F440110

General Info

Members Datasets Scaffolds Average Seq Length
421 345 156 387

Family's Representative Sequence

Representative Sequence 3300049568|Ga0501031_0083447|Ga0501031_0083447_278_1486
Length 402
Sequence MAETKQETSRPFRLAVVAGEESGDLLGADLVRALQRLTGRTVQLAGVGGRHLGELGLSSIFDAGDIALVGVSAVLRDLPRLLRRIGQAADAIVAQKPDCLVTIDSPDFALRVARKVRAADPSIPIVHYVCPSVWAWRPGRAAAMRDHVDRILCLLPFEPAELERLGGPEGVYVGHRLTRDADVDAAAAMQAAPRDLSPEREKTLLLLPGSRRGEVRRLIEPFGETVSVLASRGHRLRLLLPTVPHVADLVRDAVAGWAHRPQILIEAQDKWRAFGEADAALIASGTVSLELAMSGVPMVSTYRLDPVMRMAQGLITTWSALLPNLIADRPVVPEFYDRYVRPQNLARHLEALFVESGMRAWQKDGFAEVRRRMETDRPAGDLAAEAVMGVVRQSATGSRQSG

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
3 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
4 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
5 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
6 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
7 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
8 2512875024 Mesorhizobium loti R88b Isolate Nodule
9 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
10 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
11 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
12 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
13 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
14 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
15 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
16 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
17 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
18 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
19 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
20 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
21 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
22 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
23 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
24 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
25 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
26 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
27 2738543024 Aminobacter sp. AP02 Isolate Unclassified
28 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
29 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
30 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
31 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
32 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
33 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
34 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
35 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
36 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
37 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
38 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
39 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
40 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
41 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
42 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
43 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
44 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
45 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
46 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
47 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
48 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
49 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
50 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
51 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
52 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
53 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
54 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
55 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
56 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
57 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
58 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
59 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
60 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
61 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
62 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
63 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
64 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
65 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
66 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
67 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
68 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
69 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
70 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
71 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
72 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
73 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
74 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
75 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
76 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
77 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
78 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
79 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
80 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
81 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
82 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
83 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
84 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
85 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
86 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
87 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
88 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
89 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
90 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
91 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
92 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
93 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
94 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
95 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
96 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
97 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
98 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
99 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
100 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
101 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
102 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
103 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
104 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
105 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
106 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
107 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
108 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
109 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
110 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
111 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
112 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
113 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
114 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
115 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
116 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
117 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
118 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
119 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
120 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
121 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
122 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
123 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
124 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
125 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
126 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
127 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
128 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
129 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
130 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
131 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
132 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
133 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
134 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
135 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
136 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
137 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
138 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
139 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
140 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
141 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
142 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
143 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
144 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
145 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
146 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
147 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
148 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
149 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
150 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
151 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
152 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
153 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
154 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
155 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
156 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
157 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
158 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
159 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
160 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
161 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
162 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
163 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
164 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
165 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
166 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
167 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
168 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
169 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
170 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
171 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
172 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
173 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
174 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
175 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
176 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
177 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
178 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
179 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
180 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
181 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
182 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
183 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
184 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
185 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
186 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
187 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
188 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
189 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
190 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
191 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
192 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
193 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
194 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
195 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
196 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
197 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
198 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
199 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
200 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
201 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
202 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
203 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
204 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
205 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
206 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
207 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
208 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
209 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
210 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
211 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
212 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
213 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
214 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
215 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
216 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
217 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
218 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
219 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
220 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
221 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
222 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
223 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
224 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
225 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
226 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
227 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
228 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
229 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
230 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
231 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
232 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
233 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
234 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
235 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
236 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
237 3004167301 Mesorhizobium loti 582 Isolate Unclassified
238 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
239 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
240 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
241 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
242 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
243 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
244 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
245 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
246 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
247 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
248 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
249 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
250 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
251 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
252 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
253 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
254 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
255 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
256 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
257 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
258 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
259 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
260 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
261 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
262 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
263 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
264 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
265 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
266 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
267 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
268 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
269 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
270 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
271 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
272 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
273 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
274 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
275 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
276 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
277 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
283 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
284 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
287 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
288 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
289 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
290 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
291 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
292 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
293 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
294 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
295 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
296 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
297 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
298 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
299 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
300 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
301 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
302 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
303 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
304 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
306 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
308 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
309 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
310 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
311 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
312 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
313 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
314 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
315 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
316 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
317 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
318 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
319 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
320 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
321 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
322 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
323 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
324 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
325 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
326 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
327 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
328 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
329 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
330 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
331 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
332 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
333 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
334 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
335 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
336 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
337 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
338 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
339 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
340 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
341 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
342 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
343 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
344 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
345 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 37.05
Metatranscriptomes 0
Isolates 62.95

