F440110
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 421 | 345 | 156 | 387 |
Family's Representative Sequence
| Representative Sequence | 3300049568|Ga0501031_0083447|Ga0501031_0083447_278_1486 |
| Length | 402 |
| Sequence | MAETKQETSRPFRLAVVAGEESGDLLGADLVRALQRLTGRTVQLAGVGGRHLGELGLSSIFDAGDIALVGVSAVLRDLPRLLRRIGQAADAIVAQKPDCLVTIDSPDFALRVARKVRAADPSIPIVHYVCPSVWAWRPGRAAAMRDHVDRILCLLPFEPAELERLGGPEGVYVGHRLTRDADVDAAAAMQAAPRDLSPEREKTLLLLPGSRRGEVRRLIEPFGETVSVLASRGHRLRLLLPTVPHVADLVRDAVAGWAHRPQILIEAQDKWRAFGEADAALIASGTVSLELAMSGVPMVSTYRLDPVMRMAQGLITTWSALLPNLIADRPVVPEFYDRYVRPQNLARHLEALFVESGMRAWQKDGFAEVRRRMETDRPAGDLAAEAVMGVVRQSATGSRQSG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2503198000 | Mesorhizobium opportunistum WSM2075 | Isolate | Nodule |
| 2 | 2508501123 | Mesorhizobium sp. WSM3626 | Isolate | Nodule |
| 3 | 2508501127 | Mesorhizobium sp. WSM2561 | Isolate | Nodule |
| 4 | 2509276018 | Mesorhizobium ciceri CMG6 | Isolate | Nodule |
| 5 | 2509276022 | Mesorhizobium australicum WSM2073 | Isolate | Nodule |
| 6 | 2510065059 | Mesorhizobium ciceri WSM4083 | Isolate | Nodule |
| 7 | 2512875016 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 8 | 2512875024 | Mesorhizobium loti R88b | Isolate | Nodule |
| 9 | 2513237090 | Mesorhizobium sp. WSM3224 | Isolate | Nodule |
| 10 | 2513237164 | Mesorhizobium loti CJ3sym | Isolate | Nodule |
| 11 | 2513237305 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 12 | 2513237351 | Mesorhizobium alhagi CCNWXJ12-2 | Isolate | Nodule |
| 13 | 2588253730 | Mesorhizobium huakuii 7653R | Isolate | Rhizosphere |
| 14 | 2597489875 | Mesorhizobium ciceri ca181 | Isolate | Unclassified |
| 15 | 2599185301 | Mesorhizobium sp. NFR06 | Isolate | Rhizoplane |
| 16 | 2643221550 | Mesorhizobium sp. Root552 | Isolate | Unclassified |
| 17 | 2643221551 | Mesorhizobium sp. Root1471 | Isolate | Unclassified |
| 18 | 2643221555 | Mesorhizobium sp. Root554 | Isolate | Unclassified |
| 19 | 2643221564 | Mesorhizobium sp. Root157 | Isolate | Unclassified |
| 20 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 21 | 2643221623 | Aminobacter sp. DSM 101952 Root100 | Isolate | Unclassified |
| 22 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 23 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 24 | 2693429783 | Mesorhizobium sp. LCM 4577 | Isolate | Rhizosphere |
| 25 | 2693429784 | Mesorhizobium sp. LCM 4576 | Isolate | Rhizosphere |
| 26 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 27 | 2738543024 | Aminobacter sp. AP02 | Isolate | Unclassified |
| 28 | 2756170246 | Mesorhizobium loti DSM 2626 | Isolate | Nodule |
| 29 | 2765235802 | Phyllobacterium bourgognense 31-25a | Isolate | Rhizoplane |
| 30 | 2767802442 | Phyllobacterium brassicacearum 29-15 | Isolate | Rhizoplane |
| 31 | 2775506902 | Phyllobacterium zundukense Tri-48 | Isolate | Unclassified |
| 32 | 2775506904 | Phyllobacterium zundukense Tri-38 | Isolate | Unclassified |
| 33 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 34 | 2839993093 | Phyllobacterium endophyticum PEPV15 | Isolate | Unclassified |
| 35 | 2841734538 | Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 | Isolate | Nodule |
| 36 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 37 | 2844009547 | Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 | Isolate | Nodule |
| 38 | 2847670302 | Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 | Isolate | Nodule |
| 39 | 2847686936 | Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 | Isolate | Nodule |
| 40 | 2856314179 | Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 | Isolate | Nodule |
| 41 | 2856320880 | Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 | Isolate | Nodule |
| 42 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 43 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 44 | 2856342000 | Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 | Isolate | Nodule |
| 45 | 2856364286 | Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 | Isolate | Nodule |
| 46 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 47 | 2869162929 | Mesorhizobium sanjuanii BSA136 | Isolate | Nodule |
| 48 | 2869234852 | Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 | Isolate | Nodule |
| 49 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 50 | 2869278585 | Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 | Isolate | Nodule |
| 51 | 2869285874 | Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 | Isolate | Nodule |
| 52 | 2871429161 | Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 | Isolate | Nodule |
| 53 | 2871435913 | Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 | Isolate | Nodule |
| 54 | 2871444079 | Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 | Isolate | Nodule |
| 55 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 56 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 57 | 2871466892 | Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 | Isolate | Nodule |
| 58 | 2871474448 | Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 | Isolate | Nodule |
| 59 | 2871481445 | Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 | Isolate | Nodule |
| 60 | 2871488783 | Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 | Isolate | Nodule |
| 61 | 2871495908 | Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 | Isolate | Nodule |
| 62 | 2874102143 | Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 | Isolate | Nodule |
| 63 | 2874109183 | Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 | Isolate | Nodule |
| 64 | 2874116593 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 | Isolate | Nodule |
| 65 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 66 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 67 | 2874146452 | Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 | Isolate | Nodule |
| 68 | 2874155637 | Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 | Isolate | Nodule |
| 69 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 70 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 71 | 2876363079 | Mesorhizobium loti R7ANS::ICEMlSym2042 | Isolate | Nodule |
| 72 | 2876377896 | Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 | Isolate | Nodule |
| 73 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 74 | 2876392853 | Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 | Isolate | Nodule |
| 75 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 76 | 2876406927 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 | Isolate | Nodule |
| 77 | 2876413966 | Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 | Isolate | Nodule |
| 78 | 2876420981 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 | Isolate | Nodule |
| 79 | 2878035449 | Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 | Isolate | Nodule |
| 80 | 2878730984 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 | Isolate | Nodule |
| 81 | 2878738818 | Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 | Isolate | Nodule |
| 82 | 2878745973 | Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 | Isolate | Nodule |
| 83 | 2878753008 | Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 | Isolate | Nodule |
| 84 | 2878760144 | Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 | Isolate | Nodule |
| 85 | 2878767105 | Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 | Isolate | Nodule |
| 86 | 2878774303 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 | Isolate | Nodule |
| 87 | 2878781027 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 | Isolate | Nodule |
| 88 | 2878788777 | Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 | Isolate | Nodule |
| 89 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 90 | 2881155292 | Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 | Isolate | Nodule |
| 91 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 92 | 2881845957 | Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 | Isolate | Nodule |
