0207680_10032318 3300025903 Bacteria 2974
171 Ga0207647_10003821 3300025904 Bacteria 11264
172 Ga0207647_10023651 3300025904 Unclassified 4060
173 Ga0207705_10002169 3300025909 Bacteria 15185
174 Ga0207705_10064802 3300025909 Bacteria 2641
175 Ga0207705_10158997 3300025909 Archaea 1697
176 Ga0207695_10306590 3300025913 Unclassified 1478
177 Ga0207657_10034506 3300025919 Bacteria 4548
178 Ga0207657_10088734 3300025919 Unclassified 2584
179 Ga0207657_10212298 3300025919 Bacteria 1553
180 Ga0207649_10102914 3300025920 Bacteria 1894
181 Ga0207649_10142148 3300025920 Bacteria 1644
182 Ga0207649_10259831 3300025920 Bacteria 1254
183 Ga0207649_10358893 3300025920 Unclassified 1081
184 Ga0207652_10010377 3300025921 Bacteria 7500
185 Ga0207681_10110061 3300025923 Unclassified 2002
186 Ga0207681_10455189 3300025923 Unclassified 1042
187 Ga0207650_10003792 3300025925 Bacteria 10337
188 Ga0207650_10051214 3300025925 Unclassified 3055
189 Ga0207650_10095496 3300025925 Bacteria 2279
190 Ga0207659_10001593 3300025926 Bacteria 13460
191 Ga0207664_10173347 3300025929 Unclassified 1848
192 Ga0207644_10000110 3300025931 Bacteria 60867
193 Ga0207644_10003194 3300025931 Bacteria 10553
194 Ga0207644_10039149 3300025931 Unclassified 3344
195 Ga0207644_10054894 3300025931 Unclassified 2870
196 Ga0207644_10081955 3300025931 Unclassified 2385
197 Ga0207644_10127923 3300025931 Bacteria 1941
198 Ga0207644_10358744 3300025931 Bacteria 1185
199 Ga0207690_10004350 3300025932 Bacteria 8367
200 Ga0207690_10016417 3300025932 Bacteria 4503
201 Ga0207706_10004761 3300025933 Bacteria 12707
202 Ga0207706_10009871 3300025933 Bacteria 8758
203 Ga0207706_10011549 3300025933 Bacteria 8042
204 Ga0207706_10014818 3300025933 Bacteria 7058
205 Ga0207706_10024053 3300025933 Bacteria 5464
206 Ga0207706_10032192 3300025933 Unclassified 4670
207 Ga0207706_10131803 3300025933 Bacteria 2198
208 Ga0207669_10070291 3300025937 Unclassified 2194
209 Ga0207669_10192408 3300025937 Unclassified 1473
210 Ga0207704_10109804 3300025938 Bacteria 1861
211 Ga0207691_10022111 3300025940 Bacteria 6000
212 Ga0207691_10022416 3300025940 Bacteria 5956
213 Ga0207691_10050820 3300025940 Unclassified 3793
214 Ga0207691_10298260 3300025940 Unclassified 1385
215 Ga0207711_10005517 3300025941 Bacteria 10698
216 Ga0207711_10014822 3300025941 Bacteria 6477
217 Ga0207711_10042595 3300025941 Unclassified 3868
218 Ga0207711_10185352 3300025941 Bacteria 1894
219 Ga0207661_10055571 3300025944 Bacteria 3176
220 Ga0207679_10054031 3300025945 Unclassified 2955
221 Ga0207679_10116292 3300025945 Unclassified 2120
222 Ga0207679_10129361 3300025945 Unclassified 2023
223 Ga0207679_10140665 3300025945 Bacteria 1950
224 Ga0207667_10004629 3300025949 Bacteria 16877
225 Ga0207667_10005521 3300025949 Bacteria 15429
226 Ga0207667_10261591 3300025949 Bacteria 1769
227 Ga0207651_10008091 3300025960 Bacteria 5650
228 Ga0207651_10084260 3300025960 Bacteria 2302
229 Ga0207651_10467789 3300025960 Unclassified 1084