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.75
Nodule 51.54
Rhizoplane 1.43
Rhizosphere 32.07
Stem 0
Stem Tuber 0
Unclassified 10.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25157J39369_1000723 3300002741 Bacteria 17621
2 JGI25165J46597_1000033 3300003214 Bacteria 293030
3 Ga0070660_100125861 3300005339 Bacteria 2048
4 Ga0070663_100008612 3300005455 Bacteria 6286
5 Ga0070663_100070536 3300005455 Bacteria 2541
6 Ga0068853_100041006 3300005539 Bacteria 3952
7 Ga0070665_100008269 3300005548 Bacteria 10521
8 Ga0070665_100068934 3300005548 Bacteria 3545
9 Ga0070665_100463976 3300005548 Bacteria 1277
10 Ga0068863_100397162 3300005841 Bacteria 1348
11 Ga0075365_10010409 3300006038 Bacteria 5416
12 Ga0075365_10108338 3300006038 Bacteria 1908
13 Ga0075363_100018221 3300006048 Bacteria 3494
14 Ga0075363_100110659 3300006048 Bacteria 1527
15 Ga0075364_10030480 3300006051 Bacteria 3462
16 Ga0075367_10025564 3300006178 Bacteria 3340
17 Ga0075369_10018606 3300006186 Bacteria 2830
18 Ga0105240_10224145 3300009093 Bacteria 2188
19 Ga0105245_10382964 3300009098 Bacteria 1401
20 Ga0105237_10055984 3300009545 Bacteria 3949
21 Ga0105238_10094317 3300009551 Bacteria 2980
22 Ga0105238_10098245 3300009551 Bacteria 2912
23 Ga0105238_10164249 3300009551 Bacteria 2196
24 Ga0105239_10035083 3300010375 Bacteria 5509
25 Ga0157369_10229350 3300013105 Bacteria 1942
26 Ga0157374_10111028 3300013296 Bacteria 2637
27 Ga0182008_10035493 3300014497 Bacteria 2497
28 Ga0157376_10100548 3300014969 Bacteria 2525
29 Ga0182007_10033297 3300015262 Bacteria 1747
30 Ga0209026_1000002 3300025250 Bacteria 1136158
31 Ga0209677_111506 3300025253 Bacteria 1377
32 Ga0209148_1000072 3300025254 Bacteria 325292
33 Ga0209759_1000146 3300025256 Bacteria 121497
34 Ga0209233_1000027 3300025261 Bacteria 652089
35 Ga0209455_1000133 3300025272 Bacteria 155670
36 Ga0209758_1004563 3300025297 Bacteria 11425
37 Ga0207705_10110877 3300025909 Bacteria 2027
38 Ga0207654_10082791 3300025911 Bacteria 1936
39 Ga0207654_10163112 3300025911 Bacteria 1441
40 Ga0207695_10058029 3300025913 Bacteria 4019
41 Ga0207671_10055761 3300025914 Bacteria 2928
42 Ga0207657_10120313 3300025919 Bacteria 2161
43 Ga0207667_10252997 3300025949 Bacteria 1802
44 Ga0207639_10077995 3300026041 Bacteria 2613
45 Ga0207678_10020509 3300026067 Bacteria 5794
46 Ga0207678_10029629 3300026067 Bacteria 4779
47 Ga0268266_10047589 3300028379 Bacteria 3675
48 Ga0268266_10049090 3300028379 Bacteria 3618
49 Ga0268266_10279886 3300028379 Bacteria 1551
50 Ga0395899_0000398 3300037312 Bacteria 51631
51 Ga0395900_0000121 3300037418 Bacteria 135026
52 Ga0395900_0064054 3300037418 Bacteria 3779
53 Ga0395898_0000247 3300037466 Bacteria 135026
54 Ga0395905_0000112 3300037471 Bacteria 135010
55 Ga0395905_0033440 3300037471 Bacteria 4830
56 Ga0395905_0060082 3300037471 Bacteria 3554
57 Ga0395901_0000078 3300038443 Bacteria 135026
58 Ga0395901_0049597 3300038443 Bacteria 4362
59 Ga0439465_0014756 3300041413 Bacteria 2437
60 Ga0495638_0091476 3300046460 Bacteria 1832
61 Ga0495643_0064858 3300046522 Bacteria 1929
62 Ga0495597_0111160 3300046542 Bacteria 1149
63 Ga0495687_038530 3300047443 Bacteria 2121
64 Ga0496102_0196088 3300048905 Bacteria 1903
65 Ga0496109_0206665 3300048912 Bacteria 1846
66 Ga0496112_0054278 3300048915 Bacteria 3937
67 Ga0496118_0104219 3300048921 Bacteria 1905
68 Ga0496120_0003082 3300048923 Bacteria 15709
69 Ga0496120_0045208 3300048923 Bacteria 2552
70 Ga0496121_0106521 3300048924 Bacteria 2149
71 Ga0496126_0097058 3300048929 Bacteria 2583
72 Ga0501031_0000194 3300049568 Bacteria 34317
73 Ga0501031_0032883 3300049568 Bacteria 3382
74 Ga0501031_0083447 3300049568 Bacteria 2082
75 Ga0501031_0262894 3300049568 Bacteria 1121
76 Ga0501032_0000084 3300049569 Bacteria 82148
77 Ga0501032_0000117 3300049569 Bacteria 67270
78 Ga0501032_0002091 3300049569 Bacteria 15738
79 Ga0501032_0036484 3300049569 Bacteria 3354
80 Ga0501033_0000102 3300049570 Bacteria 81583
81 Ga0501033_0000224 3300049570 Bacteria 54346
82 Ga0501033_0006694 3300049570 Bacteria 9004
83 Ga0501033_0048290 3300049570 Bacteria 3162
84 Ga0501033_0064399 3300049570 Bacteria 2697
85 Ga0501033_0076579 3300049570 Bacteria 2455
86 Ga0501033_0079428 3300049570 Bacteria 2407
87 Ga0501034_0000744 3300049571 Bacteria 49218
88 Ga0501034_0000962 3300049571 Bacteria 41541
89 Ga0501034_0095718 3300049571 Bacteria 2965
90 Ga0501034_0269506 3300049571 Bacteria 1644
91 Ga0501036_0000040 3300049572 Bacteria 81588
92 Ga0501036_0000645 3300049572 Bacteria 25508
93 Ga0501036_0125662 3300049572 Bacteria 2166
94 Ga0501036_0193577 3300049572 Bacteria 1710
95 Ga0501037_0000098 3300049573 Bacteria 81588
96 Ga0501037_0000147 3300049573 Bacteria 65415
97 Ga0501037_0001126 3300049573 Bacteria 19773
98 Ga0501037_0047876 3300049573 Bacteria 3132
99 Ga0501037_0114454 3300049573 Bacteria 1941
100 Ga0501037_0198424 3300049573 Bacteria 1419
101 Ga0501038_0000002 3300049574 Bacteria 330446
102 Ga0501038_0000307 3300049574 Bacteria 41649
103 Ga0501038_0028088 3300049574 Bacteria 4999
104 Ga0501038_0084777 3300049574 Bacteria 2665
105 Ga0501038_0115333 3300049574 Bacteria 2221
106 Ga0501039_0000002 3300049575 Bacteria 375152
107 Ga0501039_0000048 3300049575 Bacteria 102012
108 Ga0501039_0163587 3300049575 Bacteria 1749
109 Ga0501040_0047076 3300049576 Bacteria 2944
110 Ga0501043_0000041 3300049579 Bacteria 116876
111 Ga0501043_0003484 3300049579 Bacteria 12933
112 Ga0501043_0004586 3300049579 Bacteria 11206
113 Ga0501043_0277071 3300049579 Bacteria 1286
114 Ga0501047_0004818 3300049581 Bacteria 12685
115 Ga0501047_0024046 3300049581 Bacteria 5851
116 Ga0501047_0201251 3300049581 Bacteria 1852
117 Ga0501067_0011732 3300049583 Bacteria 4855
118 Ga0501069_0000018 3300049585 Bacteria 133550
119 Ga0501069_0063971 3300049585 Bacteria 2055
120 Ga0501070_0000222 3300049586 Bacteria 54032
121 Ga0501070_0024243 3300049586 Bacteria 5088
122 Ga0501070_0031192 3300049586 Bacteria 4465
123 Ga0501070_0158330 3300049586 Bacteria 1867
124 Ga0501073_0014351 3300049589 Bacteria 5756
125 Ga0501074_0000001 3300049590 Bacteria 123588
126 Ga0501074_0095716 3300049590 Bacteria 2126
127 Ga0501080_0000456 3300049742 Bacteria 31663
128 Ga0501080_0000753 3300049742 Bacteria 26231
129 Ga0501080_0043984 3300049742 Bacteria 4158
130 Ga0501083_0000079 3300049744 Bacteria 64984
131 Ga0501035_0000061 3300049822 Bacteria 131658
132 Ga0501035_0000163 3300049822 Bacteria 81898
133 Ga0501035_0000953 3300049822 Bacteria 30602
134 Ga0501035_0001988 3300049822 Bacteria 20436
135 Ga0501035_0014704 3300049822 Bacteria 7224
136 Ga0501035_0015079 3300049822 Bacteria 7130
137 Ga0501035_0089127 3300049822 Bacteria 2717
138 Ga0501035_0194915 3300049822 Bacteria 1740
139 Ga0501035_0211480 3300049822 Bacteria 1659
140 Ga0501044_0000002 3300049823 Bacteria 375152
141 Ga0501044_0000003 3300049823 Bacteria 345647
142 Ga0501044_0026050 3300049823 Bacteria 6193
143 Ga0501044_0031442 3300049823 Bacteria 5588
144 Ga0501044_0054348 3300049823 Bacteria 4117
145 Ga0501044_0079923 3300049823 Bacteria 3312
146 Ga0501044_0227820 3300049823 Bacteria 1812
147 Ga0501044_0237971 3300049823 Bacteria 1765
148 nmdc:mga03n38_96945_c1 3300050490 Bacteria 1415
149 nmdc:mga0yw44_14524_c1 3300050492 Bacteria 4186
150 nmdc:mga0yw44_165509_c1 3300050492 Bacteria 1449
151 nmdc:mga0sz30_28719_c1 3300050516 Bacteria 2290
152 Ga0500610_0042654 3300053079 Bacteria 2348
153 Ga0500620_001820 3300053155 Bacteria 4082
154 Ga0500620_001912 3300053155 Bacteria 4021
155 Ga0501084_0328535 3300054114 Unclassified 1292
156 Ga0501082_0033871 3300060353 Bacteria 4406