| 93 | 2881853255 | Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 | Isolate | Nodule |
| 94 | 2881861095 | Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 | Isolate | Nodule |
| 95 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 96 | 2882912400 | Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 | Isolate | Nodule |
| 97 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 98 | 2885312484 | Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 | Isolate | Nodule |
| 99 | 2885342637 | Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 | Isolate | Nodule |
| 100 | 2888337043 | Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 | Isolate | Nodule |
| 101 | 2888343758 | Mesorhizobium sp. AA22 | Isolate | Unclassified |
| 102 | 2888350351 | Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 | Isolate | Nodule |
| 103 | 2889010040 | Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 | Isolate | Nodule |
| 104 | 2889016732 | Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 | Isolate | Nodule |
| 105 | 2889790730 | Chelativorans xinjiangense lm93 | Isolate | Rhizosphere |
| 106 | 2889914905 | Chelativorans alearense UJN715 | Isolate | Rhizosphere |
| 107 | 2894652903 | Phyllobacterium sp. SYP-B3895 | Isolate | Rhizosphere |
| 108 | 2903448605 | Mesorhizobium japonicum Opo-235 | Isolate | Nodule |
| 109 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 110 | 2903521522 | Mesorhizobium loti R7ANS::ICEMlSym2014 | Isolate | Nodule |
| 111 | 2903528002 | Mesorhizobium loti R7ANS::ICEMlSym2037 | Isolate | Nodule |
| 112 | 2903540706 | Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 | Isolate | Nodule |
| 113 | 2904578770 | Phyllobacterium sp. 586 | Isolate | Unclassified |
| 114 | 2904659560 | Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 | Isolate | Nodule |
| 115 | 2906308376 | Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 | Isolate | Nodule |
| 116 | 2906321335 | Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 | Isolate | Nodule |
| 117 | 2906328253 | Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 | Isolate | Nodule |
| 118 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 119 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 120 | 2906378014 | Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 | Isolate | Nodule |
| 121 | 2906393657 | Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 | Isolate | Nodule |
| 122 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 123 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 124 | 2906414383 | Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 | Isolate | Nodule |
| 125 | 2906427513 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 | Isolate | Nodule |
| 126 | 2919119836 | Phyllobacterium sp. 1468 | Isolate | Rhizosphere |
| 127 | 2922130491 | Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 | Isolate | Nodule |
| 128 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 129 | 2922158528 | Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 | Isolate | Nodule |
| 130 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 131 | 2922178524 | Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 | Isolate | Nodule |
| 132 | 2924710171 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 | Isolate | Nodule |
| 133 | 2924718760 | Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 | Isolate | Nodule |
| 134 | 2924726620 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 | Isolate | Nodule |
| 135 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 136 | 2924748358 | Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 | Isolate | Nodule |
| 137 | 2924754689 | Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 | Isolate | Nodule |
| 138 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 139 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 140 | 2924784321 | Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | Isolate | Nodule |
| 141 | 2928521798 | Phyllobacterium ifriqiyense 1451 | Isolate | Rhizosphere |
| 142 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 143 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 144 | 2937836603 | Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 | Isolate | Nodule |
| 145 | 2937843397 | Mesorhizobium xinjiangense lm94 | Isolate | Rhizosphere |
| 146 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 147 | 2937861824 | Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 | Isolate | Nodule |
| 148 | 2937877337 | Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 | Isolate | Nodule |
| 149 | 2937891427 | Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 | Isolate | Nodule |
| 150 | 2937972304 | Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 | Isolate | Nodule |
| 151 | 2937994558 | Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 | Isolate | Nodule |
| 152 | 2954011201 | Phyllobacterium ifrigiyense W4I11 | Isolate | Rhizosphere |
| 153 | 2958034702 | Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 | Isolate | Nodule |
| 154 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 155 | 2958064165 | Mesorhizobium sp. SARCC-RB16n | Isolate | Unclassified |
| 156 | 2958071322 | Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 | Isolate | Nodule |
| 157 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 158 | 2958092219 | Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 | Isolate | Nodule |
| 159 | 2958100919 | Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 | Isolate | Nodule |
| 160 | 2958108152 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 | Isolate | Nodule |
| 161 | 2958115193 | Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 | Isolate | Nodule |
| 162 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 163 | 2958130278 | Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 | Isolate | Nodule |
| 164 | 2958137437 | Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 | Isolate | Nodule |
| 165 | 2958144490 | Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 | Isolate | Nodule |
| 166 | 2958158011 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 | Isolate | Nodule |
| 167 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 168 | 2958172287 | Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 | Isolate | Nodule |
| 169 | 2958179912 | Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 | Isolate | Nodule |
| 170 | 2961077736 | Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 | Isolate | Nodule |
| 171 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 172 | 2961127735 | Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 | Isolate | Nodule |
| 173 | 2961136820 | Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 | Isolate | Nodule |
| 174 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 175 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 176 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 177 | 2963644680 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 178 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 179 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 180 | 2965032056 | Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 | Isolate | Nodule |
| 181 | 2965047637 | Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 | Isolate | Nodule |
| 182 | 2965062239 | Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 | Isolate | Nodule |
| 183 | 2965102966 | Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 | Isolate | Nodule |
| 184 | 2965110997 | Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 | Isolate | Nodule |
| 185 | 2965119406 | Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 | Isolate | Nodule |
| 186 | 2967996073 | Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 | Isolate | Nodule |
| 187 | 2968003550 | Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 | Isolate | Nodule |
| 188 | 2968016561 | Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 | Isolate | Nodule |
| 189 | 2968083720 | Mesorhizobium erdmanii Opo-242 | Isolate | Unclassified |