230 Ga0207640_10037699 3300025981 Bacteria 3044
231 Ga0207658_10304657 3300025986 Unclassified 1374
232 Ga0207658_10318625 3300025986 Unclassified 1345
233 Ga0207677_10083595 3300026023 Unclassified 2298
234 Ga0207677_10318842 3300026023 Bacteria 1291
235 Ga0207703_10091420 3300026035 Unclassified 2560
236 Ga0207703_10202115 3300026035 Unclassified 1766
237 Ga0207639_10727188 3300026041 Unclassified 922
238 Ga0207678_10003264 3300026067 Bacteria 14641
239 Ga0207678_10013246 3300026067 Bacteria 7237
240 Ga0207678_10024610 3300026067 Bacteria 5259
241 Ga0207678_10202659 3300026067 Bacteria 1697
242 Ga0207702_10019425 3300026078 Bacteria 5622
243 Ga0207702_10212503 3300026078 Unclassified 1799
244 Ga0207641_10047089 3300026088 Bacteria 3636
245 Ga0207641_10188519 3300026088 Bacteria 1894
246 Ga0207641_10231936 3300026088 Bacteria 1716
247 Ga0207676_10007954 3300026095 Bacteria 7539
248 Ga0207676_10029636 3300026095 Unclassified 4100
249 Ga0207676_10234803 3300026095 Bacteria 1641
250 Ga0207676_10425382 3300026095 Unclassified 1246
251 Ga0207674_10067211 3300026116 Bacteria 3609
252 Ga0207674_10204176 3300026116 Bacteria 1926
253 Ga0207674_10438417 3300026116 Bacteria 1263
254 Ga0207683_10002536 3300026121 Bacteria 15941
255 Ga0207683_10021162 3300026121 Bacteria 5567
256 Ga0207683_10046428 3300026121 Unclassified 3801
257 Ga0207683_10116927 3300026121 Bacteria 2391
258 Ga0207683_10251601 3300026121 Unclassified 1612
259 Ga0207698_10009963 3300026142 Bacteria 6080
260 Ga0207698_10048253 3300026142 Unclassified 3231
261 Ga0268266_10074634 3300028379 Plasmid 2945
262 Ga0268266_10088211 3300028379 Bacteria 2715
263 Ga0268266_10137132 3300028379 Unclassified 2192
264 Ga0268265_10117544 3300028380 Bacteria 2184
265 Ga0307408_100063445 3300031548 Unclassified 2703
266 Ga0307408_100215759 3300031548 Unclassified 1562
267 Ga0307408_100303112 3300031548 Unclassified 1339
268 Ga0307405_10081898 3300031731 Unclassified 2111
269 Ga0307405_10253676 3300031731 Bacteria 1310
270 Ga0307413_10114615 3300031824 Bacteria 1812
271 Ga0307410_10018254 3300031852 Bacteria 4236
272 Ga0307410_10180811 3300031852 Unclassified 1596
273 Ga0307410_10240618 3300031852 Bacteria 1402
274 Ga0307406_10101412 3300031901 Unclassified 1961
275 Ga0307412_10066033 3300031911 Unclassified 2451
276 Ga0307412_10700724 3300031911 Bacteria 869
277 Ga0307416_100009112 3300032002 Bacteria 6468
278 Ga0307416_100079034 3300032002 Unclassified 2770
279 Ga0307416_100161728 3300032002 Unclassified 2070
280 Ga0307414_10250593 3300032004 Bacteria 1472
281 Ga0307411_10051755 3300032005 Bacteria 2681
282 Ga0307411_10074530 3300032005 Unclassified 2313
283 Ga0307415_100018520 3300032126 Bacteria 4208
284 Ga0307415_100050004 3300032126 Bacteria 2830
285 Ga0307415_100705607 3300032126 Unclassified 911
286 Ga0373927_0087943 3300035695 Bacteria 2017
287 Ga0395899_0000274 3300037312 Bacteria 67210
288 Ga0395899_0002261 3300037312 Bacteria 15752
289 Ga0395899_0012400 3300037312 Bacteria 6529