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2871444079 2871448924 326
2 iso_pu_bacteria 2965119406 2965124508 326
3 3300049568 Ga0501031_0262894 Ga0501031_0262894_116_1108 328
4 3300046542 Ga0495597_0111160 Ga0495597_0111160_12_1001 329
5 iso_pu_bacteria 2876377896 2876383341 342
6 3300049570 Ga0501033_0079428 Ga0501033_0079428_632_1813 348
7 3300049574 Ga0501038_0115333 Ga0501038_0115333_643_1824 348
8 3300049581 Ga0501047_0024046 Ga0501047_0024046_2555_3736 348
9 3300049590 Ga0501074_0095716 Ga0501074_0095716_607_1788 348
10 3300049742 Ga0501080_0000456 Ga0501080_0000456_4957_6138 348
11 3300049822 Ga0501035_0000953 Ga0501035_0000953_27158_28339 348
12 iso_pu_bacteria 2885342637 2885349632 355
13 iso_pu_bacteria 8004395343 8004396394 356
14 3300049823 Ga0501044_0227820 Ga0501044_0227820_393_1574 359
15 3300054114 Ga0501084_0328535 Ga0501084_0328535_41_1222 359
16 3300049573 Ga0501037_0198424 Ga0501037_0198424_289_1398 361
17 3300049568 Ga0501031_0000194 Ga0501031_0000194_32728_33936 369
18 3300049569 Ga0501032_0000084 Ga0501032_0000084_32705_33913 369
19 3300049570 Ga0501033_0000102 Ga0501033_0000102_47653_48861 369
20 3300049570 Ga0501033_0048290 Ga0501033_0048290_1669_2859 369
21 3300049571 Ga0501034_0000744 Ga0501034_0000744_32603_33811 369
22 3300049572 Ga0501036_0000040 Ga0501036_0000040_47653_48861 369
23 3300049573 Ga0501037_0000098 Ga0501037_0000098_47653_48861 369
24 3300049574 Ga0501038_0000002 Ga0501038_0000002_314577_315785 369
25 3300049575 Ga0501039_0000002 Ga0501039_0000002_32728_33936 369
26 3300049576 Ga0501040_0047076 Ga0501040_0047076_369_1577 369
27 3300049579 Ga0501043_0003484 Ga0501043_0003484_11376_12584 369
28 3300049581 Ga0501047_0004818 Ga0501047_0004818_11221_12429 369
29 3300049586 Ga0501070_0031192 Ga0501070_0031192_74_1282 369
30 3300049822 Ga0501035_0000163 Ga0501035_0000163_47963_49171 369
31 3300049822 Ga0501035_0089127 Ga0501035_0089127_1267_2448 369
32 3300049823 Ga0501044_0000002 Ga0501044_0000002_341217_342425 369
33 iso_pu_bacteria 2965102966 2965109708 371
34 iso_pu_bacteria 2906378014 2906383469 382
35 iso_pu_bacteria 2643221623 2644132151 383
36 iso_pu_bacteria 2738543024 2739307964 383
37 iso_pu_bacteria 2869162929 2869166009 383
38 iso_pu_bacteria 2508501127 2509140553 384
39 iso_pu_bacteria 2513237305 2514421811 384
40 iso_pu_bacteria 2597489875 2597814009 384
41 iso_pu_bacteria 2721755686 2723576270 384
42 iso_pu_bacteria 2775506902 2776271317 384
43 iso_pu_bacteria 2775506904 2776280685 384
44 iso_pu_bacteria 2841734538 2841740105 384
45 iso_pu_bacteria 2856342000 2856343787 384
46 iso_pu_bacteria 2871474448 2871480266 384
47 iso_pu_bacteria 2871488783 2871495208 384
48 iso_pu_bacteria 2878753008 2878758126 384
49 iso_pu_bacteria 2878788777 2878792654 384
50 iso_pu_bacteria 2881155292 2881156024 384
51 iso_pu_bacteria 2881845957 2881851731 384
52 iso_pu_bacteria 2881853255 2881857693 384
53 iso_pu_bacteria 2881861095 2881861474 384
54 iso_pu_bacteria 2882632389 2882633972 384
55 iso_pu_bacteria 2882912400 2882916635 384
56 iso_pu_bacteria 2888343758 2888347550 384
57 iso_pu_bacteria 2903492973 2903496142 384
58 iso_pu_bacteria 2924784321 2924785867 384
59 iso_pu_bacteria 2937836603 2937837861 384
60 iso_pu_bacteria 2937843397 2937846977 384
61 iso_pu_bacteria 2958071322 2958077599 384
62 iso_pu_bacteria 2961127735 2961129391 384
63 iso_pu_bacteria 2961170736 2961174756 384
64 iso_pu_bacteria 2967996073 2968000691 384
65 iso_pu_bacteria 2968003550 2968009936 384
66 iso_pu_bacteria 2970503327 2970507342 384
67 iso_pu_bacteria 2970524798 2970531800 384
68 iso_pu_bacteria 2970540015 2970545058 384
69 iso_pu_bacteria 2977821940 2977828800 384
70 iso_pu_bacteria 2977828996 2977831629 384
71 iso_pu_bacteria 2977971508 2977971670 384
72 iso_pu_bacteria 2979808191 2979812538 384
73 iso_pu_bacteria 8004374579 8004379638 384
74 iso_pu_bacteria 8004633249 8004638991 384
75 iso_pu_bacteria 8055617313 8055621627 384
76 3300049822 Ga0501035_0194915 Ga0501035_0194915_371_1552 385
77 3300049823 Ga0501044_0054348 Ga0501044_0054348_2233_3414 385
78 iso_pu_bacteria 2513237351 2514590105 385
79 iso_pu_bacteria 2767802442 2770195763 385
80 iso_pu_bacteria 2885312484 2885317207 385
81 iso_pu_bacteria 2928521798 2928523393 385
82 iso_pu_bacteria 2954011201 2954015664 385
83 3300049571 Ga0501034_0269506 Ga0501034_0269506_387_1550 386
84 iso_pu_bacteria 2510065059 2510317410 386