| 190 | 2968091066 | Mesorhizobium sp. AA23 | Isolate | Unclassified |
| 191 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 192 | 2968117919 | Mesorhizobium atlanticum CNPSo 3140 | Isolate | Unclassified |
| 193 | 2968128360 | Mesorhizobium sp. WSM3873 | Isolate | Unclassified |
| 194 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 195 | 2970469710 | Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 | Isolate | Nodule |
| 196 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 197 | 2970503327 | Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 | Isolate | Nodule |
| 198 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 199 | 2970524798 | Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 | Isolate | Nodule |
| 200 | 2970540015 | Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 | Isolate | Nodule |
| 201 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 202 | 2970593180 | Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 | Isolate | Nodule |
| 203 | 2970627176 | Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 | Isolate | Nodule |
| 204 | 2977821940 | Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 | Isolate | Nodule |
| 205 | 2977828996 | Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 | Isolate | Nodule |
| 206 | 2977843712 | Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 | Isolate | Nodule |
| 207 | 2977851361 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 | Isolate | Nodule |
| 208 | 2977858184 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 | Isolate | Nodule |
| 209 | 2977864932 | Mesorhizobium tamadayense DSM 28320 | Isolate | Nodule |
| 210 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 211 | 2977907340 | Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 | Isolate | Nodule |
| 212 | 2977915119 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 | Isolate | Nodule |
| 213 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 214 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 215 | 2977942078 | Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 | Isolate | Nodule |
| 216 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 217 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 218 | 2977971508 | Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 | Isolate | Nodule |
| 219 | 2979710463 | Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 | Isolate | Nodule |
| 220 | 2979742915 | Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 | Isolate | Nodule |
| 221 | 2979772303 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 | Isolate | Nodule |
| 222 | 2979779861 | Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 | Isolate | Nodule |
| 223 | 2979793036 | Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 | Isolate | Nodule |
| 224 | 2979808191 | Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 | Isolate | Nodule |
| 225 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 226 | 2987645492 | Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 | Isolate | Nodule |
| 227 | 2987652177 | Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 | Isolate | Nodule |
| 228 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 229 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 230 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 231 | 2996310559 | Mesorhizobium zhangyense CGMCC 1.15528 | Isolate | Unclassified |
| 232 | 2996336353 | Mesorhizobium sp. YM1C-6-2 | Isolate | Unclassified |
| 233 | 2996341866 | Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 | Isolate | Nodule |
| 234 | 2996348954 | Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 | Isolate | Nodule |
| 235 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 236 | 3000135777 | Unclassified bacterium M00.F.Ca.ET.205.01.1.1 | Isolate | Unclassified |
| 237 | 3004167301 | Mesorhizobium loti 582 | Isolate | Unclassified |
| 238 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 239 | 3004195979 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 | Isolate | Nodule |
| 240 | 3004203850 | Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 | Isolate | Nodule |
| 241 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 242 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 243 | 3004248173 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 | Isolate | Nodule |
| 244 | 3004268573 | Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 | Isolate | Nodule |
| 245 | 3004275668 | Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 | Isolate | Nodule |
| 246 | 3004289098 | Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 | Isolate | Nodule |
| 247 | 3004334049 | Mesorhizobium huakuii 583 | Isolate | Unclassified |
| 248 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 249 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 250 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 251 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 252 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 253 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 254 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 255 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 256 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 257 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 258 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 259 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 260 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 261 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 262 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 263 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 264 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 265 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 266 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 267 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 268 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 269 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 270 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 271 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 272 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 273 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 274 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 275 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 276 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 277 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 286 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 287 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 288 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 289 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 290 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 291 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 292 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 297 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 298 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 299 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 300 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 301 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 302 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 303 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 311 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 315 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 324 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 325 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 326 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 327 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 328 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 329 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 330 | 637000159 | Mesorhizobium japonicum MAFF 303099 | Isolate | Unclassified |
| 331 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 332 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 333 | 8004312739 | Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 | Isolate | Nodule |