290 Ga0395899_0014700 3300037312 Bacteria 5973
291 Ga0395899_0015415 3300037312 Bacteria 5826
292 Ga0395899_0170706 3300037312 Bacteria 1532
293 Ga0395899_0254939 3300037312 Bacteria 1202
294 Ga0395899_0501442 3300037312 Bacteria 787
295 Ga0395900_0000595 3300037418 Bacteria 49632
296 Ga0395900_0004150 3300037418 Bacteria 15419
297 Ga0395900_0009492 3300037418 Bacteria 9975
298 Ga0395900_0012141 3300037418 Bacteria 8801
299 Ga0395900_0019526 3300037418 Bacteria 6909
300 Ga0395900_0021697 3300037418 Bacteria 6566
301 Ga0395900_0032009 3300037418 Bacteria 5406
302 Ga0395900_0053668 3300037418 Bacteria 4148
303 Ga0395900_0061474 3300037418 Unclassified 3861
304 Ga0395900_0069099 3300037418 Bacteria 3630
305 Ga0395900_0094415 3300037418 Unclassified 3072
306 Ga0395900_0112993 3300037418 Unclassified 2788
307 Ga0395900_0128824 3300037418 Unclassified 2594
308 Ga0395900_0182564 3300037418 Bacteria 2131
309 Ga0395900_0192235 3300037418 Unclassified 2069
310 Ga0395900_0222167 3300037418 Viruses 1903
311 Ga0395900_0421488 3300037418 Bacteria 1295
312 Ga0395900_0466699 3300037418 Bacteria 1216
313 Ga0395900_0507423 3300037418 Unclassified 1156
314 Ga0395900_0559446 3300037418 Bacteria 1087
315 Ga0395898_0000087 3300037466 Bacteria 239211
316 Ga0395898_0005114 3300037466 Bacteria 14209
317 Ga0395898_0006829 3300037466 Bacteria 12138
318 Ga0395898_0024914 3300037466 Bacteria 6031
319 Ga0395898_0026720 3300037466 Bacteria 5802
320 Ga0395898_0028182 3300037466 Bacteria 5632
321 Ga0395898_0034810 3300037466 Bacteria 5013
322 Ga0395898_0055067 3300037466 Bacteria 3879
323 Ga0395898_0127100 3300037466 Bacteria 2442
324 Ga0395898_0161732 3300037466 Unclassified 2141
325 Ga0395898_0205883 3300037466 Unclassified 1877
326 Ga0395898_0242652 3300037466 Bacteria 1718
327 Ga0395898_0568767 3300037466 Bacteria 1076
328 Ga0395898_0713916 3300037466 Bacteria 944
329 Ga0395905_0000005 3300037471 Bacteria 557808
330 Ga0395905_0002328 3300037471 Bacteria 21216
331 Ga0395905_0003746 3300037471 Bacteria 16115
332 Ga0395905_0006198 3300037471 Bacteria 12067
333 Ga0395905_0010952 3300037471 Bacteria 8777
334 Ga0395905_0011179 3300037471 Bacteria 8679
335 Ga0395905_0017479 3300037471 Bacteria 6808
336 Ga0395905_0020706 3300037471 Bacteria 6228
337 Ga0395905_0025512 3300037471 Bacteria 5574
338 Ga0395905_0028988 3300037471 Bacteria 5217
339 Ga0395905_0034430 3300037471 Unclassified 4756
340 Ga0395905_0036265 3300037471 Bacteria 4631
341 Ga0395905_0045310 3300037471 Unclassified 4125
342 Ga0395905_0064924 3300037471 Bacteria 3417
343 Ga0395905_0091485 3300037471 Bacteria 2852
344 Ga0395905_0121272 3300037471 Bacteria 2457
345 Ga0395905_0137976 3300037471 Bacteria 2294
346 Ga0395905_0243199 3300037471 Viruses 1681
347 Ga0395905_0268877 3300037471 Bacteria 1590
348 Ga0395905_0309714 3300037471 Bacteria 1467
349 Ga0395905_0412183 3300037471 Unclassified 1246
350 Ga0395905_0439830 3300037471 Unclassified 1201
351 Ga0395905_0525702 3300037471 Unclassified 1083
352 Ga0395905_0579488 3300037471 Unclassified 1023