85 iso_pu_bacteria 2512875016 2512930788 386
86 iso_pu_bacteria 2588253730 2588516451 386
87 iso_pu_bacteria 2643221595 2643989961 386
88 iso_pu_bacteria 2643221627 2644155267 386
89 iso_pu_bacteria 2756170246 2756675798 386
90 iso_pu_bacteria 2791355123 2792746009 386
91 iso_pu_bacteria 2844002411 2844006540 386
92 iso_pu_bacteria 2856320880 2856325969 386
93 iso_pu_bacteria 2869278585 2869278727 386
94 iso_pu_bacteria 2871451962 2871452883 386
95 iso_pu_bacteria 2871466892 2871470232 386
96 iso_pu_bacteria 2874139085 2874145312 386
97 iso_pu_bacteria 2874168670 2874176331 386
98 iso_pu_bacteria 2876363079 2876365541 386
99 iso_pu_bacteria 2878738818 2878743559 386
100 iso_pu_bacteria 2888337043 2888340243 386
101 iso_pu_bacteria 2889790730 2889795963 386
102 iso_pu_bacteria 2889914905 2889918680 386
103 iso_pu_bacteria 2894652903 2894654495 386
104 iso_pu_bacteria 2903448605 2903455707 386
105 iso_pu_bacteria 2903521522 2903522897 386
106 iso_pu_bacteria 2903528002 2903533087 386
107 iso_pu_bacteria 2924718760 2924722684 386
108 iso_pu_bacteria 2924776078 2924781371 386
109 iso_pu_bacteria 2937848649 2937853874 386
110 iso_pu_bacteria 2937877337 2937879083 386
111 iso_pu_bacteria 2937972304 2937975171 386
112 iso_pu_bacteria 2958034702 2958034843 386
113 iso_pu_bacteria 2958041894 2958043029 386
114 iso_pu_bacteria 2958064165 2958067087 386
115 iso_pu_bacteria 2958084443 2958086257 386
116 iso_pu_bacteria 2958092219 2958097719 386
117 iso_pu_bacteria 2958144490 2958147811 386
118 iso_pu_bacteria 2963644680 2963648438 386
119 iso_pu_bacteria 2968016561 2968017748 386
120 iso_pu_bacteria 2968083720 2968084952 386
121 iso_pu_bacteria 2970469710 2970472077 386
122 iso_pu_bacteria 2970489779 2970495918 386
123 iso_pu_bacteria 2970593180 2970593323 386
124 iso_pu_bacteria 2977922695 2977928968 386
125 iso_pu_bacteria 2996336353 2996341774 386
126 iso_pu_bacteria 2996348954 2996351009 386
127 iso_pu_bacteria 3004167301 3004169688 386
128 iso_pu_bacteria 3004211236 3004213177 386
129 iso_pu_bacteria 3004218560 3004221548 386
130 iso_pu_bacteria 3004275668 3004277707 386
131 iso_pu_bacteria 3004289098 3004293923 386
132 iso_pu_bacteria 3004334049 3004340894 386
133 iso_pu_bacteria 637000159 637073835 386
134 iso_pu_bacteria 2512875024 2512958513 387
135 iso_pu_bacteria 2513237164 2514035074 387
136 iso_pu_bacteria 2765235802 2765466156 387
137 iso_pu_bacteria 2847670302 2847670710 387
138 iso_pu_bacteria 2856314179 2856316166 387
139 iso_pu_bacteria 2878035449 2878040435 387
140 iso_pu_bacteria 2904578770 2904582690 387
141 iso_pu_bacteria 2906414383 2906416303 387
142 iso_pu_bacteria 2919119836 2919124696 387
143 iso_pu_bacteria 2996310559 2996311146 387
144 3300006038 Ga0075365_10108338 Ga0075365_101083382 388
145 3300006178 Ga0075367_10025564 Ga0075367_100255642 388
146 3300006186 Ga0075369_10018606 Ga0075369_100186062 388
147 3300037312 Ga0395899_0000398 Ga0395899_0000398_14273_15439 388
148 3300037418 Ga0395900_0000121 Ga0395900_0000121_36193_37359 388
149 3300037466 Ga0395898_0000247 Ga0395898_0000247_97668_98834 388
150 3300037471 Ga0395905_0000112 Ga0395905_0000112_97652_98818 388
151 3300038443 Ga0395901_0000078 Ga0395901_0000078_36193_37359 388
152 3300050492 nmdc:mga0yw44_14524_c1 nmdc:mga0yw44_14524_c1_2812_3978 388
153 3300050516 nmdc:mga0sz30_28719_c1 nmdc:mga0sz30_28719_c1_240_1406 388
154 iso_pu_bacteria 2508501123 2509114255 388
155 iso_pu_bacteria 2509276018 2509370446 388
156 iso_pu_bacteria 2509276022 2509396958 388
157 iso_pu_bacteria 2643221551 2643775681 388
158 iso_pu_bacteria 2643221555 2643794128 388
159 iso_pu_bacteria 2687453392 2688599326 388
160 iso_pu_bacteria 2839993093 2839995343 388
161 iso_pu_bacteria 2844009547 2844014609 388
162 iso_pu_bacteria 2856328259 2856330449 388
163 iso_pu_bacteria 2856334872 2856338740 388
164 iso_pu_bacteria 2869234852 2869238014 388
165 iso_pu_bacteria 2869264136 2869270955 388
166 iso_pu_bacteria 2871435913 2871441064 388
167 iso_pu_bacteria 2871459585 2871464979 388
168 iso_pu_bacteria 2871481445 2871488674 388
169 iso_pu_bacteria 2874109183 2874113618 388
170 iso_pu_bacteria 2874116593 2874122552 388
171 iso_pu_bacteria 2874123672 2874125897 388
172 iso_pu_bacteria 2874162495 2874164899 388
173 iso_pu_bacteria 2876386047 2876391086 388
174 iso_pu_bacteria 2876399893 2876403147 388
175 iso_pu_bacteria 2876406927 2876408183 388
176 iso_pu_bacteria 2876420981 2876421568 388
177 iso_pu_bacteria 2878730984 2878735282 388
178 iso_pu_bacteria 2878774303 2878779562 388
179 iso_pu_bacteria 2878781027 2878782399 388
180 iso_pu_bacteria 2906363423 2906369679 388
181 iso_pu_bacteria 2906370794 2906371666 388
182 iso_pu_bacteria 2906393657 2906398014 388
183 iso_pu_bacteria 2906401398 2906407438 388
184 iso_pu_bacteria 2906408224 2906412742 388
185 iso_pu_bacteria 2906427513 2906429566 388
186 iso_pu_bacteria 2922151315 2922158244 388
187 iso_pu_bacteria 2922172374 2922174139 388
188 iso_pu_bacteria 2922178524 2922181992 388
189 iso_pu_bacteria 2924710171 2924715956 388
190 iso_pu_bacteria 2924733363 2924735940 388
191 iso_pu_bacteria 2924748358 2924750727 388
192 iso_pu_bacteria 2924754689 2924757390 388
193 iso_pu_bacteria 2924762789 2924768876 388
194 iso_pu_bacteria 2937822353 2937827186 388
195 iso_pu_bacteria 2937861824 2937863915 388
196 iso_pu_bacteria 2958108152 2958109219 388
197 iso_pu_bacteria 2958122699 2958129179 388
198 iso_pu_bacteria 2958137437 2958140234 388
199 iso_pu_bacteria 2958158011 2958163387 388
200 iso_pu_bacteria 2961136820 2961138488 388
201 iso_pu_bacteria 2961183825 2961188090 388
202 iso_pu_bacteria 2965025482 2965029426 388
203 iso_pu_bacteria 2965032056 2965034875 388
204 iso_pu_bacteria 2965047637 2965051514 388
205 iso_pu_bacteria 2965110997 2965117922 388
206 iso_pu_bacteria 2970510686 2970516427 388
207 iso_pu_bacteria 2970627176 2970634098 388
208 iso_pu_bacteria 2977851361 2977851712 388
209 iso_pu_bacteria 2977872689 2977877954 388
210 iso_pu_bacteria 2977907340 2977908260 388
211 iso_pu_bacteria 2977915119 2977922204 388
212 iso_pu_bacteria 2977935797 2977941505 388
213 iso_pu_bacteria 2977950692 2977957408 388
214 iso_pu_bacteria 2977957713 2977960131 388
215 iso_pu_bacteria 2979772303 2979772774 388
216 iso_pu_bacteria 2979793036 2979799584 388
217 iso_pu_bacteria 2987645492 2987645635 388
218 iso_pu_bacteria 2987666974 2987670554 388
219 iso_pu_bacteria 2987673487 2987676109 388
220 iso_pu_bacteria 2996386984 2996392660 388
221 iso_pu_bacteria 3000135777 3000138386 388
222 iso_pu_bacteria 3004195979 3004201954 388
223 iso_pu_bacteria 3004248173 3004253175 388
224 iso_pu_bacteria 3004268573 3004275293 388
225 iso_pu_bacteria 649633066 649873831 388
226 iso_pu_bacteria 8004300914 8004304045 388
227 iso_pu_bacteria 8004312739 8004318867 388
228 iso_pu_bacteria 8004361976 8004367118 388
229 iso_pu_bacteria 8004695233 8004701461 388
230 iso_pu_bacteria 8004727605 8004732440 388
231 3300005548 Ga0070665_100008269 Ga0070665_1000082694 389
232 3300028379 Ga0268266_10049090 Ga0268266_100490904 389
233 3300049586 Ga0501070_0024243 Ga0501070_0024243_205_1374 389
234 iso_pu_bacteria 2693429783 2694632116 389
235 iso_pu_bacteria 2693429784 2694634477 389
236 iso_pu_bacteria 2847686936 2847693044 389
237 iso_pu_bacteria 2856364286 2856368925 389
238 iso_pu_bacteria 2857349434 2857349502 389
239 iso_pu_bacteria 2869285874 2869291444 389
240 iso_pu_bacteria 2871429161 2871433724 389
241 iso_pu_bacteria 2874102143 2874106254 389
242 iso_pu_bacteria 2874146452 2874153301 389
243 iso_pu_bacteria 2874155637 2874160566 389
244 iso_pu_bacteria 2876392853 2876395070 389
245 iso_pu_bacteria 2876413966 2876419592 389
246 iso_pu_bacteria 2878745973 2878751335 389
247 iso_pu_bacteria 2881147464 2881152759 389
248 iso_pu_bacteria 2885305155 2885310408 389
249 iso_pu_bacteria 2888350351 2888356678 389
250 iso_pu_bacteria 2889010040 2889011554 389
251 iso_pu_bacteria 2889016732 2889023341 389
252 iso_pu_bacteria 2903492973 2903501877 389
253 iso_pu_bacteria 2904659560 2904661701 389
254 iso_pu_bacteria 2906308376 2906313252 389
255 iso_pu_bacteria 2906321335 2906325963 389
256 iso_pu_bacteria 2906328253 2906335174 389
257 iso_pu_bacteria 2922130491 2922136013 389
258 iso_pu_bacteria 2922158528 2922162291 389
259 iso_pu_bacteria 2924726620 2924729219 389
260 iso_pu_bacteria 2937813078 2937820598 389
261 iso_pu_bacteria 2937891427 2937891943 389
262 iso_pu_bacteria 2958041894 2958056346 389
263 iso_pu_bacteria 2958100919 2958104585 389
264 iso_pu_bacteria 2958115193 2958122348 389
265 iso_pu_bacteria 2958130278 2958135843 389
266 iso_pu_bacteria 2958172287 2958173016 389
267 iso_pu_bacteria 2958179912 2958185310 389
268 iso_pu_bacteria 2961077736 2961083577 389
269 iso_pu_bacteria 2961114664 2961116854 389
270 iso_pu_bacteria 2965062239 2965068410 389
271 iso_pu_bacteria 2968091066 2968091891 389
272 iso_pu_bacteria 2968110612 2968112761 389
273 iso_pu_bacteria 2968117919 2968123006 389
274 iso_pu_bacteria 2968128360 2968129952 389
275 iso_pu_bacteria 2977843712 2977848896 389
276 iso_pu_bacteria 2977858184 2977862416 389
277 iso_pu_bacteria 2977864932 2977867545 389
278 iso_pu_bacteria 2977942078 2977947059 389
279 iso_pu_bacteria 2979710463 2979714596 389
280 iso_pu_bacteria 2979742915 2979749509 389
281 iso_pu_bacteria 2979779861 2979780462 389
282 iso_pu_bacteria 2987636660 2987645409 389
283 iso_pu_bacteria 2987652177 2987652850 389
284 iso_pu_bacteria 2996341866 2996343456 389
285 iso_pu_bacteria 3004203850 3004206316 389
286 iso_pu_bacteria 8004387939 8004394001 389
287 iso_pu_bacteria 8004445564 8004447269 389
288 iso_pu_bacteria 8004703790 8004713782 389
289 iso_pu_bacteria 8004714634 8004719508 389
290 3300005339 Ga0070660_100125861 Ga0070660_1001258611 390
291 3300005455 Ga0070663_100008612 Ga0070663_1000086122 390
292 3300005548 Ga0070665_100463976 Ga0070665_1004639761 390
293 3300006038 Ga0075365_10010409 Ga0075365_100104092 390
294 3300006048 Ga0075363_100018221 Ga0075363_1000182212 390
295 3300009551 Ga0105238_10098245 Ga0105238_100982453 390
296 3300009551 Ga0105238_10164249 Ga0105238_101642492 390
297 3300013296 Ga0157374_10111028 Ga0157374_101110282 390
298 3300014497 Ga0182008_10035493 Ga0182008_100354932 390
299 3300015262 Ga0182007_10033297 Ga0182007_100332972 390
300 3300025253 Ga0209677_111506 Ga0209677_1115062 390
301 3300025254 Ga0209148_1000072 Ga0209148_1000072161 390
302 3300025272 Ga0209455_1000133 Ga0209455_1000133124 390
303 3300025909 Ga0207705_10110877 Ga0207705_101108771 390
304 3300025911 Ga0207654_10082791 Ga0207654_100827912 390
305 3300025919 Ga0207657_10120313 Ga0207657_101203132 390
306 3300028379 Ga0268266_10279886 Ga0268266_102798862 390
307 3300046460 Ga0495638_0091476 Ga0495638_0091476_140_1315 390
308 3300048912 Ga0496109_0206665 Ga0496109_0206665_293_1468 390
309 3300048915 Ga0496112_0054278 Ga0496112_0054278_171_1343 390
310 3300048923 Ga0496120_0045208 Ga0496120_0045208_170_1342 390
311 3300050490 nmdc:mga03n38_96945_c1 nmdc:mga03n38_96945_c1_47_1219 390
312 iso_pu_bacteria 2503198000 2503202311 390
313 iso_pu_bacteria 2513237090 2513609830 390
314 iso_pu_bacteria 2599185301 2599940027 390
315 iso_pu_bacteria 2643221550 2643773614 390
316 iso_pu_bacteria 2643221564 2643837362 390
317 3300005455 Ga0070663_100070536 Ga0070663_1000705362 391
318 3300005539 Ga0068853_100041006 Ga0068853_1000410063 391
319 3300005548 Ga0070665_100068934 Ga0070665_1000689342 391
320 3300009093 Ga0105240_10224145 Ga0105240_102241452 391
321 3300009545 Ga0105237_10055984 Ga0105237_100559844 391
322 3300009551 Ga0105238_10094317 Ga0105238_100943172 391
323 3300010375 Ga0105239_10035083 Ga0105239_100350834 391
324 3300013105 Ga0157369_10229350 Ga0157369_102293502 391
325 3300025911 Ga0207654_10163112 Ga0207654_101631121 391
326 3300025913 Ga0207695_10058029 Ga0207695_100580292 391
327 3300025914 Ga0207671_10055761 Ga0207671_100557613 391
328 3300026041 Ga0207639_10077995 Ga0207639_100779952 391
329 3300026067 Ga0207678_10020509 Ga0207678_100205092 391
330 3300026067 Ga0207678_10029629 Ga0207678_100296292 391
331 3300041413 Ga0439465_0014756 Ga0439465_0014756_360_1541 391
332 3300048905 Ga0496102_0196088 Ga0496102_0196088_303_1478 391
333 3300048921 Ga0496118_0104219 Ga0496118_0104219_454_1629 391
334 3300048924 Ga0496121_0106521 Ga0496121_0106521_582_1757 391
335 3300048929 Ga0496126_0097058 Ga0496126_0097058_1114_2289 391
336 3300049568 Ga0501031_0032883 Ga0501031_0032883_1499_2677 391
337 3300049569 Ga0501032_0002091 Ga0501032_0002091_13952_15133 391
338 3300049570 Ga0501033_0006694 Ga0501033_0006694_7539_8720 391
339 3300049572 Ga0501036_0125662 Ga0501036_0125662_323_1504 391
340 3300049573 Ga0501037_0000147 Ga0501037_0000147_31591_32772 391
341 3300049574 Ga0501038_0028088 Ga0501038_0028088_3338_4519 391
342 3300049579 Ga0501043_0000041 Ga0501043_0000041_84586_85767 391
343 3300049579 Ga0501043_0277071 Ga0501043_0277071_20_1201 391
344 3300049583 Ga0501067_0011732 Ga0501067_0011732_1249_2430 391
345 3300049585 Ga0501069_0000018 Ga0501069_0000018_43285_44466 391
346 3300049585 Ga0501069_0063971 Ga0501069_0063971_574_1755 391
347 3300049586 Ga0501070_0000222 Ga0501070_0000222_47912_49093 391
348 3300049586 Ga0501070_0158330 Ga0501070_0158330_452_1633 391
349 3300049589 Ga0501073_0014351 Ga0501073_0014351_3272_4453 391
350 3300049590 Ga0501074_0000001 Ga0501074_0000001_88451_89632 391
351 3300049742 Ga0501080_0000753 Ga0501080_0000753_24800_25981 391
352 3300049744 Ga0501083_0000079 Ga0501083_0000079_24822_26003 391
353 3300049822 Ga0501035_0000061 Ga0501035_0000061_6475_7656 391
354 3300049822 Ga0501035_0015079 Ga0501035_0015079_4631_5812 391
355 3300049823 Ga0501044_0000003 Ga0501044_0000003_260325_261506 391
356 3300049823 Ga0501044_0079923 Ga0501044_0079923_1924_3105 391
357 3300060353 Ga0501082_0033871 Ga0501082_0033871_2199_3380 391
358 iso_pu_bacteria 2871495908 2871500648 391
359 iso_pu_bacteria 2878760144 2878764737 391
360 iso_pu_bacteria 2878767105 2878771838 391
361 iso_pu_bacteria 2881161766 2881168437 391
362 iso_pu_bacteria 2903540706 2903545461 391
363 iso_pu_bacteria 2937994558 2937999311 391
364 iso_pu_bacteria 2958165035 2958169785 391
365 iso_pu_bacteria 2961163497 2961168245 391
366 iso_pu_bacteria 2965018300 2965023064 391
367 iso_pu_bacteria 2968171901 2968176645 391
368 iso_pu_bacteria 2970554993 2970559584 391
369 iso_pu_bacteria 2987659509 2987664259 391
370 iso_pu_bacteria 3004188549 3004193314 391
371 iso_pu_bacteria 8004640170 8004646817 391
372 3300005841 Ga0068863_100397162 Ga0068863_1003971622 392
373 3300006051 Ga0075364_10030480 Ga0075364_100304803 392
374 3300009098 Ga0105245_10382964 Ga0105245_103829642 392
375 3300014969 Ga0157376_10100548 Ga0157376_101005482 392
376 3300028379 Ga0268266_10047589 Ga0268266_100475894 392
377 3300046522 Ga0495643_0064858 Ga0495643_0064858_578_1756 392
378 3300047443 Ga0495687_038530 Ga0495687_038530_162_1340 392
379 3300053079 Ga0500610_0042654 Ga0500610_0042654_368_1546 392
380 3300053155 Ga0500620_001820 Ga0500620_001820_365_1543 392
381 3300053155 Ga0500620_001912 Ga0500620_001912_2688_3866 392
382 3300003214 JGI25165J46597_1000033 JGI25165J46597_1000033194 393
383 3300006048 Ga0075363_100110659 Ga0075363_1001106592 393
384 3300025261 Ga0209233_1000027 Ga0209233_1000027470 393
385 3300038443 Ga0395901_0049597 Ga0395901_0049597_1545_2726 393
386 3300049569 Ga0501032_0000117 Ga0501032_0000117_64234_65421 393
387 3300049569 Ga0501032_0036484 Ga0501032_0036484_432_1637 393
388 3300049570 Ga0501033_0000224 Ga0501033_0000224_34811_35998 393
389 3300049570 Ga0501033_0064399 Ga0501033_0064399_1066_2271 393
390 3300049571 Ga0501034_0000962 Ga0501034_0000962_5551_6738 393
391 3300049572 Ga0501036_0000645 Ga0501036_0000645_12621_13808 393
392 3300049572 Ga0501036_0193577 Ga0501036_0193577_304_1509 393
393 3300049573 Ga0501037_0001126 Ga0501037_0001126_18390_19577 393
394 3300049573 Ga0501037_0047876 Ga0501037_0047876_204_1409 393
395 3300049574 Ga0501038_0000307 Ga0501038_0000307_34912_36099 393
396 3300049574 Ga0501038_0084777 Ga0501038_0084777_999_2204 393
397 3300049575 Ga0501039_0000048 Ga0501039_0000048_18276_19463 393
398 3300049579 Ga0501043_0004586 Ga0501043_0004586_9189_10376 393
399 3300049581 Ga0501047_0201251 Ga0501047_0201251_304_1509 393
400 3300049742 Ga0501080_0043984 Ga0501080_0043984_189_1394 393
401 3300049822 Ga0501035_0001988 Ga0501035_0001988_18507_19694 393
402 3300049822 Ga0501035_0014704 Ga0501035_0014704_3036_4241 393
403 3300049823 Ga0501044_0026050 Ga0501044_0026050_426_1631 393
404 3300049823 Ga0501044_0031442 Ga0501044_0031442_405_1592 393
405 3300050492 nmdc:mga0yw44_165509_c1 nmdc:mga0yw44_165509_c1_45_1226 393
406 3300025297 Ga0209758_1004563 Ga0209758_10045632 394
407 3300025949 Ga0207667_10252997 Ga0207667_102529972 394
408 3300049568 Ga0501031_0083447 Ga0501031_0083447_278_1486 394
409 3300049570 Ga0501033_0076579 Ga0501033_0076579_1055_2263 394
410 3300049571 Ga0501034_0095718 Ga0501034_0095718_703_1911 394
411 3300049573 Ga0501037_0114454 Ga0501037_0114454_463_1671 394
412 3300049575 Ga0501039_0163587 Ga0501039_0163587_284_1492 394
413 3300049822 Ga0501035_0211480 Ga0501035_0211480_366_1574 394
414 3300049823 Ga0501044_0237971 Ga0501044_0237971_360_1568 394
415 3300002741 JGI25157J39369_1000723 JGI25157J39369_100072314 395
416 3300025250 Ga0209026_1000002 Ga0209026_1000002724 395
417 3300025256 Ga0209759_1000146 Ga0209759_100014626 395
418 3300037418 Ga0395900_0064054 Ga0395900_0064054_2573_3760 395
419 3300037471 Ga0395905_0033440 Ga0395905_0033440_1721_2908 395
420 3300037471 Ga0395905_0060082 Ga0395905_0060082_2115_3302 395
421 3300048923 Ga0496120_0003082 Ga0496120_0003082_564_1751 395

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02684

LpxB

Lipid-A-disaccharide synthetase

14

386

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
8gym-assembly1.cif.gz_t1 cryo-em structure of tetrahymena thermophila respiratory mega-complex mc iv2+(i+iii2+ii)2 0.7205 5 390
5ejg-assembly1.cif.gz_B crystal structure of nad kinase p252d mutant from listeria monocytogenes 0.7197 8 123
8gym-assembly1.cif.gz_t1 cryo-em structure of tetrahymena thermophila respiratory mega-complex mc iv2+(i+iii2+ii)2 0.7048 5 390
6rg9-assembly1.cif.gz_A crystal structure of nad kinase 1 from listeria monocytogenes in complexe with an inhibitor 0.6909 8 127
7e15-assembly2.cif.gz_D protein ternary complex working for dna replication initiation 0.6901 8 122
ID Description Score Start End Superfamily
af_F4IF99_42_436_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.865 10 372 3.40.50.2000
af_P10441_9_377_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.7978 10 382 3.40.50.2000
af_P10441_9_377_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.792 10 382 3.40.50.2000
af_Q22620_372_492_3.40.50.800 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Anticodon-binding domain 0.7555 196 233 3.40.50.800
2h1fB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.7011 197 301 3.40.50.2000
ID Description Score Start End GO Terms
AF-A0A530ZZI3-F1-model_v4 Lipid-A-disaccharide synthase (EC 2.4.1.182) 0.9664 140 388 GO:0005543
GO:0008915
GO:0009245
GO:0016020
AF-A0A531MLB6-F1-model_v4 Lipid-A-disaccharide synthase (EC 2.4.1.182) 0.9636 3 232 GO:0005543
GO:0008915
GO:0009245
GO:0016020
AF-A0A530ZZI3-F1-model_v4 Lipid-A-disaccharide synthase (EC 2.4.1.182) 0.9588 140 388 GO:0005543
GO:0008915
GO:0009245
GO:0016020
AF-A0A531MLB6-F1-model_v4 Lipid-A-disaccharide synthase (EC 2.4.1.182) 0.9555 3 232 GO:0005543
GO:0008915
GO:0009245
GO:0016020
AF-A0A7V3U1F7-F1-model_v4 Lipid-A-disaccharide synthase (EC 2.4.1.182) 0.9358 8 176 GO:0005543
GO:0008915
GO:0009245
GO:0016020

Feature Viewer

pLDDT pTM Quality
87.52 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map