| 334 | 8004361976 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 | Isolate | Nodule |
| 335 | 8004374579 | Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 | Isolate | Nodule |
| 336 | 8004387939 | Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 | Isolate | Nodule |
| 337 | 8004395343 | Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 | Isolate | Nodule |
| 338 | 8004445564 | Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 | Isolate | Nodule |
| 339 | 8004633249 | Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 | Isolate | Nodule |
| 340 | 8004640170 | Mesorhizobium sp. GbtcB19 | Isolate | Unclassified |
| 341 | 8004695233 | Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 | Isolate | Nodule |
| 342 | 8004703790 | Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 | Isolate | Nodule |
| 343 | 8004714634 | Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 | Isolate | Nodule |
| 344 | 8004727605 | Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 | Isolate | Nodule |
| 345 | 8055617313 | Mesorhizobium onobrychidis OM4 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 37.05 |
| Metatranscriptomes | 0 |
| Isolates | 62.95 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.75 |
| Nodule | 51.54 |
| Rhizoplane | 1.43 |
| Rhizosphere | 32.07 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.21 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25157J39369_1000723 | 3300002741 | Bacteria | 17621 |
| 2 | JGI25165J46597_1000033 | 3300003214 | Bacteria | 293030 |
| 3 | Ga0070660_100125861 | 3300005339 | Bacteria | 2048 |
| 4 | Ga0070663_100008612 | 3300005455 | Bacteria | 6286 |
| 5 | Ga0070663_100070536 | 3300005455 | Bacteria | 2541 |
| 6 | Ga0068853_100041006 | 3300005539 | Bacteria | 3952 |
| 7 | Ga0070665_100008269 | 3300005548 | Bacteria | 10521 |
| 8 | Ga0070665_100068934 | 3300005548 | Bacteria | 3545 |
| 9 | Ga0070665_100463976 | 3300005548 | Bacteria | 1277 |
| 10 | Ga0068863_100397162 | 3300005841 | Bacteria | 1348 |
| 11 | Ga0075365_10010409 | 3300006038 | Bacteria | 5416 |
| 12 | Ga0075365_10108338 | 3300006038 | Bacteria | 1908 |
| 13 | Ga0075363_100018221 | 3300006048 | Bacteria | 3494 |
| 14 | Ga0075363_100110659 | 3300006048 | Bacteria | 1527 |
| 15 | Ga0075364_10030480 | 3300006051 | Bacteria | 3462 |
| 16 | Ga0075367_10025564 | 3300006178 | Bacteria | 3340 |
| 17 | Ga0075369_10018606 | 3300006186 | Bacteria | 2830 |
| 18 | Ga0105240_10224145 | 3300009093 | Bacteria | 2188 |
| 19 | Ga0105245_10382964 | 3300009098 | Bacteria | 1401 |
| 20 | Ga0105237_10055984 | 3300009545 | Bacteria | 3949 |
| 21 | Ga0105238_10094317 | 3300009551 | Bacteria | 2980 |
| 22 | Ga0105238_10098245 | 3300009551 | Bacteria | 2912 |
| 23 | Ga0105238_10164249 | 3300009551 | Bacteria | 2196 |
| 24 | Ga0105239_10035083 | 3300010375 | Bacteria | 5509 |
| 25 | Ga0157369_10229350 | 3300013105 | Bacteria | 1942 |
| 26 | Ga0157374_10111028 | 3300013296 | Bacteria | 2637 |
| 27 | Ga0182008_10035493 | 3300014497 | Bacteria | 2497 |
| 28 | Ga0157376_10100548 | 3300014969 | Bacteria | 2525 |
| 29 | Ga0182007_10033297 | 3300015262 | Bacteria | 1747 |
| 30 | Ga0209026_1000002 | 3300025250 | Bacteria | 1136158 |
| 31 | Ga0209677_111506 | 3300025253 | Bacteria | 1377 |
| 32 | Ga0209148_1000072 | 3300025254 | Bacteria | 325292 |
| 33 | Ga0209759_1000146 | 3300025256 | Bacteria | 121497 |
| 34 | Ga0209233_1000027 | 3300025261 | Bacteria | 652089 |
| 35 | Ga0209455_1000133 | 3300025272 | Bacteria | 155670 |
| 36 | Ga0209758_1004563 | 3300025297 | Bacteria | 11425 |
| 37 | Ga0207705_10110877 | 3300025909 | Bacteria | 2027 |
| 38 | Ga0207654_10082791 | 3300025911 | Bacteria | 1936 |
| 39 | Ga0207654_10163112 | 3300025911 | Bacteria | 1441 |
| 40 | Ga0207695_10058029 | 3300025913 | Bacteria | 4019 |
| 41 | Ga0207671_10055761 | 3300025914 | Bacteria | 2928 |
| 42 | Ga0207657_10120313 | 3300025919 | Bacteria | 2161 |
| 43 | Ga0207667_10252997 | 3300025949 | Bacteria | 1802 |
| 44 | Ga0207639_10077995 | 3300026041 | Bacteria | 2613 |
| 45 | Ga0207678_10020509 | 3300026067 | Bacteria | 5794 |
| 46 | Ga0207678_10029629 | 3300026067 | Bacteria | 4779 |
| 47 | Ga0268266_10047589 | 3300028379 | Bacteria | 3675 |
| 48 | Ga0268266_10049090 | 3300028379 | Bacteria | 3618 |
| 49 | Ga0268266_10279886 | 3300028379 | Bacteria | 1551 |
| 50 | Ga0395899_0000398 | 3300037312 | Bacteria | 51631 |
| 51 | Ga0395900_0000121 | 3300037418 | Bacteria | 135026 |
| 52 | Ga0395900_0064054 | 3300037418 | Bacteria | 3779 |
| 53 | Ga0395898_0000247 | 3300037466 | Bacteria | 135026 |
| 54 | Ga0395905_0000112 | 3300037471 | Bacteria | 135010 |
| 55 | Ga0395905_0033440 | 3300037471 | Bacteria | 4830 |
| 56 | Ga0395905_0060082 | 3300037471 | Bacteria | 3554 |
| 57 | Ga0395901_0000078 | 3300038443 | Bacteria | 135026 |
| 58 | Ga0395901_0049597 | 3300038443 | Bacteria | 4362 |
| 59 | Ga0439465_0014756 | 3300041413 | Bacteria | 2437 |
| 60 | Ga0495638_0091476 | 3300046460 | Bacteria | 1832 |
| 61 | Ga0495643_0064858 | 3300046522 | Bacteria | 1929 |
| 62 | Ga0495597_0111160 | 3300046542 | Bacteria | 1149 |
| 63 | Ga0495687_038530 | 3300047443 | Bacteria | 2121 |
| 64 | Ga0496102_0196088 | 3300048905 | Bacteria | 1903 |
| 65 | Ga0496109_0206665 | 3300048912 | Bacteria | 1846 |
| 66 | Ga0496112_0054278 | 3300048915 | Bacteria | 3937 |
| 67 | Ga0496118_0104219 | 3300048921 | Bacteria | 1905 |
| 68 | Ga0496120_0003082 | 3300048923 | Bacteria | 15709 |
| 69 | Ga0496120_0045208 | 3300048923 | Bacteria | 2552 |
| 70 | Ga0496121_0106521 | 3300048924 | Bacteria | 2149 |
| 71 | Ga0496126_0097058 | 3300048929 | Bacteria | 2583 |
| 72 | Ga0501031_0000194 | 3300049568 | Bacteria | 34317 |
| 73 | Ga0501031_0032883 | 3300049568 | Bacteria | 3382 |
| 74 | Ga0501031_0083447 | 3300049568 | Bacteria | 2082 |
| 75 | Ga0501031_0262894 | 3300049568 | Bacteria | 1121 |
| 76 | Ga0501032_0000084 | 3300049569 | Bacteria | 82148 |
| 77 | Ga0501032_0000117 | 3300049569 | Bacteria | 67270 |
| 78 | Ga0501032_0002091 | 3300049569 | Bacteria | 15738 |
| 79 | Ga0501032_0036484 | 3300049569 | Bacteria | 3354 |
| 80 | Ga0501033_0000102 | 3300049570 | Bacteria | 81583 |
| 81 | Ga0501033_0000224 | 3300049570 | Bacteria | 54346 |
| 82 | Ga0501033_0006694 | 3300049570 | Bacteria | 9004 |
| 83 | Ga0501033_0048290 | 3300049570 | Bacteria | 3162 |
| 84 | Ga0501033_0064399 | 3300049570 | Bacteria | 2697 |
| 85 | Ga0501033_0076579 | 3300049570 | Bacteria | 2455 |
| 86 | Ga0501033_0079428 | 3300049570 | Bacteria | 2407 |
| 87 | Ga0501034_0000744 | 3300049571 | Bacteria | 49218 |
| 88 | Ga0501034_0000962 | 3300049571 | Bacteria | 41541 |
| 89 | Ga0501034_0095718 | 3300049571 | Bacteria | 2965 |
| 90 | Ga0501034_0269506 | 3300049571 | Bacteria | 1644 |
| 91 | Ga0501036_0000040 | 3300049572 | Bacteria | 81588 |
| 92 | Ga0501036_0000645 | 3300049572 | Bacteria | 25508 |
| 93 | Ga0501036_0125662 | 3300049572 | Bacteria | 2166 |
| 94 | Ga0501036_0193577 | 3300049572 | Bacteria | 1710 |
| 95 | Ga0501037_0000098 | 3300049573 | Bacteria | 81588 |
| 96 | Ga0501037_0000147 | 3300049573 | Bacteria | 65415 |
| 97 | Ga0501037_0001126 | 3300049573 | Bacteria | 19773 |
| 98 | Ga0501037_0047876 | 3300049573 | Bacteria | 3132 |
| 99 | Ga0501037_0114454 | 3300049573 | Bacteria | 1941 |
| 100 | Ga0501037_0198424 | 3300049573 | Bacteria | 1419 |
| 101 | Ga0501038_0000002 | 3300049574 | Bacteria | 330446 |
| 102 | Ga0501038_0000307 | 3300049574 | Bacteria | 41649 |
| 103 | Ga0501038_0028088 | 3300049574 | Bacteria | 4999 |
| 104 | Ga0501038_0084777 | 3300049574 | Bacteria | 2665 |
| 105 | Ga0501038_0115333 | 3300049574 | Bacteria | 2221 |
| 106 | Ga0501039_0000002 | 3300049575 | Bacteria | 375152 |
| 107 | Ga0501039_0000048 | 3300049575 | Bacteria | 102012 |
| 108 | Ga0501039_0163587 | 3300049575 | Bacteria | 1749 |
| 109 | Ga0501040_0047076 | 3300049576 | Bacteria | 2944 |
| 110 | Ga0501043_0000041 | 3300049579 | Bacteria | 116876 |
| 111 | Ga0501043_0003484 | 3300049579 | Bacteria | 12933 |