353 Ga0395901_0001391 3300038443 Bacteria 25281
354 Ga0395901_0005012 3300038443 Bacteria 13368
355 Ga0395901_0005682 3300038443 Bacteria 12622
356 Ga0395901_0008570 3300038443 Bacteria 10334
357 Ga0395901_0012026 3300038443 Bacteria 8780
358 Ga0395901_0012920 3300038443 Bacteria 8471
359 Ga0395901_0014443 3300038443 Bacteria 8036
360 Ga0395901_0031335 3300038443 Bacteria 5483
361 Ga0395901_0034344 3300038443 Bacteria 5237
362 Ga0395901_0034381 3300038443 Bacteria 5234
363 Ga0395901_0037861 3300038443 Unclassified 4987
364 Ga0395901_0219510 3300038443 Bacteria 1987
365 Ga0395901_0371822 3300038443 Unclassified 1472
366 Ga0395901_0555126 3300038443 Bacteria 1163
367 Ga0395901_0823727 3300038443 Bacteria 915
368 Ga0395901_1058379 3300038443 Unclassified 784
369 Ga0436365_0736792 3300039437 Bacteria 14837
370 Ga0439448_0003296 3300042005 Bacteria 4464
371 Ga0439432_116247 3300042006 Unclassified 794
372 Ga0439455_0045330 3300042012 Unclassified 1136
373 Ga0439458_0000082 3300042157 Bacteria 17715
374 Ga0439458_0001374 3300042157 Bacteria 6143
375 Ga0439458_0064363 3300042157 Unclassified 919
376 Ga0466969_0324341 3300044656 Unclassified 697
377 Ga0466966_0427624 3300044684 Bacteria 796
378 Ga0466961_0062322 3300044693 Bacteria 2370
379 Ga0466961_0124454 3300044693 Bacteria 1618
380 Ga0466963_0202006 3300044694 Bacteria 1390
381 Ga0466963_0602404 3300044694 Bacteria 776
382 Ga0466964_0018603 3300044706 Bacteria 2667
383 Ga0466970_0005298 3300044765 Bacteria 6393
384 Ga0466970_0009215 3300044765 Unclassified 4981
385 Ga0466957_0181844 3300044842 Unclassified 1373
386 Ga0466959_0022708 3300045049 Bacteria 4639
387 Ga0466959_0303826 3300045049 Unclassified 1092
388 Ga0466959_0419524 3300045049 Bacteria 908
389 Ga0466958_0014628 3300045836 Bacteria 4480
390 Ga0466958_0077446 3300045836 Bacteria 2042
391 Ga0466958_0230164 3300045836 Bacteria 1183
392 Ga0466967_0196212 3300045976 Bacteria 1910
393 Ga0495643_0035553 3300046522 Unclassified 2743
394 Ga0495642_0116670 3300046528 Unclassified 1144
395 Ga0495621_0028286 3300046539 Unclassified 1905
396 Ga0495633_0176209 3300046558 Unclassified 985
397 Ga0495669_0000706 3300046684 Bacteria 14559
398 Ga0495669_0001241 3300046684 Bacteria 10595
399 Ga0495677_0028792 3300047445 Bacteria 2019
400 Ga0496100_0096807 3300048903 Bacteria 2025
401 Ga0496100_0537525 3300048903 Unclassified 903
402 Ga0496101_0023068 3300048904 Bacteria 4294
403 Ga0496107_0101443 3300048910 Bacteria 2110
404 Ga0496109_0037881 3300048912 Bacteria 4358
405 Ga0496110_0003415 3300048913 Bacteria 12149
406 Ga0496112_0052100 3300048915 Bacteria 4016
407 Ga0496112_0076194 3300048915 Unclassified 3317
408 Ga0496114_0329602 3300048917 Unclassified 1349
409 Ga0496115_0040388 3300048918 Unclassified 3709
410 Ga0501201_007951 3300049651 Unclassified 1018
411 Ga0501217_021556 3300049661 Unclassified 1522
412 Ga0501235_001852 3300049669 Bacteria 4524
413 Ga0501239_002286 3300049672 Unclassified 1726