| 112 | Ga0501043_0004586 | 3300049579 | Bacteria | 11206 |
| 113 | Ga0501043_0277071 | 3300049579 | Bacteria | 1286 |
| 114 | Ga0501047_0004818 | 3300049581 | Bacteria | 12685 |
| 115 | Ga0501047_0024046 | 3300049581 | Bacteria | 5851 |
| 116 | Ga0501047_0201251 | 3300049581 | Bacteria | 1852 |
| 117 | Ga0501067_0011732 | 3300049583 | Bacteria | 4855 |
| 118 | Ga0501069_0000018 | 3300049585 | Bacteria | 133550 |
| 119 | Ga0501069_0063971 | 3300049585 | Bacteria | 2055 |
| 120 | Ga0501070_0000222 | 3300049586 | Bacteria | 54032 |
| 121 | Ga0501070_0024243 | 3300049586 | Bacteria | 5088 |
| 122 | Ga0501070_0031192 | 3300049586 | Bacteria | 4465 |
| 123 | Ga0501070_0158330 | 3300049586 | Bacteria | 1867 |
| 124 | Ga0501073_0014351 | 3300049589 | Bacteria | 5756 |
| 125 | Ga0501074_0000001 | 3300049590 | Bacteria | 123588 |
| 126 | Ga0501074_0095716 | 3300049590 | Bacteria | 2126 |
| 127 | Ga0501080_0000456 | 3300049742 | Bacteria | 31663 |
| 128 | Ga0501080_0000753 | 3300049742 | Bacteria | 26231 |
| 129 | Ga0501080_0043984 | 3300049742 | Bacteria | 4158 |
| 130 | Ga0501083_0000079 | 3300049744 | Bacteria | 64984 |
| 131 | Ga0501035_0000061 | 3300049822 | Bacteria | 131658 |
| 132 | Ga0501035_0000163 | 3300049822 | Bacteria | 81898 |
| 133 | Ga0501035_0000953 | 3300049822 | Bacteria | 30602 |
| 134 | Ga0501035_0001988 | 3300049822 | Bacteria | 20436 |
| 135 | Ga0501035_0014704 | 3300049822 | Bacteria | 7224 |
| 136 | Ga0501035_0015079 | 3300049822 | Bacteria | 7130 |
| 137 | Ga0501035_0089127 | 3300049822 | Bacteria | 2717 |
| 138 | Ga0501035_0194915 | 3300049822 | Bacteria | 1740 |
| 139 | Ga0501035_0211480 | 3300049822 | Bacteria | 1659 |
| 140 | Ga0501044_0000002 | 3300049823 | Bacteria | 375152 |
| 141 | Ga0501044_0000003 | 3300049823 | Bacteria | 345647 |
| 142 | Ga0501044_0026050 | 3300049823 | Bacteria | 6193 |
| 143 | Ga0501044_0031442 | 3300049823 | Bacteria | 5588 |
| 144 | Ga0501044_0054348 | 3300049823 | Bacteria | 4117 |
| 145 | Ga0501044_0079923 | 3300049823 | Bacteria | 3312 |
| 146 | Ga0501044_0227820 | 3300049823 | Bacteria | 1812 |
| 147 | Ga0501044_0237971 | 3300049823 | Bacteria | 1765 |
| 148 | nmdc:mga03n38_96945_c1 | 3300050490 | Bacteria | 1415 |
| 149 | nmdc:mga0yw44_14524_c1 | 3300050492 | Bacteria | 4186 |
| 150 | nmdc:mga0yw44_165509_c1 | 3300050492 | Bacteria | 1449 |
| 151 | nmdc:mga0sz30_28719_c1 | 3300050516 | Bacteria | 2290 |
| 152 | Ga0500610_0042654 | 3300053079 | Bacteria | 2348 |
| 153 | Ga0500620_001820 | 3300053155 | Bacteria | 4082 |
| 154 | Ga0500620_001912 | 3300053155 | Bacteria | 4021 |
| 155 | Ga0501084_0328535 | 3300054114 | Unclassified | 1292 |
| 156 | Ga0501082_0033871 | 3300060353 | Bacteria | 4406 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2871444079 | 2871448924 | 326 |
| 2 | iso_pu_bacteria | 2965119406 | 2965124508 | 326 |
| 3 | 3300049568 | Ga0501031_0262894 | Ga0501031_0262894_116_1108 | 328 |
| 4 | 3300046542 | Ga0495597_0111160 | Ga0495597_0111160_12_1001 | 329 |
| 5 | iso_pu_bacteria | 2876377896 | 2876383341 | 342 |
| 6 | 3300049570 | Ga0501033_0079428 | Ga0501033_0079428_632_1813 | 348 |
| 7 | 3300049574 | Ga0501038_0115333 | Ga0501038_0115333_643_1824 | 348 |
| 8 | 3300049581 | Ga0501047_0024046 | Ga0501047_0024046_2555_3736 | 348 |
| 9 | 3300049590 | Ga0501074_0095716 | Ga0501074_0095716_607_1788 | 348 |
| 10 | 3300049742 | Ga0501080_0000456 | Ga0501080_0000456_4957_6138 | 348 |
| 11 | 3300049822 | Ga0501035_0000953 | Ga0501035_0000953_27158_28339 | 348 |
| 12 | iso_pu_bacteria | 2885342637 | 2885349632 | 355 |
| 13 | iso_pu_bacteria | 8004395343 | 8004396394 | 356 |
| 14 | 3300049823 | Ga0501044_0227820 | Ga0501044_0227820_393_1574 | 359 |
| 15 | 3300054114 | Ga0501084_0328535 | Ga0501084_0328535_41_1222 | 359 |
| 16 | 3300049573 | Ga0501037_0198424 | Ga0501037_0198424_289_1398 | 361 |
| 17 | 3300049568 | Ga0501031_0000194 | Ga0501031_0000194_32728_33936 | 369 |
| 18 | 3300049569 | Ga0501032_0000084 | Ga0501032_0000084_32705_33913 | 369 |
| 19 | 3300049570 | Ga0501033_0000102 | Ga0501033_0000102_47653_48861 | 369 |
| 20 | 3300049570 | Ga0501033_0048290 | Ga0501033_0048290_1669_2859 | 369 |
| 21 | 3300049571 | Ga0501034_0000744 | Ga0501034_0000744_32603_33811 | 369 |
| 22 | 3300049572 | Ga0501036_0000040 | Ga0501036_0000040_47653_48861 | 369 |
| 23 | 3300049573 | Ga0501037_0000098 | Ga0501037_0000098_47653_48861 | 369 |
| 24 | 3300049574 | Ga0501038_0000002 | Ga0501038_0000002_314577_315785 | 369 |
| 25 | 3300049575 | Ga0501039_0000002 | Ga0501039_0000002_32728_33936 | 369 |
| 26 | 3300049576 | Ga0501040_0047076 | Ga0501040_0047076_369_1577 | 369 |
| 27 | 3300049579 | Ga0501043_0003484 | Ga0501043_0003484_11376_12584 | 369 |
| 28 | 3300049581 | Ga0501047_0004818 | Ga0501047_0004818_11221_12429 | 369 |
| 29 | 3300049586 | Ga0501070_0031192 | Ga0501070_0031192_74_1282 | 369 |
| 30 | 3300049822 | Ga0501035_0000163 | Ga0501035_0000163_47963_49171 | 369 |
| 31 | 3300049822 | Ga0501035_0089127 | Ga0501035_0089127_1267_2448 | 369 |
| 32 | 3300049823 | Ga0501044_0000002 | Ga0501044_0000002_341217_342425 | 369 |
| 33 | iso_pu_bacteria | 2965102966 | 2965109708 | 371 |
| 34 | iso_pu_bacteria | 2906378014 | 2906383469 | 382 |
| 35 | iso_pu_bacteria | 2643221623 | 2644132151 | 383 |
| 36 | iso_pu_bacteria | 2738543024 | 2739307964 | 383 |
| 37 | iso_pu_bacteria | 2869162929 | 2869166009 | 383 |
| 38 | iso_pu_bacteria | 2508501127 | 2509140553 | 384 |
| 39 | iso_pu_bacteria | 2513237305 | 2514421811 | 384 |
| 40 | iso_pu_bacteria | 2597489875 | 2597814009 | 384 |
| 41 | iso_pu_bacteria | 2721755686 | 2723576270 | 384 |
| 42 | iso_pu_bacteria | 2775506902 | 2776271317 | 384 |
| 43 | iso_pu_bacteria | 2775506904 | 2776280685 | 384 |
| 44 | iso_pu_bacteria | 2841734538 | 2841740105 | 384 |
| 45 | iso_pu_bacteria | 2856342000 | 2856343787 | 384 |
| 46 | iso_pu_bacteria | 2871474448 | 2871480266 | 384 |
| 47 | iso_pu_bacteria | 2871488783 | 2871495208 | 384 |
| 48 | iso_pu_bacteria | 2878753008 | 2878758126 | 384 |
| 49 | iso_pu_bacteria | 2878788777 | 2878792654 | 384 |
| 50 | iso_pu_bacteria | 2881155292 | 2881156024 | 384 |
| 51 | iso_pu_bacteria | 2881845957 | 2881851731 | 384 |
| 52 | iso_pu_bacteria | 2881853255 | 2881857693 | 384 |
| 53 | iso_pu_bacteria | 2881861095 | 2881861474 | 384 |
| 54 | iso_pu_bacteria | 2882632389 | 2882633972 | 384 |
| 55 | iso_pu_bacteria | 2882912400 | 2882916635 | 384 |
| 56 | iso_pu_bacteria | 2888343758 | 2888347550 | 384 |
| 57 | iso_pu_bacteria | 2903492973 | 2903496142 | 384 |
| 58 | iso_pu_bacteria | 2924784321 | 2924785867 | 384 |
| 59 | iso_pu_bacteria | 2937836603 | 2937837861 | 384 |
| 60 | iso_pu_bacteria | 2937843397 | 2937846977 | 384 |
| 61 | iso_pu_bacteria | 2958071322 | 2958077599 | 384 |
| 62 | iso_pu_bacteria | 2961127735 | 2961129391 | 384 |
| 63 | iso_pu_bacteria | 2961170736 | 2961174756 | 384 |
| 64 | iso_pu_bacteria | 2967996073 | 2968000691 | 384 |
| 65 | iso_pu_bacteria | 2968003550 | 2968009936 | 384 |
| 66 | iso_pu_bacteria | 2970503327 | 2970507342 | 384 |
| 67 | iso_pu_bacteria | 2970524798 | 2970531800 | 384 |
| 68 | iso_pu_bacteria | 2970540015 | 2970545058 | 384 |
| 69 | iso_pu_bacteria | 2977821940 | 2977828800 | 384 |
| 70 | iso_pu_bacteria | 2977828996 | 2977831629 | 384 |
| 71 | iso_pu_bacteria | 2977971508 | 2977971670 | 384 |
| 72 | iso_pu_bacteria | 2979808191 | 2979812538 | 384 |
| 73 | iso_pu_bacteria | 8004374579 | 8004379638 | 384 |
| 74 | iso_pu_bacteria | 8004633249 | 8004638991 | 384 |
| 75 | iso_pu_bacteria | 8055617313 | 8055621627 | 384 |
| 76 | 3300049822 | Ga0501035_0194915 | Ga0501035_0194915_371_1552 | 385 |
| 77 | 3300049823 | Ga0501044_0054348 | Ga0501044_0054348_2233_3414 | 385 |
| 78 | iso_pu_bacteria | 2513237351 | 2514590105 | 385 |
| 79 | iso_pu_bacteria | 2767802442 | 2770195763 | 385 |
| 80 | iso_pu_bacteria | 2885312484 | 2885317207 | 385 |
| 81 | iso_pu_bacteria | 2928521798 | 2928523393 | 385 |
| 82 | iso_pu_bacteria | 2954011201 | 2954015664 | 385 |
| 83 | 3300049571 | Ga0501034_0269506 | Ga0501034_0269506_387_1550 | 386 |
| 84 | iso_pu_bacteria | 2510065059 | 2510317410 | 386 |
| 85 | iso_pu_bacteria | 2512875016 | 2512930788 | 386 |
| 86 | iso_pu_bacteria | 2588253730 | 2588516451 | 386 |
| 87 | iso_pu_bacteria | 2643221595 | 2643989961 | 386 |
| 88 | iso_pu_bacteria | 2643221627 | 2644155267 | 386 |
| 89 | iso_pu_bacteria | 2756170246 | 2756675798 | 386 |
| 90 | iso_pu_bacteria | 2791355123 | 2792746009 | 386 |
| 91 | iso_pu_bacteria | 2844002411 | 2844006540 | 386 |
| 92 | iso_pu_bacteria | 2856320880 | 2856325969 | 386 |
| 93 | iso_pu_bacteria | 2869278585 | 2869278727 | 386 |
| 94 | iso_pu_bacteria | 2871451962 | 2871452883 | 386 |
| 95 | iso_pu_bacteria | 2871466892 | 2871470232 | 386 |
| 96 | iso_pu_bacteria | 2874139085 | 2874145312 | 386 |
| 97 | iso_pu_bacteria | 2874168670 | 2874176331 | 386 |
| 98 | iso_pu_bacteria | 2876363079 | 2876365541 | 386 |
| 99 | iso_pu_bacteria | 2878738818 | 2878743559 | 386 |
| 100 | iso_pu_bacteria | 2888337043 | 2888340243 | 386 |
| 101 | iso_pu_bacteria | 2889790730 | 2889795963 | 386 |
| 102 | iso_pu_bacteria | 2889914905 | 2889918680 | 386 |
| 103 | iso_pu_bacteria | 2894652903 | 2894654495 | 386 |
| 104 | iso_pu_bacteria | 2903448605 | 2903455707 | 386 |
| 105 | iso_pu_bacteria | 2903521522 | 2903522897 | 386 |
| 106 | iso_pu_bacteria | 2903528002 | 2903533087 | 386 |
| 107 | iso_pu_bacteria | 2924718760 | 2924722684 | 386 |
| 108 | iso_pu_bacteria | 2924776078 | 2924781371 | 386 |
| 109 | iso_pu_bacteria | 2937848649 | 2937853874 | 386 |
| 110 | iso_pu_bacteria | 2937877337 | 2937879083 | 386 |
| 111 | iso_pu_bacteria | 2937972304 | 2937975171 | 386 |
| 112 | iso_pu_bacteria | 2958034702 | 2958034843 | 386 |
| 113 | iso_pu_bacteria | 2958041894 | 2958043029 | 386 |
| 114 | iso_pu_bacteria | 2958064165 | 2958067087 | 386 |
| 115 | iso_pu_bacteria | 2958084443 | 2958086257 | 386 |
| 116 | iso_pu_bacteria | 2958092219 | 2958097719 | 386 |
| 117 | iso_pu_bacteria | 2958144490 | 2958147811 | 386 |
| 118 | iso_pu_bacteria | 2963644680 | 2963648438 | 386 |
| 119 | iso_pu_bacteria | 2968016561 | 2968017748 | 386 |
| 120 | iso_pu_bacteria | 2968083720 | 2968084952 | 386 |
| 121 | iso_pu_bacteria | 2970469710 | 2970472077 | 386 |
| 122 | iso_pu_bacteria | 2970489779 | 2970495918 | 386 |
| 123 | iso_pu_bacteria | 2970593180 | 2970593323 | 386 |
| 124 | iso_pu_bacteria | 2977922695 | 2977928968 | 386 |
| 125 | iso_pu_bacteria | 2996336353 | 2996341774 | 386 |
| 126 | iso_pu_bacteria | 2996348954 | 2996351009 | 386 |
| 127 | iso_pu_bacteria | 3004167301 | 3004169688 | 386 |
| 128 | iso_pu_bacteria | 3004211236 | 3004213177 | 386 |
| 129 | iso_pu_bacteria | 3004218560 | 3004221548 | 386 |
| 130 | iso_pu_bacteria | 3004275668 | 3004277707 | 386 |
| 131 | iso_pu_bacteria | 3004289098 | 3004293923 | 386 |
| 132 | iso_pu_bacteria | 3004334049 | 3004340894 | 386 |
| 133 | iso_pu_bacteria | 637000159 | 637073835 | 386 |
| 134 | iso_pu_bacteria | 2512875024 | 2512958513 | 387 |
| 135 | iso_pu_bacteria | 2513237164 | 2514035074 | 387 |
| 136 | iso_pu_bacteria | 2765235802 | 2765466156 | 387 |
| 137 | iso_pu_bacteria | 2847670302 | 2847670710 | 387 |
| 138 | iso_pu_bacteria | 2856314179 | 2856316166 | 387 |
| 139 | iso_pu_bacteria | 2878035449 | 2878040435 | 387 |
| 140 | iso_pu_bacteria | 2904578770 | 2904582690 | 387 |
| 141 | iso_pu_bacteria | 2906414383 | 2906416303 | 387 |
| 142 | iso_pu_bacteria | 2919119836 | 2919124696 | 387 |
| 143 | iso_pu_bacteria | 2996310559 | 2996311146 | 387 |
| 144 | 3300006038 | Ga0075365_10108338 | Ga0075365_101083382 | 388 |
| 145 | 3300006178 | Ga0075367_10025564 | Ga0075367_100255642 | 388 |
| 146 | 3300006186 | Ga0075369_10018606 | Ga0075369_100186062 | 388 |
| 147 | 3300037312 | Ga0395899_0000398 | Ga0395899_0000398_14273_15439 | 388 |
| 148 | 3300037418 | Ga0395900_0000121 | Ga0395900_0000121_36193_37359 | 388 |
| 149 | 3300037466 | Ga0395898_0000247 | Ga0395898_0000247_97668_98834 | 388 |
| 150 | 3300037471 | Ga0395905_0000112 | Ga0395905_0000112_97652_98818 | 388 |
| 151 | 3300038443 | Ga0395901_0000078 | Ga0395901_0000078_36193_37359 | 388 |
| 152 | 3300050492 | nmdc:mga0yw44_14524_c1 | nmdc:mga0yw44_14524_c1_2812_3978 | 388 |
| 153 | 3300050516 | nmdc:mga0sz30_28719_c1 | nmdc:mga0sz30_28719_c1_240_1406 | 388 |
| 154 | iso_pu_bacteria | 2508501123 | 2509114255 | 388 |
| 155 | iso_pu_bacteria | 2509276018 | 2509370446 | 388 |
| 156 | iso_pu_bacteria | 2509276022 | 2509396958 | 388 |
| 157 | iso_pu_bacteria | 2643221551 | 2643775681 | 388 |
| 158 | iso_pu_bacteria | 2643221555 | 2643794128 | 388 |
| 159 | iso_pu_bacteria | 2687453392 | 2688599326 | 388 |
| 160 | iso_pu_bacteria | 2839993093 | 2839995343 | 388 |
| 161 | iso_pu_bacteria | 2844009547 | 2844014609 | 388 |
| 162 | iso_pu_bacteria | 2856328259 | 2856330449 | 388 |
| 163 | iso_pu_bacteria | 2856334872 | 2856338740 | 388 |
| 164 | iso_pu_bacteria | 2869234852 | 2869238014 | 388 |
| 165 | iso_pu_bacteria | 2869264136 | 2869270955 | 388 |
| 166 | iso_pu_bacteria | 2871435913 | 2871441064 | 388 |
| 167 | iso_pu_bacteria | 2871459585 | 2871464979 | 388 |
| 168 | iso_pu_bacteria | 2871481445 | 2871488674 | 388 |
| 169 | iso_pu_bacteria | 2874109183 | 2874113618 | 388 |
| 170 | iso_pu_bacteria | 2874116593 | 2874122552 | 388 |
| 171 | iso_pu_bacteria | 2874123672 | 2874125897 | 388 |
| 172 | iso_pu_bacteria | 2874162495 | 2874164899 | 388 |
| 173 | iso_pu_bacteria | 2876386047 | 2876391086 | 388 |
| 174 | iso_pu_bacteria | 2876399893 | 2876403147 | 388 |
| 175 | iso_pu_bacteria | 2876406927 | 2876408183 | 388 |
| 176 | iso_pu_bacteria | 2876420981 | 2876421568 | 388 |
| 177 | iso_pu_bacteria | 2878730984 | 2878735282 | 388 |
| 178 | iso_pu_bacteria | 2878774303 | 2878779562 | 388 |
| 179 | iso_pu_bacteria | 2878781027 | 2878782399 | 388 |
| 180 | iso_pu_bacteria | 2906363423 | 2906369679 | 388 |
| 181 | iso_pu_bacteria | 2906370794 | 2906371666 | 388 |
| 182 | iso_pu_bacteria | 2906393657 | 2906398014 | 388 |
| 183 | iso_pu_bacteria | 2906401398 | 2906407438 | 388 |
| 184 | iso_pu_bacteria | 2906408224 | 2906412742 | 388 |
| 185 | iso_pu_bacteria | 2906427513 | 2906429566 | 388 |
| 186 | iso_pu_bacteria | 2922151315 | 2922158244 | 388 |
| 187 | iso_pu_bacteria | 2922172374 | 2922174139 | 388 |
| 188 | iso_pu_bacteria | 2922178524 | 2922181992 | 388 |
| 189 | iso_pu_bacteria | 2924710171 | 2924715956 | 388 |
| 190 | iso_pu_bacteria | 2924733363 | 2924735940 | 388 |
| 191 | iso_pu_bacteria | 2924748358 | 2924750727 | 388 |
| 192 | iso_pu_bacteria | 2924754689 | 2924757390 | 388 |
| 193 | iso_pu_bacteria | 2924762789 | 2924768876 | 388 |
| 194 | iso_pu_bacteria | 2937822353 | 2937827186 | 388 |
| 195 | iso_pu_bacteria | 2937861824 | 2937863915 | 388 |
| 196 | iso_pu_bacteria | 2958108152 | 2958109219 | 388 |
| 197 | iso_pu_bacteria | 2958122699 | 2958129179 | 388 |
| 198 | iso_pu_bacteria | 2958137437 | 2958140234 | 388 |
| 199 | iso_pu_bacteria | 2958158011 | 2958163387 | 388 |
| 200 | iso_pu_bacteria | 2961136820 | 2961138488 | 388 |
| 201 | iso_pu_bacteria | 2961183825 | 2961188090 | 388 |
| 202 | iso_pu_bacteria | 2965025482 | 2965029426 | 388 |
| 203 | iso_pu_bacteria | 2965032056 | 2965034875 | 388 |
| 204 | iso_pu_bacteria | 2965047637 | 2965051514 | 388 |
| 205 | iso_pu_bacteria | 2965110997 | 2965117922 | 388 |
| 206 | iso_pu_bacteria | 2970510686 | 2970516427 | 388 |
| 207 | iso_pu_bacteria | 2970627176 | 2970634098 | 388 |
| 208 | iso_pu_bacteria | 2977851361 | 2977851712 | 388 |
| 209 | iso_pu_bacteria | 2977872689 | 2977877954 | 388 |
| 210 | iso_pu_bacteria | 2977907340 | 2977908260 | 388 |
| 211 | iso_pu_bacteria | 2977915119 | 2977922204 | 388 |
| 212 | iso_pu_bacteria | 2977935797 | 2977941505 | 388 |
| 213 | iso_pu_bacteria | 2977950692 | 2977957408 | 388 |
| 214 | iso_pu_bacteria | 2977957713 | 2977960131 | 388 |
| 215 | iso_pu_bacteria | 2979772303 | 2979772774 | 388 |
| 216 | iso_pu_bacteria | 2979793036 | 2979799584 | 388 |