414 Ga0501249_027414 3300049679 Unclassified 1260
415 Ga0501250_009504 3300049680 Unclassified 1096
416 Ga0501253_011420 3300049683 Unclassified 1364
417 Ga0501258_004097 3300049687 Unclassified 1365
418 Ga0501221_009292 3300049704 Bacteria 1723
419 Ga0501225_0035178 3300049705 Unclassified 1379
420 Ga0501229_012057 3300049706 Unclassified 1101
421 Ga0501234_016537 3300049707 Unclassified 1164
422 2896429565 2896429255 Bacteria 2557483
423 Ga0070670_100068780
424 JGI24735J21928_10053489
425 rootL2_10178467
426 Ga0070658_10014784
427 Ga0070658_10027650
428 Ga0070658_10070176
429 Ga0070658_10595383
430 Ga0070658_10616455
431 Ga0070676_10345848
432 Ga0070683_100016104
433 Ga0070690_100078798
434 Ga0070670_100000482
435 Ga0070670_100013946
436 Ga0070670_100120620
437 Ga0070670_100308247
438 Ga0070677_10219894
439 Ga0070666_10025157
440 Ga0070666_10027996
441 Ga0070666_10044734
442 Ga0070666_10184203
443 Ga0070680_100035425
444 Ga0068868_100068952
445 Ga0068868_100079365
446 Ga0068868_100321489
447 Ga0070660_100007812
448 Ga0070660_100011819
449 Ga0070660_100019162
450 Ga0070660_100079348
451 Ga0070660_100085989
452 Ga0070660_100245774
453 Ga0070660_100272305
454 Ga0070661_100002823
455 Ga0070661_100003992
456 Ga0070661_100104388
457 Ga0070661_100272873
458 Ga0070661_100283564
459 Ga0070692_10020700
460 Ga0070675_100000877
461 Ga0070675_100002093
462 Ga0070671_100000585
463 Ga0070671_100003827
464 Ga0070671_100037502
465 Ga0070671_100045653
466 Ga0070671_100289257
467 Ga0070674_100234510
468 Ga0070673_100004985
469 Ga0070673_100100294
470 Ga0070673_100169667
471 Ga0070659_100007018
472 Ga0070659_100012286
473 Ga0070667_100003311
474 Ga0070667_100081475
475 Ga0070667_100226411
476 Ga0070714_100120757
477 Ga0070714_100156329
478 Ga0070714_100299145
479 Ga0070713_100123284
480 Ga0070663_100062121
481 Ga0070663_100357632
482 Ga0070663_100617790
483 Ga0070678_100011216
484 Ga0070678_100060622
485 Ga0070678_100085251
486 Ga0070678_100129322
487 Ga0070662_100017163
488 Ga0070662_100037197
489 Ga0070662_100057498
490 Ga0070662_100064145
491 Ga0070662_100098222
492 Ga0070662_100129167
493 Ga0068867_100097902
494 Ga0070685_10363933
495 Ga0070679_100042382
496 Ga0070684_100868430
497 Ga0068853_100046247
498 Ga0070672_100001022
499 Ga0070672_100031012
500 Ga0070672_100117629
501 Ga0070672_100434695
502 Ga0070665_100001865
503 Ga0070665_100032641
504 Ga0070665_100155454
505 Ga0068855_100005824
506 Ga0068855_100006659
507 Ga0068855_100019199
508 Ga0068855_100199319
509 Ga0068855_100356827
510 Ga0068855_100665269
511 Ga0070664_100000161
512 Ga0070664_100012603
513 Ga0070664_100079788
514 Ga0070664_100086527
515 Ga0070664_100316931
516 Ga0070664_100339857
517 Ga0068857_100360380
518 Ga0068857_100594760
519 Ga0068854_100012828
520 Ga0068854_100111384
521 Ga0068854_100296963
522 Ga0068856_100010684
523 Ga0068856_100023749
524 Ga0068856_100122888
525 Ga0068852_100014915
526 Ga0068852_100199957
527 Ga0068852_100340190
528 Ga0068852_101001457
529 Ga0068859_101067235