| 217 | iso_pu_bacteria | 2987645492 | 2987645635 | 388 |
| 218 | iso_pu_bacteria | 2987666974 | 2987670554 | 388 |
| 219 | iso_pu_bacteria | 2987673487 | 2987676109 | 388 |
| 220 | iso_pu_bacteria | 2996386984 | 2996392660 | 388 |
| 221 | iso_pu_bacteria | 3000135777 | 3000138386 | 388 |
| 222 | iso_pu_bacteria | 3004195979 | 3004201954 | 388 |
| 223 | iso_pu_bacteria | 3004248173 | 3004253175 | 388 |
| 224 | iso_pu_bacteria | 3004268573 | 3004275293 | 388 |
| 225 | iso_pu_bacteria | 649633066 | 649873831 | 388 |
| 226 | iso_pu_bacteria | 8004300914 | 8004304045 | 388 |
| 227 | iso_pu_bacteria | 8004312739 | 8004318867 | 388 |
| 228 | iso_pu_bacteria | 8004361976 | 8004367118 | 388 |
| 229 | iso_pu_bacteria | 8004695233 | 8004701461 | 388 |
| 230 | iso_pu_bacteria | 8004727605 | 8004732440 | 388 |
| 231 | 3300005548 | Ga0070665_100008269 | Ga0070665_1000082694 | 389 |
| 232 | 3300028379 | Ga0268266_10049090 | Ga0268266_100490904 | 389 |
| 233 | 3300049586 | Ga0501070_0024243 | Ga0501070_0024243_205_1374 | 389 |
| 234 | iso_pu_bacteria | 2693429783 | 2694632116 | 389 |
| 235 | iso_pu_bacteria | 2693429784 | 2694634477 | 389 |
| 236 | iso_pu_bacteria | 2847686936 | 2847693044 | 389 |
| 237 | iso_pu_bacteria | 2856364286 | 2856368925 | 389 |
| 238 | iso_pu_bacteria | 2857349434 | 2857349502 | 389 |
| 239 | iso_pu_bacteria | 2869285874 | 2869291444 | 389 |
| 240 | iso_pu_bacteria | 2871429161 | 2871433724 | 389 |
| 241 | iso_pu_bacteria | 2874102143 | 2874106254 | 389 |
| 242 | iso_pu_bacteria | 2874146452 | 2874153301 | 389 |
| 243 | iso_pu_bacteria | 2874155637 | 2874160566 | 389 |
| 244 | iso_pu_bacteria | 2876392853 | 2876395070 | 389 |
| 245 | iso_pu_bacteria | 2876413966 | 2876419592 | 389 |
| 246 | iso_pu_bacteria | 2878745973 | 2878751335 | 389 |
| 247 | iso_pu_bacteria | 2881147464 | 2881152759 | 389 |
| 248 | iso_pu_bacteria | 2885305155 | 2885310408 | 389 |
| 249 | iso_pu_bacteria | 2888350351 | 2888356678 | 389 |
| 250 | iso_pu_bacteria | 2889010040 | 2889011554 | 389 |
| 251 | iso_pu_bacteria | 2889016732 | 2889023341 | 389 |
| 252 | iso_pu_bacteria | 2903492973 | 2903501877 | 389 |
| 253 | iso_pu_bacteria | 2904659560 | 2904661701 | 389 |
| 254 | iso_pu_bacteria | 2906308376 | 2906313252 | 389 |
| 255 | iso_pu_bacteria | 2906321335 | 2906325963 | 389 |
| 256 | iso_pu_bacteria | 2906328253 | 2906335174 | 389 |
| 257 | iso_pu_bacteria | 2922130491 | 2922136013 | 389 |
| 258 | iso_pu_bacteria | 2922158528 | 2922162291 | 389 |
| 259 | iso_pu_bacteria | 2924726620 | 2924729219 | 389 |
| 260 | iso_pu_bacteria | 2937813078 | 2937820598 | 389 |
| 261 | iso_pu_bacteria | 2937891427 | 2937891943 | 389 |
| 262 | iso_pu_bacteria | 2958041894 | 2958056346 | 389 |
| 263 | iso_pu_bacteria | 2958100919 | 2958104585 | 389 |
| 264 | iso_pu_bacteria | 2958115193 | 2958122348 | 389 |
| 265 | iso_pu_bacteria | 2958130278 | 2958135843 | 389 |
| 266 | iso_pu_bacteria | 2958172287 | 2958173016 | 389 |
| 267 | iso_pu_bacteria | 2958179912 | 2958185310 | 389 |
| 268 | iso_pu_bacteria | 2961077736 | 2961083577 | 389 |
| 269 | iso_pu_bacteria | 2961114664 | 2961116854 | 389 |
| 270 | iso_pu_bacteria | 2965062239 | 2965068410 | 389 |
| 271 | iso_pu_bacteria | 2968091066 | 2968091891 | 389 |
| 272 | iso_pu_bacteria | 2968110612 | 2968112761 | 389 |
| 273 | iso_pu_bacteria | 2968117919 | 2968123006 | 389 |
| 274 | iso_pu_bacteria | 2968128360 | 2968129952 | 389 |
| 275 | iso_pu_bacteria | 2977843712 | 2977848896 | 389 |
| 276 | iso_pu_bacteria | 2977858184 | 2977862416 | 389 |
| 277 | iso_pu_bacteria | 2977864932 | 2977867545 | 389 |
| 278 | iso_pu_bacteria | 2977942078 | 2977947059 | 389 |
| 279 | iso_pu_bacteria | 2979710463 | 2979714596 | 389 |
| 280 | iso_pu_bacteria | 2979742915 | 2979749509 | 389 |
| 281 | iso_pu_bacteria | 2979779861 | 2979780462 | 389 |
| 282 | iso_pu_bacteria | 2987636660 | 2987645409 | 389 |
| 283 | iso_pu_bacteria | 2987652177 | 2987652850 | 389 |
| 284 | iso_pu_bacteria | 2996341866 | 2996343456 | 389 |
| 285 | iso_pu_bacteria | 3004203850 | 3004206316 | 389 |
| 286 | iso_pu_bacteria | 8004387939 | 8004394001 | 389 |
| 287 | iso_pu_bacteria | 8004445564 | 8004447269 | 389 |
| 288 | iso_pu_bacteria | 8004703790 | 8004713782 | 389 |
| 289 | iso_pu_bacteria | 8004714634 | 8004719508 | 389 |
| 290 | 3300005339 | Ga0070660_100125861 | Ga0070660_1001258611 | 390 |
| 291 | 3300005455 | Ga0070663_100008612 | Ga0070663_1000086122 | 390 |
| 292 | 3300005548 | Ga0070665_100463976 | Ga0070665_1004639761 | 390 |
| 293 | 3300006038 | Ga0075365_10010409 | Ga0075365_100104092 | 390 |
| 294 | 3300006048 | Ga0075363_100018221 | Ga0075363_1000182212 | 390 |
| 295 | 3300009551 | Ga0105238_10098245 | Ga0105238_100982453 | 390 |
| 296 | 3300009551 | Ga0105238_10164249 | Ga0105238_101642492 | 390 |
| 297 | 3300013296 | Ga0157374_10111028 | Ga0157374_101110282 | 390 |
| 298 | 3300014497 | Ga0182008_10035493 | Ga0182008_100354932 | 390 |
| 299 | 3300015262 | Ga0182007_10033297 | Ga0182007_100332972 | 390 |
| 300 | 3300025253 | Ga0209677_111506 | Ga0209677_1115062 | 390 |
| 301 | 3300025254 | Ga0209148_1000072 | Ga0209148_1000072161 | 390 |
| 302 | 3300025272 | Ga0209455_1000133 | Ga0209455_1000133124 | 390 |
| 303 | 3300025909 | Ga0207705_10110877 | Ga0207705_101108771 | 390 |
| 304 | 3300025911 | Ga0207654_10082791 | Ga0207654_100827912 | 390 |
| 305 | 3300025919 | Ga0207657_10120313 | Ga0207657_101203132 | 390 |
| 306 | 3300028379 | Ga0268266_10279886 | Ga0268266_102798862 | 390 |
| 307 | 3300046460 | Ga0495638_0091476 | Ga0495638_0091476_140_1315 | 390 |
| 308 | 3300048912 | Ga0496109_0206665 | Ga0496109_0206665_293_1468 | 390 |
| 309 | 3300048915 | Ga0496112_0054278 | Ga0496112_0054278_171_1343 | 390 |
| 310 | 3300048923 | Ga0496120_0045208 | Ga0496120_0045208_170_1342 | 390 |
| 311 | 3300050490 | nmdc:mga03n38_96945_c1 | nmdc:mga03n38_96945_c1_47_1219 | 390 |
| 312 | iso_pu_bacteria | 2503198000 | 2503202311 | 390 |
| 313 | iso_pu_bacteria | 2513237090 | 2513609830 | 390 |
| 314 | iso_pu_bacteria | 2599185301 | 2599940027 | 390 |
| 315 | iso_pu_bacteria | 2643221550 | 2643773614 | 390 |
| 316 | iso_pu_bacteria | 2643221564 | 2643837362 | 390 |
| 317 | 3300005455 | Ga0070663_100070536 | Ga0070663_1000705362 | 391 |
| 318 | 3300005539 | Ga0068853_100041006 | Ga0068853_1000410063 | 391 |
| 319 | 3300005548 | Ga0070665_100068934 | Ga0070665_1000689342 | 391 |
| 320 | 3300009093 | Ga0105240_10224145 | Ga0105240_102241452 | 391 |
| 321 | 3300009545 | Ga0105237_10055984 | Ga0105237_100559844 | 391 |
| 322 | 3300009551 | Ga0105238_10094317 | Ga0105238_100943172 | 391 |
| 323 | 3300010375 | Ga0105239_10035083 | Ga0105239_100350834 | 391 |
| 324 | 3300013105 | Ga0157369_10229350 | Ga0157369_102293502 | 391 |
| 325 | 3300025911 | Ga0207654_10163112 | Ga0207654_101631121 | 391 |
| 326 | 3300025913 | Ga0207695_10058029 | Ga0207695_100580292 | 391 |
| 327 | 3300025914 | Ga0207671_10055761 | Ga0207671_100557613 | 391 |
| 328 | 3300026041 | Ga0207639_10077995 | Ga0207639_100779952 | 391 |
| 329 | 3300026067 | Ga0207678_10020509 | Ga0207678_100205092 | 391 |
| 330 | 3300026067 | Ga0207678_10029629 | Ga0207678_100296292 | 391 |
| 331 | 3300041413 | Ga0439465_0014756 | Ga0439465_0014756_360_1541 | 391 |
| 332 | 3300048905 | Ga0496102_0196088 | Ga0496102_0196088_303_1478 | 391 |
| 333 | 3300048921 | Ga0496118_0104219 | Ga0496118_0104219_454_1629 | 391 |
| 334 | 3300048924 | Ga0496121_0106521 | Ga0496121_0106521_582_1757 | 391 |
| 335 | 3300048929 | Ga0496126_0097058 | Ga0496126_0097058_1114_2289 | 391 |
| 336 | 3300049568 | Ga0501031_0032883 | Ga0501031_0032883_1499_2677 | 391 |
| 337 | 3300049569 | Ga0501032_0002091 | Ga0501032_0002091_13952_15133 | 391 |
| 338 | 3300049570 | Ga0501033_0006694 | Ga0501033_0006694_7539_8720 | 391 |
| 339 | 3300049572 | Ga0501036_0125662 | Ga0501036_0125662_323_1504 | 391 |
| 340 | 3300049573 | Ga0501037_0000147 | Ga0501037_0000147_31591_32772 | 391 |
| 341 | 3300049574 | Ga0501038_0028088 | Ga0501038_0028088_3338_4519 | 391 |