530 Ga0068864_100048368
531 Ga0068864_100107289
532 Ga0068864_100134729
533 Ga0068864_100210423
534 Ga0068866_10039294
535 Ga0068863_100068000
536 Ga0068863_100265535
537 Ga0068858_100070725
538 Ga0068858_100096630
539 Ga0068862_100096682
540 Ga0081539_10066111
541 Ga0070717_10439113
542 Ga0097621_100013198
543 Ga0097621_100030868
544 Ga0097621_100735381
545 Ga0068871_100137333
546 Ga0068871_100156692
547 Ga0068865_100009762
548 Ga0097620_101067107
549 Ga0105240_10154718
550 Ga0105240_10180308
551 Ga0105243_11008688
552 Ga0105248_10000864
553 Ga0105248_10001731
554 Ga0105248_10030620
555 Ga0105248_10079884
556 Ga0105248_10082992
557 Ga0105238_10482303
558 Ga0105239_10833286
559 Ga0105246_10541509
560 Ga0157373_10108143
561 Ga0157373_10457406
562 Ga0157371_10263852
563 Ga0157370_10077871
564 Ga0157370_10127572
565 Ga0157370_10382004
566 Ga0157369_10002126
567 Ga0157369_10071353
568 Ga0157369_10103523
569 Ga0157369_10154858
570 Ga0157369_10210256
571 Ga0157369_10269826
572 Ga0157369_10578249
573 Ga0157374_10004774
574 Ga0157374_10057816
575 Ga0157378_10090576
576 Ga0157378_10127820
577 Ga0163162_10019694
578 Ga0163162_10025893
579 Ga0163162_10066915
580 Ga0157372_10099622
581 Ga0157375_10011719
582 Ga0157375_10108944
583 Ga0157375_10221272
584 Ga0157375_11049418
585 Ga0163163_10074390
586 Ga0163163_10390601
587 Ga0157379_10652903
588 Ga0163161_10234795
589 Ga0207682_10251212
590 Ga0207642_10027086
591 Ga0207680_10016580
592 Ga0207680_10032318
593 Ga0207647_10003821
594 Ga0207647_10023651
595 Ga0207705_10002169
596 Ga0207705_10064802
597 Ga0207705_10158997
598 Ga0207695_10306590
599 Ga0207657_10034506
600 Ga0207657_10088734
601 Ga0207657_10212298
602 Ga0207649_10102914
603 Ga0207649_10142148
604 Ga0207649_10259831
605 Ga0207649_10358893
606 Ga0207652_10010377
607 Ga0207681_10110061
608 Ga0207681_10455189
609 Ga0207650_10003792
610 Ga0207650_10051214
611 Ga0207650_10095496
612 Ga0207659_10001593
613 Ga0207664_10173347
614 Ga0207644_10000110
615 Ga0207644_10003194
616 Ga0207644_10039149
617 Ga0207644_10054894
618 Ga0207644_10081955
619 Ga0207644_10127923
620 Ga0207644_10358744
621 Ga0207690_10004350
622 Ga0207690_10016417
623 Ga0207706_10004761
624 Ga0207706_10009871
625 Ga0207706_10011549
626 Ga0207706_10014818
627 Ga0207706_10024053
628 Ga0207706_10032192
629 Ga0207706_10131803
630 Ga0207669_10070291
631 Ga0207669_10192408
632 Ga0207704_10109804
633 Ga0207691_10022111
634 Ga0207691_10022416
635 Ga0207691_10050820
636 Ga0207691_10298260
637 Ga0207711_10005517
638 Ga0207711_10014822
639 Ga0207711_10042595
640 Ga0207711_10185352
641 Ga0207661_10055571
642 Ga0207679_10054031
643 Ga0207679_10116292
644 Ga0207679_10129361
645 Ga0207679_10140665
646 Ga0207667_10004629
647 Ga0207667_10005521
648 Ga0207667_10261591
649 Ga0207651_10008091
650 Ga0207651_10084260
651 Ga0207651_10467789
652 Ga0207640_10037699
653 Ga0207658_10304657
654 Ga0207658_10318625
655 Ga0207677_10083595
656 Ga0207677_10318842
657 Ga0207703_10091420
658 Ga0207703_10202115
659 Ga0207639_10727188
660 Ga0207678_10003264
661 Ga0207678_10013246
662 Ga0207678_10024610
663 Ga0207678_10202659
664 Ga0207702_10019425
665 Ga0207702_10212503
666 Ga0207641_10047089
667 Ga0207641_10188519
668 Ga0207641_10231936
669 Ga0207676_10007954
670 Ga0207676_10029636
671 Ga0207676_10234803
672 Ga0207676_10425382
673 Ga0207674_10067211
674 Ga0207674_10204176
675 Ga0207674_10438417
676 Ga0207683_10002536
677 Ga0207683_10021162
678 Ga0207683_10046428
679 Ga0207683_10116927
680 Ga0207683_10251601
681 Ga0207698_10009963
682 Ga0207698_10048253
683 Ga0268266_10074634
684 Ga0268266_10088211
685 Ga0268266_10137132
686 Ga0268265_10117544
687 Ga0307408_100063445
688 Ga0307408_100215759
689 Ga0307408_100303112
690 Ga0307405_10081898
691 Ga0307405_10253676
692 Ga0307413_10114615
693 Ga0307410_10018254
694 Ga0307410_10180811
695 Ga0307410_10240618
696 Ga0307406_10101412
697 Ga0307412_10066033
698 Ga0307412_10700724
699 Ga0307416_100009112
700 Ga0307416_100079034
701 Ga0307416_100161728
702 Ga0307414_10250593
703 Ga0307411_10051755
704 Ga0307411_10074530
705 Ga0307415_100018520
706 Ga0307415_100050004
707 Ga0307415_100705607
708 Ga0373927_0087943
709 Ga0395899_0000274
710 Ga0395899_0002261
711 Ga0395899_0012400
712 Ga0395899_0014700
713 Ga0395899_0015415
714 Ga0395899_0170706
715 Ga0395899_0254939
716 Ga0395899_0501442
717 Ga0395900_0000595
718 Ga0395900_0004150
719 Ga0395900_0009492
720 Ga0395900_0012141
721 Ga0395900_0019526
722 Ga0395900_0021697
723 Ga0395900_0032009
724 Ga0395900_0053668
725 Ga0395900_0061474
726 Ga0395900_0069099
727 Ga0395900_0094415
728 Ga0395900_0112993
729 Ga0395900_0128824
730 Ga0395900_0182564
731 Ga0395900_0192235
732 Ga0395900_0222167
733 Ga0395900_0421488
734 Ga0395900_0466699
735 Ga0395900_0507423
736 Ga0395900_0559446
737 Ga0395898_0000087
738 Ga0395898_0005114
739 Ga0395898_0006829
740 Ga0395898_0024914
741 Ga0395898_0026720
742 Ga0395898_0028182
743 Ga0395898_0034810
744 Ga0395898_0055067
745 Ga0395898_0127100
746 Ga0395898_0161732
747 Ga0395898_0205883
748 Ga0395898_0242652
749 Ga0395898_0568767
750 Ga0395898_0713916
751 Ga0395905_0000005
752 Ga0395905_0002328
753 Ga0395905_0003746
754 Ga0395905_0006198
755 Ga0395905_0010952
756 Ga0395905_0011179
757 Ga0395905_0017479
758 Ga0395905_0020706
759 Ga0395905_0025512
760 Ga0395905_0028988
761 Ga0395905_0034430
762 Ga0395905_0036265
763 Ga0395905_0045310
764 Ga0395905_0064924
765 Ga0395905_0091485
766 Ga0395905_0121272
767 Ga0395905_0137976
768 Ga0395905_0243199
769 Ga0395905_0268877
770 Ga0395905_0309714
771 Ga0395905_0412183
772 Ga0395905_0439830
773 Ga0395905_0525702
774 Ga0395905_0579488
775 Ga0395901_0001391
776 Ga0395901_0005012
777 Ga0395901_0005682
778 Ga0395901_0008570
779 Ga0395901_0012026
780 Ga0395901_0012920
781 Ga0395901_0014443
782 Ga0395901_0031335
783 Ga0395901_0034344
784 Ga0395901_0034381
785 Ga0395901_0037861
786 Ga0395901_0219510
787 Ga0395901_0371822
788 Ga0395901_0555126
789 Ga0395901_0823727
790 Ga0395901_1058379
791 Ga0436365_0736792
792 Ga0439448_0003296
793 Ga0439432_116247
794 Ga0439455_0045330
795 Ga0439458_0000082
796 Ga0439458_0001374
797 Ga0439458_0064363
798 Ga0466969_0324341
799 Ga0466966_0427624
800 Ga0466961_0062322
801 Ga0466961_0124454
802 Ga0466963_0202006
803 Ga0466963_0602404
804 Ga0466964_0018603
805 Ga0466970_0005298
806 Ga0466970_0009215
807 Ga0466957_0181844
808 Ga0466959_0022708
809 Ga0466959_0303826
810 Ga0466959_0419524
811 Ga0466958_0014628
812 Ga0466958_0077446
813 Ga0466958_0230164
814 Ga0466967_0196212
815 Ga0495643_0035553
816 Ga0495642_0116670
817 Ga0495621_0028286
818 Ga0495633_0176209
819 Ga0495669_0000706
820 Ga0495669_0001241
821 Ga0495677_0028792
822 Ga0496100_0096807
823 Ga0496100_0537525
824 Ga0496101_0023068
825 Ga0496107_0101443
826 Ga0496109_0037881
827 Ga0496110_0003415
828 Ga0496112_0052100
829 Ga0496112_0076194
830 Ga0496114_0329602
831 Ga0496115_0040388
832 Ga0501201_007951
833 Ga0501217_021556
834 Ga0501235_001852
835 Ga0501239_002286
836 Ga0501249_027414
837 Ga0501250_009504
838 Ga0501253_011420
839 Ga0501258_004097
840 Ga0501221_009292
841 Ga0501225_0035178
842 Ga0501229_012057
843 Ga0501234_016537
844 2896429565

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11984

DUF3485

Protein of unknown function (DUF3485)

19

225

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3jva-assembly1.cif.gz_G crystal structure of dipeptide epimerase from enterococcus faecalis v583 0.6554 126 158
6xrr-assembly2.cif.gz_B structure of sciw bound to the rhs1 transmembrane domain from salmonella typhimurium 0.5116 96 212
3hlz-assembly1.cif.gz_A crystal structure of bt_1490 (np_810393.1) from bacteroides thetaiotaomicron vpi-5482 at 1.50 a resolution 0.5086 58 215
2xb3-assembly1.cif.gz_A the structure of cyanobacterial psbp 0.5038 58 216
6e8a-assembly2.cif.gz_B-2 crystal structure of dcrb from salmonella enterica at 1.92 angstroms resolution 0.4918 60 216
ID Description Score Start End Superfamily
2pgeA01 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain 0.6241 124 158 3.30.390.10
1qlmA02 Alpha Beta;2-Layer Sandwich;Methenyltetrahydromethanopterin Cyclohydrolase; Chain A, domain 2;Methenyltetrahydromethanopterin Cyclohydrolase; Chain A, domain 2 0.6146 116 148 3.30.1030.10
af_P34298_11_298_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.6074 126 158 1.20.140.150
af_Q4CZH8_102_268_3.40.1000.10 Alpha Beta;3-Layer(aba) Sandwich;Protein Transport Mog1p; Chain A;Mog1/PsbP, alpha/beta/alpha sandwich 0.5832 83 222 3.40.1000.10
af_A0A0P0XF80_79_240_3.40.1000.10 Alpha Beta;3-Layer(aba) Sandwich;Protein Transport Mog1p; Chain A;Mog1/PsbP, alpha/beta/alpha sandwich 0.5795 57 215 3.40.1000.10
ID Description Score Start End GO Terms
AF-A0A6G7YQV0-F1-model_v4 EpsI family protein 0.9474 9 230
AF-A0A161JR89-F1-model_v4 deleted 0.9387 97 230
AF-A0A1E4I745-F1-model_v4 EpsI family protein 0.9324 25 230
AF-A0A2T4I6Z0-F1-model_v4 EpsI family protein 0.929 1 229
AF-A0A0Q5R8J1-F1-model_v4 Methanolan biosynthesis protein EpsI 0.926 19 229

Map