| 342 | 3300049579 | Ga0501043_0000041 | Ga0501043_0000041_84586_85767 | 391 |
| 343 | 3300049579 | Ga0501043_0277071 | Ga0501043_0277071_20_1201 | 391 |
| 344 | 3300049583 | Ga0501067_0011732 | Ga0501067_0011732_1249_2430 | 391 |
| 345 | 3300049585 | Ga0501069_0000018 | Ga0501069_0000018_43285_44466 | 391 |
| 346 | 3300049585 | Ga0501069_0063971 | Ga0501069_0063971_574_1755 | 391 |
| 347 | 3300049586 | Ga0501070_0000222 | Ga0501070_0000222_47912_49093 | 391 |
| 348 | 3300049586 | Ga0501070_0158330 | Ga0501070_0158330_452_1633 | 391 |
| 349 | 3300049589 | Ga0501073_0014351 | Ga0501073_0014351_3272_4453 | 391 |
| 350 | 3300049590 | Ga0501074_0000001 | Ga0501074_0000001_88451_89632 | 391 |
| 351 | 3300049742 | Ga0501080_0000753 | Ga0501080_0000753_24800_25981 | 391 |
| 352 | 3300049744 | Ga0501083_0000079 | Ga0501083_0000079_24822_26003 | 391 |
| 353 | 3300049822 | Ga0501035_0000061 | Ga0501035_0000061_6475_7656 | 391 |
| 354 | 3300049822 | Ga0501035_0015079 | Ga0501035_0015079_4631_5812 | 391 |
| 355 | 3300049823 | Ga0501044_0000003 | Ga0501044_0000003_260325_261506 | 391 |
| 356 | 3300049823 | Ga0501044_0079923 | Ga0501044_0079923_1924_3105 | 391 |
| 357 | 3300060353 | Ga0501082_0033871 | Ga0501082_0033871_2199_3380 | 391 |
| 358 | iso_pu_bacteria | 2871495908 | 2871500648 | 391 |
| 359 | iso_pu_bacteria | 2878760144 | 2878764737 | 391 |
| 360 | iso_pu_bacteria | 2878767105 | 2878771838 | 391 |
| 361 | iso_pu_bacteria | 2881161766 | 2881168437 | 391 |
| 362 | iso_pu_bacteria | 2903540706 | 2903545461 | 391 |
| 363 | iso_pu_bacteria | 2937994558 | 2937999311 | 391 |
| 364 | iso_pu_bacteria | 2958165035 | 2958169785 | 391 |
| 365 | iso_pu_bacteria | 2961163497 | 2961168245 | 391 |
| 366 | iso_pu_bacteria | 2965018300 | 2965023064 | 391 |
| 367 | iso_pu_bacteria | 2968171901 | 2968176645 | 391 |
| 368 | iso_pu_bacteria | 2970554993 | 2970559584 | 391 |
| 369 | iso_pu_bacteria | 2987659509 | 2987664259 | 391 |
| 370 | iso_pu_bacteria | 3004188549 | 3004193314 | 391 |
| 371 | iso_pu_bacteria | 8004640170 | 8004646817 | 391 |
| 372 | 3300005841 | Ga0068863_100397162 | Ga0068863_1003971622 | 392 |
| 373 | 3300006051 | Ga0075364_10030480 | Ga0075364_100304803 | 392 |
| 374 | 3300009098 | Ga0105245_10382964 | Ga0105245_103829642 | 392 |
| 375 | 3300014969 | Ga0157376_10100548 | Ga0157376_101005482 | 392 |
| 376 | 3300028379 | Ga0268266_10047589 | Ga0268266_100475894 | 392 |
| 377 | 3300046522 | Ga0495643_0064858 | Ga0495643_0064858_578_1756 | 392 |
| 378 | 3300047443 | Ga0495687_038530 | Ga0495687_038530_162_1340 | 392 |
| 379 | 3300053079 | Ga0500610_0042654 | Ga0500610_0042654_368_1546 | 392 |
| 380 | 3300053155 | Ga0500620_001820 | Ga0500620_001820_365_1543 | 392 |
| 381 | 3300053155 | Ga0500620_001912 | Ga0500620_001912_2688_3866 | 392 |
| 382 | 3300003214 | JGI25165J46597_1000033 | JGI25165J46597_1000033194 | 393 |
| 383 | 3300006048 | Ga0075363_100110659 | Ga0075363_1001106592 | 393 |
| 384 | 3300025261 | Ga0209233_1000027 | Ga0209233_1000027470 | 393 |
| 385 | 3300038443 | Ga0395901_0049597 | Ga0395901_0049597_1545_2726 | 393 |
| 386 | 3300049569 | Ga0501032_0000117 | Ga0501032_0000117_64234_65421 | 393 |
| 387 | 3300049569 | Ga0501032_0036484 | Ga0501032_0036484_432_1637 | 393 |
| 388 | 3300049570 | Ga0501033_0000224 | Ga0501033_0000224_34811_35998 | 393 |
| 389 | 3300049570 | Ga0501033_0064399 | Ga0501033_0064399_1066_2271 | 393 |
| 390 | 3300049571 | Ga0501034_0000962 | Ga0501034_0000962_5551_6738 | 393 |
| 391 | 3300049572 | Ga0501036_0000645 | Ga0501036_0000645_12621_13808 | 393 |
| 392 | 3300049572 | Ga0501036_0193577 | Ga0501036_0193577_304_1509 | 393 |
| 393 | 3300049573 | Ga0501037_0001126 | Ga0501037_0001126_18390_19577 | 393 |
| 394 | 3300049573 | Ga0501037_0047876 | Ga0501037_0047876_204_1409 | 393 |
| 395 | 3300049574 | Ga0501038_0000307 | Ga0501038_0000307_34912_36099 | 393 |
| 396 | 3300049574 | Ga0501038_0084777 | Ga0501038_0084777_999_2204 | 393 |
| 397 | 3300049575 | Ga0501039_0000048 | Ga0501039_0000048_18276_19463 | 393 |
| 398 | 3300049579 | Ga0501043_0004586 | Ga0501043_0004586_9189_10376 | 393 |
| 399 | 3300049581 | Ga0501047_0201251 | Ga0501047_0201251_304_1509 | 393 |
| 400 | 3300049742 | Ga0501080_0043984 | Ga0501080_0043984_189_1394 | 393 |
| 401 | 3300049822 | Ga0501035_0001988 | Ga0501035_0001988_18507_19694 | 393 |
| 402 | 3300049822 | Ga0501035_0014704 | Ga0501035_0014704_3036_4241 | 393 |
| 403 | 3300049823 | Ga0501044_0026050 | Ga0501044_0026050_426_1631 | 393 |
| 404 | 3300049823 | Ga0501044_0031442 | Ga0501044_0031442_405_1592 | 393 |
| 405 | 3300050492 | nmdc:mga0yw44_165509_c1 | nmdc:mga0yw44_165509_c1_45_1226 | 393 |
| 406 | 3300025297 | Ga0209758_1004563 | Ga0209758_10045632 | 394 |
| 407 | 3300025949 | Ga0207667_10252997 | Ga0207667_102529972 | 394 |
| 408 | 3300049568 | Ga0501031_0083447 | Ga0501031_0083447_278_1486 | 394 |
| 409 | 3300049570 | Ga0501033_0076579 | Ga0501033_0076579_1055_2263 | 394 |
| 410 | 3300049571 | Ga0501034_0095718 | Ga0501034_0095718_703_1911 | 394 |
| 411 | 3300049573 | Ga0501037_0114454 | Ga0501037_0114454_463_1671 | 394 |
| 412 | 3300049575 | Ga0501039_0163587 | Ga0501039_0163587_284_1492 | 394 |
| 413 | 3300049822 | Ga0501035_0211480 | Ga0501035_0211480_366_1574 | 394 |
| 414 | 3300049823 | Ga0501044_0237971 | Ga0501044_0237971_360_1568 | 394 |
| 415 | 3300002741 | JGI25157J39369_1000723 | JGI25157J39369_100072314 | 395 |
| 416 | 3300025250 | Ga0209026_1000002 | Ga0209026_1000002724 | 395 |
| 417 | 3300025256 | Ga0209759_1000146 | Ga0209759_100014626 | 395 |
| 418 | 3300037418 | Ga0395900_0064054 | Ga0395900_0064054_2573_3760 | 395 |
| 419 | 3300037471 | Ga0395905_0033440 | Ga0395905_0033440_1721_2908 | 395 |
| 420 | 3300037471 | Ga0395905_0060082 | Ga0395905_0060082_2115_3302 | 395 |
| 421 | 3300048923 | Ga0496120_0003082 | Ga0496120_0003082_564_1751 | 395 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8gym-assembly1.cif.gz_t1 | cryo-em structure of tetrahymena thermophila respiratory mega-complex mc iv2+(i+iii2+ii)2 | 0.7205 | 5 | 390 |
| 5ejg-assembly1.cif.gz_B | crystal structure of nad kinase p252d mutant from listeria monocytogenes | 0.7197 | 8 | 123 |
| 8gym-assembly1.cif.gz_t1 | cryo-em structure of tetrahymena thermophila respiratory mega-complex mc iv2+(i+iii2+ii)2 | 0.7048 | 5 | 390 |
| 6rg9-assembly1.cif.gz_A | crystal structure of nad kinase 1 from listeria monocytogenes in complexe with an inhibitor | 0.6909 | 8 | 127 |
| 7e15-assembly2.cif.gz_D | protein ternary complex working for dna replication initiation | 0.6901 | 8 | 122 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_F4IF99_42_436_3.40.50.2000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.865 | 10 | 372 | 3.40.50.2000 |
| af_P10441_9_377_3.40.50.2000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.7978 | 10 | 382 | 3.40.50.2000 |
| af_P10441_9_377_3.40.50.2000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.792 | 10 | 382 | 3.40.50.2000 |
| af_Q22620_372_492_3.40.50.800 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Anticodon-binding domain | 0.7555 | 196 | 233 | 3.40.50.800 |
| 2h1fB02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.7011 | 197 | 301 | 3.40.50.2000 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A530ZZI3-F1-model_v4 | Lipid-A-disaccharide synthase (EC 2.4.1.182) | 0.9664 | 140 | 388 |
GO:0005543
GO:0008915 GO:0009245 GO:0016020 |
| AF-A0A531MLB6-F1-model_v4 | Lipid-A-disaccharide synthase (EC 2.4.1.182) | 0.9636 | 3 | 232 |
GO:0005543
GO:0008915 GO:0009245 GO:0016020 |
| AF-A0A530ZZI3-F1-model_v4 | Lipid-A-disaccharide synthase (EC 2.4.1.182) | 0.9588 | 140 | 388 |
GO:0005543
GO:0008915 GO:0009245 GO:0016020 |
| AF-A0A531MLB6-F1-model_v4 | Lipid-A-disaccharide synthase (EC 2.4.1.182) | 0.9555 | 3 | 232 |
GO:0005543
GO:0008915 GO:0009245 GO:0016020 |
| AF-A0A7V3U1F7-F1-model_v4 | Lipid-A-disaccharide synthase (EC 2.4.1.182) | 0.9358 | 8 | 176 |
GO:0005543
GO:0008915 GO:0009245 GO:0016020 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar