F440050

General Info

Members Datasets Scaffolds Average Seq Length
421 201 840 560

Family's Representative Sequence

Representative Sequence 3300039453|Ga0436362_0775868|Ga0436362_0775868_2346_4211
Length 621
Sequence VDGFYPAPYEADWQSAAGWQPAPLDIMTNQESFMNTALFVGAAGVAAALAVYGQPVTAGPPPPVPAVLRNYQPVTAERLKNPEDGNWLMIRRTYDGWGYSPLTQITPDNAARLKPLWIFSTGEPKVHEAAPIVNNGVMFISTPNNQVIAIDAKSGNLLWRYRRIRPEGASVPHDTSRGVALYGDKVLYAAGEAVLVALDAKTGKEVWTTKVADNTAGYYISLAPLVAGGKVMVGASGGEFGIRGFVAAFDLDTGKELWRTYTIPAPGDPGSETWPKGDEWKNGGGSVWVTGNYDPQTNLAFWGVGNGGPWMGDRRPGDNLYVSSTIALDVATGAIKGHFQYHPNDSWDWDEVSPPVLVDFQRGGRTIKGLIDVARDGYLWFLDRSNVEKGGKIKFIEGKPYVKQNVFTRLDPETGRPEVDPAHKPGTGKRAEYCPSLHGGKNWPPISFSPKTRMIYIPANENLCAASLGADTVEYTPGRGYTGTATTNPSFFVQPGADHIGEVQAWNVDTGQRVWTHSYAKSPNWGAMLATAGGVVFSGGTSDRKFHAFDAATGKLLWEFPTNSGILAPPSSFIVDGKQYVAVLTGWGGDSRGMQANLNRVFPGEYPEVPEGGALWVFALE

Samples

Sample ID Description Type Environment
1 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
139 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
140 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
141 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
142 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
143 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
144 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
145 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
146 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
147 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
148 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
149 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
150 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
151 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
152 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
153 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
154 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
155 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
156 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
157 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
158 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
159 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
160 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
161 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
162 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
163 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
164 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
165 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
166 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
167 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
168 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
169 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
170 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
171 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
172 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
173 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
174 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
175 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
176 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
177 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
178 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
179 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
180 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
181 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
182 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
183 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
184 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
185 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
186 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
187 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
188 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
189 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
191 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
192 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
193 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
194 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
195 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
196 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
197 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
198 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
199 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
200 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
201 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.48
Nodule 0
Rhizoplane 2.38
Rhizosphere 96.2
Stem 0
Stem Tuber 0
Unclassified 8.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436362_0775868 3300039453 Bacteria 5664
2 JGI25406J46586_10002674 3300003203 Bacteria 8398
3 Ga0065715_10004503 3300005293 Bacteria 6592
4 Ga0065715_10099700 3300005293 Unclassified 3377
5 Ga0065707_10103231 3300005295 Unclassified 2759
6 Ga0070683_100006647 3300005329 Bacteria 9711
7 Ga0070683_100009104 3300005329 Bacteria 8477
8 Ga0070683_100058609 3300005329 Bacteria 3577
9 Ga0070683_100067617 3300005329 Bacteria 3328
10 Ga0070690_100000704 3300005330 Bacteria 17143
11 Ga0070690_100048949 3300005330 Bacteria 2693
12 Ga0070690_100060283 3300005330 Unclassified 2442
13 Ga0070670_100028574 3300005331 Bacteria 4799
14 Ga0068869_100005259 3300005334 Bacteria 8129
15 Ga0068869_100095372 3300005334 Bacteria 2245
16 Ga0070666_10002002 3300005335 Bacteria 12401
17 Ga0070666_10031169 3300005335 Unclassified 3519
18 Ga0070666_10042000 3300005335 Bacteria 3057
19 Ga0068868_100002337 3300005338 Bacteria 13121
20 Ga0070689_100008838 3300005340 Bacteria 7116
21 Ga0070691_10006310 3300005341 Bacteria 5419
22 Ga0070687_100001384 3300005343 Bacteria 8498
23 Ga0070687_100060090 3300005343 Bacteria 2004
24 Ga0070661_100061458 3300005344 Unclassified 2757
25 Ga0070669_100025793 3300005353 Bacteria 4223
26 Ga0070669_100054563 3300005353 Bacteria 2927
27 Ga0070669_100089931 3300005353 Unclassified 2300
28 Ga0070675_100000113 3300005354 Bacteria 47301
29 Ga0070675_100000552 3300005354 Bacteria 25730
30 Ga0070675_100003268 3300005354 Bacteria 12292
31 Ga0070675_100005111 3300005354 Bacteria 10006
32 Ga0070675_100011850 3300005354 Bacteria 6831
33 Ga0070675_100025411 3300005354 Bacteria 4749
34 Ga0070675_100077293 3300005354 Unclassified 2770
35 Ga0070671_100003048 3300005355 Bacteria 13032
36 Ga0070671_100012169 3300005355 Bacteria 6924
37 Ga0070674_100001209 3300005356 Bacteria 13542
38 Ga0070673_100004933 3300005364 Bacteria 8498
39 Ga0070673_100009114 3300005364 Bacteria 6645
40 Ga0070673_100015504 3300005364 Bacteria 5355
41 Ga0070673_100049833 3300005364 Bacteria 3271
42 Ga0070688_100061095 3300005365 Unclassified 2381
43 Ga0070667_100003183 3300005367 Bacteria 14060
44 Ga0070667_100017306 3300005367 Bacteria 5973
45 Ga0070709_10036575 3300005434 Bacteria 2992
46 Ga0070714_100001279 3300005435 Bacteria 18196
47 Ga0070713_100001847 3300005436 Bacteria 13661
48 Ga0070701_10009361 3300005438 Bacteria 4288
49 Ga0070701_10049967 3300005438 Bacteria 2164
50 Ga0070700_100003262 3300005441 Bacteria 8356
51 Ga0070663_100023609 3300005455 Bacteria 4124
52 Ga0070678_100001785 3300005456 Bacteria 11592
53 Ga0070678_100063382 3300005456 Bacteria 2735
54 Ga0070662_100043660 3300005457 Bacteria 3208
55 Ga0070681_10030996 3300005458 Bacteria 5368
56 Ga0070681_10085958 3300005458 Bacteria 3098
57 Ga0068867_100032146 3300005459 Unclassified 3793
58 Ga0070685_10003428 3300005466 Bacteria 8062
59 Ga0070685_10005450 3300005466 Bacteria 6445
60 Ga0070707_100011206 3300005468 Bacteria 8356
61 Ga0070707_100154657 3300005468 Bacteria 2234
62 Ga0070679_100002782 3300005530 Bacteria 15900
63 Ga0070679_100058967 3300005530 Bacteria 3825
64 Ga0070684_100005311 3300005535 Bacteria 9861
65 Ga0070684_100046660 3300005535 Bacteria 3754
66 Ga0068853_100032023 3300005539 Bacteria 4452
67 Ga0070672_100003951 3300005543 Bacteria 9666
68 Ga0070672_100004343 3300005543 Bacteria 9276
69 Ga0070672_100024069 3300005543 Bacteria 4494
70 Ga0070686_100034016 3300005544 Unclassified 3137
71 Ga0070686_100037793 3300005544 Bacteria 2997
72 Ga0070695_100055761 3300005545 Bacteria 2548
73 Ga0070695_100085522 3300005545 Unclassified 2094
74 Ga0070665_100060895 3300005548 Bacteria 3784
75 Ga0068855_100038281 3300005563 Bacteria 5698
76 Ga0070664_100002733 3300005564 Bacteria 14242
77 Ga0070664_100005307 3300005564 Bacteria 10337
78 Ga0070664_100048340 3300005564 Bacteria 3595
79 Ga0068857_100002214 3300005577 Bacteria 15829
80 Ga0068857_100010888 3300005577 Bacteria 7915
81 Ga0068856_100001400 3300005614 Bacteria 25271
82 Ga0068856_100044955 3300005614 Bacteria 4347
83 Ga0068859_100006244 3300005617 Bacteria 12096
84 Ga0068859_100006614 3300005617 Bacteria 11770
85 Ga0068859_100006749 3300005617 Bacteria 11660
86 Ga0068859_100017775 3300005617 Bacteria 7148
87 Ga0068859_100023706 3300005617 Bacteria 6160
88 Ga0068859_100034290 3300005617 Bacteria 5094
89 Ga0068859_100053127 3300005617 Unclassified 4074
90 Ga0068859_100105330 3300005617 Bacteria 2880
91 Ga0068864_100001431 3300005618 Bacteria 19685
92 Ga0068864_100073522 3300005618 Bacteria 2981
93 Ga0068861_100015165 3300005719 Bacteria 5424
94 Ga0068870_10000225 3300005840 Bacteria 20697
95 Ga0068870_10016159 3300005840 Bacteria 3560
96 Ga0068863_100001281 3300005841 Bacteria 25089
97 Ga0068863_100008128 3300005841 Bacteria 10242
98 Ga0068863_100024102 3300005841 Bacteria 5806
99 Ga0068858_100008702 3300005842 Bacteria 9746
100 Ga0068858_100012568 3300005842 Bacteria 7983
101 Ga0068858_100061702 3300005842 Bacteria 3466
102 Ga0068858_100100268 3300005842 Bacteria 2701
103 Ga0068860_100003438 3300005843 Bacteria 16287
104 Ga0068860_100006015 3300005843 Bacteria 12211
105 Ga0068860_100021110 3300005843 Bacteria 6307
106 Ga0068860_100030863 3300005843 Bacteria 5152
107 Ga0068860_100129281 3300005843 Bacteria 2423
108 Ga0081540_1018589 3300005983 Bacteria 4257
109 Ga0081539_10000012 3300005985 Bacteria 440369
110 Ga0070716_100022293 3300006173 Bacteria 3345
111 Ga0097621_100002925 3300006237 Bacteria 11738
112 Ga0097621_100028795 3300006237 Bacteria 4381
113 Ga0097621_100038167 3300006237 Bacteria 3854
114 Ga0097621_100082007 3300006237 Bacteria 2685
115 Ga0097621_100084530 3300006237 Bacteria 2646
116 Ga0068871_100001631 3300006358 Bacteria 15107
117 Ga0068871_100016214 3300006358 Bacteria 5603
118 Ga0068871_100025250 3300006358 Bacteria 4620
119 Ga0068871_100107439 3300006358 Bacteria 2344
120 Ga0075428_100003885 3300006844 Bacteria 16418
121 Ga0075428_100061769 3300006844 Bacteria 4103
122 Ga0075430_100005421 3300006846 Bacteria 10775
123 Ga0075430_100006864 3300006846 Bacteria 9602
124 Ga0075431_100005088 3300006847 Bacteria 12936
125 Ga0075431_100020314 3300006847 Bacteria 6784
126 Ga0075433_10006381 3300006852 Bacteria 9328
127 Ga0075433_10015358 3300006852 Bacteria 6278
128 Ga0075433_10017249 3300006852 Bacteria 5976
129 Ga0075434_100006259 3300006871 Bacteria 10902
130 Ga0075434_100066862 3300006871 Bacteria 3581
131 Ga0075429_100130173 3300006880 Unclassified 2201
132 Ga0068865_100046418 3300006881 Bacteria 2980
133 Ga0097620_100006244 3300006931 Bacteria 12096
134 Ga0097620_100006614 3300006931 Bacteria 11770
135 Ga0097620_100006749 3300006931 Bacteria 11660
136 Ga0097620_100017775 3300006931 Bacteria 7148
137 Ga0097620_100023706 3300006931 Bacteria 6160
138 Ga0097620_100034291 3300006931 Bacteria 5094
139 Ga0097620_100053125 3300006931 Unclassified 4074
140 Ga0097620_100105327 3300006931 Bacteria 2880
141 Ga0075435_100037506 3300007076 Bacteria 3860
142 Ga0105240_10009249 3300009093 Bacteria 13974
143 Ga0105240_10040433 3300009093 Bacteria 5963
144 Ga0105240_10092575 3300009093 Bacteria 3691
145 Ga0105240_10104840 3300009093 Bacteria 3433
146 Ga0111539_10000040 3300009094 Bacteria 136085
147 Ga0111539_10002458 3300009094 Bacteria 24607
148 Ga0111539_10004553 3300009094 Bacteria 18127
149 Ga0111539_10006282 3300009094 Bacteria 15341
150 Ga0111539_10008880 3300009094 Bacteria 12727
151 Ga0111539_10018008 3300009094 Bacteria 8748
152 Ga0111539_10033124 3300009094 Bacteria 6273
153 Ga0111539_10046547 3300009094 Bacteria 5188
154 Ga0111539_10051194 3300009094 Unclassified 4919
155 Ga0105245_10001772 3300009098 Bacteria 19665
156 Ga0105245_10010124 3300009098 Bacteria 8212
157 Ga0105245_10053653 3300009098 Bacteria 3618
158 Ga0105245_10122385 3300009098 Bacteria 2432
159 Ga0114129_10001421 3300009147 Bacteria 32301
160 Ga0114129_10004206 3300009147 Bacteria 20340
161 Ga0114129_10042075 3300009147 Bacteria 6433
162 Ga0114129_10043199 3300009147 Bacteria 6341
163 Ga0114129_10052038 3300009147 Bacteria 5747
164 Ga0114129_10155962 3300009147 Bacteria 3122
165 Ga0114129_10192303 3300009147 Unclassified 2770
166 Ga0105243_10043470 3300009148 Bacteria 3521
167 Ga0105241_10018715 3300009174 Bacteria 5100
168 Ga0105241_10071598 3300009174 Bacteria 2691
169 Ga0105241_10081200 3300009174 Bacteria 2539
170 Ga0105242_10020906 3300009176 Bacteria 5133
171 Ga0105242_10038571 3300009176 Bacteria 3842
172 Ga0105242_10154413 3300009176 Bacteria 2004
173 Ga0105248_10000277 3300009177 Bacteria 60423
174 Ga0105248_10011614 3300009177 Bacteria 9701
175 Ga0105248_10022546 3300009177 Bacteria 6986
176 Ga0105248_10054025 3300009177 Bacteria 4505
177 Ga0105238_10007997 3300009551 Bacteria 10582
178 Ga0105238_10070175 3300009551 Bacteria 3503
179 Ga0105238_10083349 3300009551 Bacteria 3186
180 Ga0105238_10194973 3300009551 Bacteria 2001
181 Ga0105249_10000590 3300009553 Bacteria 33184
182 Ga0105249_10023776 3300009553 Bacteria 5503
183 Ga0157374_10029606 3300013296 Bacteria 4961
184 Ga0157378_10006402 3300013297 Bacteria 10295
185 Ga0163162_10016813 3300013306 Bacteria 7150
186 Ga0163162_10072371 3300013306 Bacteria 3502
187 Ga0157372_10009101 3300013307 Bacteria 10549
188 Ga0157375_10001019 3300013308 Bacteria 24232
189 Ga0157375_10001153 3300013308 Bacteria 22834
190 Ga0157375_10173954 3300013308 Bacteria 2302
191 Ga0163163_10004060 3300014325 Bacteria 12487
192 Ga0163163_10017721 3300014325 Bacteria 6648
193 Ga0163163_10017830 3300014325 Bacteria 6627
194 Ga0157380_10001387 3300014326 Bacteria 15804
195 Ga0157380_10012482 3300014326 Bacteria 6165
196 Ga0157380_10071058 3300014326 Bacteria 2815
197 Ga0157380_10159964 3300014326 Unclassified 1956
198 Ga0157379_10000497 3300014968 Bacteria 31919
199 Ga0157379_10001547 3300014968 Bacteria 18911
200 Ga0157379_10003212 3300014968 Bacteria 13849
201 Ga0157376_10017413 3300014969 Bacteria 5481
202 Ga0163161_10018006 3300017792 Unclassified 4951
203 Ga0207697_10000380 3300025315 Bacteria 24920
204 Ga0207656_10011824 3300025321 Bacteria 3304
205 Ga0207682_10001942 3300025893 Bacteria 9397
206 Ga0207682_10015487 3300025893 Bacteria 2967
207 Ga0207692_10015769 3300025898 Bacteria 3332
208 Ga0207688_10000558 3300025901 Bacteria 18187
209 Ga0207688_10038245 3300025901 Bacteria 2662
210 Ga0207680_10002569 3300025903 Bacteria 8467
211 Ga0207680_10006798 3300025903 Bacteria 5551
212 Ga0207699_10009363 3300025906 Bacteria 4873
213 Ga0207645_10002359 3300025907 Bacteria 14887
214 Ga0207645_10017320 3300025907 Bacteria 4758
215 Ga0207645_10024514 3300025907 Unclassified 3909
216 Ga0207645_10060457 3300025907 Bacteria 2420
217 Ga0207643_10001063 3300025908 Bacteria 16245
218 Ga0207654_10003152 3300025911 Bacteria 8334
219 Ga0207707_10001854 3300025912 Bacteria 19318
220 Ga0207695_10043974 3300025913 Bacteria 4755
221 Ga0207663_10085605 3300025916 Bacteria 2076
222 Ga0207662_10007974 3300025918 Bacteria 5772
223 Ga0207662_10009747 3300025918 Bacteria 5297
224 Ga0207649_10031240 3300025920 Unclassified 3164
225 Ga0207652_10008252 3300025921 Bacteria 8367
226 Ga0207652_10059649 3300025921 Bacteria 3289
227 Ga0207646_10006616 3300025922 Bacteria 11964
228 Ga0207646_10096441 3300025922 Bacteria 2650
229 Ga0207681_10009938 3300025923 Bacteria 5823
230 Ga0207694_10002535 3300025924 Bacteria 14833
231 Ga0207694_10021414 3300025924 Bacteria 4899
232 Ga0207694_10109684 3300025924 Bacteria 2195
233 Ga0207650_10002816 3300025925 Bacteria 12011
234 Ga0207659_10000858 3300025926 Bacteria 18047
235 Ga0207659_10001289 3300025926 Bacteria 14977
236 Ga0207659_10002152 3300025926 Bacteria 11704
237 Ga0207659_10005803 3300025926 Bacteria 7523
238 Ga0207659_10006495 3300025926 Bacteria 7166
239 Ga0207659_10014756 3300025926 Bacteria 5048
240 Ga0207659_10035321 3300025926 Bacteria 3454
241 Ga0207659_10065272 3300025926 Bacteria 2637
242 Ga0207687_10001266 3300025927 Bacteria 17283
243 Ga0207687_10004460 3300025927 Bacteria 9327
244 Ga0207687_10107216 3300025927 Unclassified 2067
245 Ga0207700_10000642 3300025928 Bacteria 20387
246 Ga0207664_10005781 3300025929 Bacteria 8461
247 Ga0207644_10008979 3300025931 Bacteria 6549
248 Ga0207690_10060329 3300025932 Unclassified 2574
249 Ga0207706_10001124 3300025933 Bacteria 27217
250 Ga0207686_10005181 3300025934 Bacteria 7003
251 Ga0207686_10040530 3300025934 Bacteria 2832
252 Ga0207709_10011487 3300025935 Bacteria 4886
253 Ga0207670_10027754 3300025936 Unclassified 3584
254 Ga0207669_10001685 3300025937 Bacteria 9392
255 Ga0207669_10096523 3300025937 Bacteria 1941
256 Ga0207704_10019925 3300025938 Bacteria 3536
257 Ga0207691_10002447 3300025940 Bacteria 18147
258 Ga0207691_10045946 3300025940 Unclassified 4014
259 Ga0207691_10058883 3300025940 Bacteria 3494
260 Ga0207711_10002709 3300025941 Bacteria 15633
261 Ga0207711_10008504 3300025941 Bacteria 8588
262 Ga0207711_10042434 3300025941 Bacteria 3876
263 Ga0207711_10043748 3300025941 Bacteria 3822
264 Ga0207689_10001758 3300025942 Bacteria 20435
265 Ga0207689_10022753 3300025942 Bacteria 5265
266 Ga0207689_10113694 3300025942 Bacteria 2225
267 Ga0207661_10001931 3300025944 Bacteria 14253
268 Ga0207661_10006343 3300025944 Bacteria 8365
269 Ga0207661_10086898 3300025944 Bacteria 2596
270 Ga0207661_10088389 3300025944 Bacteria 2576
271 Ga0207679_10006537 3300025945 Bacteria 7367
272 Ga0207679_10119399 3300025945 Bacteria 2096
273 Ga0207667_10000667 3300025949 Bacteria 44413
274 Ga0207667_10102640 3300025949 Bacteria 2950
275 Ga0207651_10010877 3300025960 Bacteria 5064
276 Ga0207651_10014763 3300025960 Bacteria 4520
277 Ga0207677_10072479 3300026023 Bacteria 2435
278 Ga0207703_10027978 3300026035 Bacteria 4439
279 Ga0207703_10029365 3300026035 Bacteria 4338
280 Ga0207703_10032633 3300026035 Bacteria 4122
281 Ga0207703_10057490 3300026035 Bacteria 3172
282 Ga0207703_10146370 3300026035 Unclassified 2055
283 Ga0207678_10045254 3300026067 Bacteria 3806
284 Ga0207708_10024647 3300026075 Bacteria 4550
285 Ga0207708_10100678 3300026075 Unclassified 2236
286 Ga0207702_10003025 3300026078 Bacteria 15619
287 Ga0207702_10087954 3300026078 Unclassified 2714
288 Ga0207641_10001278 3300026088 Bacteria 25052
289 Ga0207648_10005564 3300026089 Bacteria 12679
290 Ga0207648_10157095 3300026089 Unclassified 2008
291 Ga0207676_10008059 3300026095 Bacteria 7489
292 Ga0207674_10002402 3300026116 Bacteria 23626
293 Ga0207674_10167059 3300026116 Bacteria 2154
294 Ga0207675_100011359 3300026118 Bacteria 8334
295 Ga0207683_10026009 3300026121 Bacteria 5053
296 Ga0207683_10028916 3300026121 Bacteria 4796
297 Ga0207428_10000135 3300027907 Bacteria 99170
298 Ga0207428_10004182 3300027907 Bacteria 13834
299 Ga0207428_10006631 3300027907 Bacteria 10643
300 Ga0207428_10017582 3300027907 Bacteria 6131
301 Ga0207428_10017802 3300027907 Bacteria 6093
302 Ga0207428_10070453 3300027907 Bacteria 2748
303 Ga0268264_10007802 3300028381 Bacteria 8908
304 Ga0268264_10056913 3300028381 Bacteria 3269
305 Ga0268264_10057361 3300028381 Unclassified 3257
306 Ga0268264_10127004 3300028381 Unclassified 2255
307 Ga0265314_10001974 3300031711 Bacteria 21795
308 Ga0373929_0000361 3300035085 Bacteria 8482
309 Ga0373934_0004193 3300035086 Bacteria 5319
310 Ga0373934_0024053 3300035086 Bacteria 2355
311 Ga0373949_0006101 3300035090 Bacteria 2667
312 Ga0373951_0001831 3300035091 Bacteria 5513
313 Ga0373923_0018140 3300035111 Bacteria 2704
314 Ga0373939_0006257 3300035114 Bacteria 2864
315 Ga0373941_0002605 3300035115 Bacteria 3997
316 Ga0373943_0004970 3300035170 Bacteria 6002
317 Ga0373943_0085272 3300035170 Bacteria 1626
318 Ga0373955_0006886 3300035172 Bacteria 5198
319 Ga0373955_0012202 3300035172 Bacteria 4125
320 Ga0373942_0003739 3300035207 Bacteria 3566
321 Ga0373962_0001555 3300035242 Bacteria 5440
322 Ga0373924_0020709 3300035410 Bacteria 2559
323 Ga0373931_0023037 3300035691 Bacteria 3140
324 Ga0373931_0078938 3300035691 Unclassified 1812
325 Ga0373935_0045321 3300035692 Bacteria 2775
326 Ga0373935_0063049 3300035692 Bacteria 2375
327 Ga0373933_0025067 3300035724 Bacteria 3418
328 Ga0373933_0049304 3300035724 Bacteria 2510
329 Ga0373933_0105418 3300035724 Bacteria 1753
330 Ga0373947_0011765 3300035725 Bacteria 5014
331 Ga0373947_0053412 3300035725 Bacteria 2436
332 Ga0373947_0092192 3300035725 Bacteria 1891
333 Ga0373937_0002833 3300036401 Bacteria 14500
334 Ga0373937_0017677 3300036401 Bacteria 6362
335 Ga0373937_0035279 3300036401 Bacteria 4552
336 Ga0373937_0081796 3300036401 Bacteria 2988
337 Ga0373937_0101437 3300036401 Bacteria 2671
338 Ga0373937_0283611 3300036401 Bacteria 1564
339 Ga0373925_0005722 3300037068 Bacteria 9242
340 Ga0373925_0015488 3300037068 Bacteria 5513
341 Ga0373925_0023120 3300037068 Bacteria 4536
342 Ga0373925_0046293 3300037068 Bacteria 3234
343 Ga0436364_0442474 3300037853 Bacteria 4770
344 Ga0436364_0948665 3300037853 Bacteria 4924
345 Ga0436364_0991701 3300037853 Bacteria 11534
346 Ga0436365_1247504 3300039437 Unclassified 4415
347 Ga0439435_0019412 3300042436 Bacteria 1742
348 Ga0451576_0005817 3300045051 Bacteria 15328
349 Ga0495592_0005320 3300046454 Bacteria 9491
350 Ga0495592_0016732 3300046454 Bacteria 5566
351 Ga0495653_0093045 3300046463 Bacteria 2200
352 Ga0495580_0029542 3300046472 Bacteria 3977
353 Ga0495594_0035781 3300046499 Bacteria 2706
354 Ga0495608_0006964 3300046511 Bacteria 8004
355 Ga0495608_0041688 3300046511 Bacteria 3071
356 Ga0495618_0014859 3300046514 Unclassified 4750
357 Ga0495587_0019278 3300046536 Bacteria 4224
358 Ga0495587_0076167 3300046536 Bacteria 1948
359 Ga0495667_0001971 3300046559 Bacteria 13590
360 Ga0495667_0024238 3300046559 Bacteria 4086
361 Ga0495657_0040736 3300046675 Bacteria 3183
362 Ga0495599_0041035 3300046678 Bacteria 2906
363 Ga0495599_0087363 3300046678 Unclassified 1946
364 Ga0495658_0023549 3300046683 Bacteria 3269
365 Ga0495658_0043404 3300046683 Unclassified 2515
366 Ga0495669_0005852 3300046684 Bacteria 5126
367 Ga0495613_0003129 3300046689 Bacteria 12394
368 Ga0495613_0045145 3300046689 Bacteria 3260
369 Ga0495604_0070940 3300047317 Bacteria 2637
370 Ga0495674_0012899 3300047319 Bacteria 7870
371 Ga0495674_0026720 3300047319 Bacteria 5280
372 Ga0495680_0000614 3300047322 Bacteria 40108
373 Ga0495684_0000761 3300047471 Bacteria 26013
374 Ga0495684_0026377 3300047471 Bacteria 4465
375 Ga0495602_0120654 3300048088 Bacteria 2110
376 Ga0496100_0022615 3300048903 Bacteria 3806
377 Ga0496101_0038337 3300048904 Bacteria 3403
378 Ga0496104_0045917 3300048907 Bacteria 4110
379 Ga0496105_0039627 3300048908 Bacteria 3884
380 Ga0496106_0080818 3300048909 Bacteria 2497
381 Ga0496107_0057895 3300048910 Bacteria 2802
382 Ga0496108_0119801 3300048911 Bacteria 2256
383 Ga0496111_0082111 3300048914 Bacteria 2353
384 Ga0496112_0131459 3300048915 Bacteria 2474
385 Ga0496113_0048647 3300048916 Bacteria 3155
386 Ga0501046_0050077 3300049580 Bacteria 3301
387 Ga0501249_006744 3300049679 Bacteria 2366
388 nmdc:mga05p37_19379_c1 3300050507 Bacteria 8231
389 nmdc:mga05p37_33394_c1 3300050507 Bacteria 6302
390 nmdc:mga05p37_46127_c1 3300050507 Bacteria 5359
391 nmdc:mga05p37_6809_c1 3300050507 Bacteria 13470
392 nmdc:mga09592_10962_c1 3300050508 Bacteria 7373
393 nmdc:mga09592_16355_c1 3300050508 Bacteria 6067
394 nmdc:mga09592_40128_c1 3300050508 Bacteria 3932
395 nmdc:mga0qj67_4892_c1 3300050509 Bacteria 9741
396 nmdc:mga06r32_11960_c1 3300050510 Bacteria 7822
397 nmdc:mga06r32_14803_c1 3300050510 Bacteria 7078
398 nmdc:mga06r32_5558_c1 3300050510 Bacteria 11357
399 nmdc:mga08y16_119712_c1 3300050511 Bacteria 2740
400 nmdc:mga08y16_1391_c1 3300050511 Bacteria 24210
401 nmdc:mga08y16_205355_c1 3300050511 Unclassified 2041
402 nmdc:mga08y16_22229_c1 3300050511 Bacteria 6694
403 nmdc:mga08y16_37971_c1 3300050511 Bacteria 5056
404 nmdc:mga08y16_39568_c1 3300050511 Bacteria 4947
405 nmdc:mga08y16_4468_c1 3300050511 Bacteria 14615
406 nmdc:mga08y16_8160_c1 3300050511 Bacteria 10957
407 nmdc:mga08y16_9814_c1 3300050511 Bacteria 10049
408 nmdc:mga0n895_123890_c1 3300050512 Bacteria 2607
409 nmdc:mga0n895_244596_c1 3300050512 Bacteria 1821
410 nmdc:mga0n895_61466_c1 3300050512 Bacteria 3708
411 nmdc:mga0n895_64498_c1 3300050512 Unclassified 3623
412 nmdc:mga0a205_15529_c1 3300050515 Bacteria 7116
413 nmdc:mga0a205_18254_c1 3300050515 Bacteria 6591
414 nmdc:mga0a205_7071_c1 3300050515 Bacteria 10137
415 nmdc:mga0a205_74_c1 3300050515 Bacteria 54821
416 nmdc:mga0a205_9703_c1 3300050515 Bacteria 8814
417 Ga0495601_0001746 3300053077 Bacteria 12021
418 Ga0495619_0004374 3300053085 Bacteria 9012
419 Ga0500568_0004037 3300053139 Bacteria 7954
420 Ga0500645_008949 3300053730 Bacteria 3386
421 Ga0436362_0775868
422 JGI25406J46586_10002674
423 Ga0065715_10004503
424 Ga0065715_10099700
425 Ga0065707_10103231
426 Ga0070683_100006647
427 Ga0070683_100009104
428 Ga0070683_100058609
429 Ga0070683_100067617
430 Ga0070690_100000704
431 Ga0070690_100048949
432 Ga0070690_100060283
433 Ga0070670_100028574
434 Ga0068869_100005259
435 Ga0068869_100095372
436 Ga0070666_10002002
437 Ga0070666_10031169
438 Ga0070666_10042000
439 Ga0068868_100002337
440 Ga0070689_100008838
441 Ga0070691_10006310
442 Ga0070687_100001384
443 Ga0070687_100060090
444 Ga0070661_100061458
445 Ga0070669_100025793
446 Ga0070669_100054563
447 Ga0070669_100089931
448 Ga0070675_100000113
449 Ga0070675_100000552
450 Ga0070675_100003268
451 Ga0070675_100005111
452 Ga0070675_100011850
453 Ga0070675_100025411
454 Ga0070675_100077293
455 Ga0070671_100003048
456 Ga0070671_100012169
457 Ga0070674_100001209
458 Ga0070673_100004933
459 Ga0070673_100009114
460 Ga0070673_100015504
461 Ga0070673_100049833
462 Ga0070688_100061095
463 Ga0070667_100003183
464 Ga0070667_100017306
465 Ga0070709_10036575
466 Ga0070714_100001279
467 Ga0070713_100001847
468 Ga0070701_10009361
469 Ga0070701_10049967
470 Ga0070700_100003262
471 Ga0070663_100023609
472 Ga0070678_100001785
473 Ga0070678_100063382
474 Ga0070662_100043660
475 Ga0070681_10030996
476 Ga0070681_10085958
477 Ga0068867_100032146
478 Ga0070685_10003428
479 Ga0070685_10005450
480 Ga0070707_100011206
481 Ga0070707_100154657
482 Ga0070679_100002782
483 Ga0070679_100058967
484 Ga0070684_100005311
485 Ga0070684_100046660
486 Ga0068853_100032023
487 Ga0070672_100003951
488 Ga0070672_100004343
489 Ga0070672_100024069
490 Ga0070686_100034016
491 Ga0070686_100037793
492 Ga0070695_100055761
493 Ga0070695_100085522
494 Ga0070665_100060895
495 Ga0068855_100038281
496 Ga0070664_100002733
497 Ga0070664_100005307
498 Ga0070664_100048340
499 Ga0068857_100002214
500 Ga0068857_100010888
501 Ga0068856_100001400
502 Ga0068856_100044955
503 Ga0068859_100006244
504 Ga0068859_100006614
505 Ga0068859_100006749
506 Ga0068859_100017775
507 Ga0068859_100023706
508 Ga0068859_100034290
509 Ga0068859_100053127
510 Ga0068859_100105330
511 Ga0068864_100001431
512 Ga0068864_100073522
513 Ga0068861_100015165
514 Ga0068870_10000225
515 Ga0068870_10016159
516 Ga0068863_100001281
517 Ga0068863_100008128
518 Ga0068863_100024102
519 Ga0068858_100008702
520 Ga0068858_100012568
521 Ga0068858_100061702
522 Ga0068858_100100268
523 Ga0068860_100003438
524 Ga0068860_100006015
525 Ga0068860_100021110
526 Ga0068860_100030863
527 Ga0068860_100129281
528 Ga0081540_1018589
529 Ga0081539_10000012
530 Ga0070716_100022293
531 Ga0097621_100002925
532 Ga0097621_100028795
533 Ga0097621_100038167
534 Ga0097621_100082007
535 Ga0097621_100084530
536 Ga0068871_100001631
537 Ga0068871_100016214
538 Ga0068871_100025250
539 Ga0068871_100107439
540 Ga0075428_100003885
541 Ga0075428_100061769
542 Ga0075430_100005421
543 Ga0075430_100006864
544 Ga0075431_100005088
545 Ga0075431_100020314
546 Ga0075433_10006381
547 Ga0075433_10015358
548 Ga0075433_10017249
549 Ga0075434_100006259
550 Ga0075434_100066862
551 Ga0075429_100130173
552 Ga0068865_100046418
553 Ga0097620_100006244
554 Ga0097620_100006614
555 Ga0097620_100006749
556 Ga0097620_100017775
557 Ga0097620_100023706
558 Ga0097620_100034291
559 Ga0097620_100053125
560 Ga0097620_100105327
561 Ga0075435_100037506
562 Ga0105240_10009249
563 Ga0105240_10040433
564 Ga0105240_10092575
565 Ga0105240_10104840
566 Ga0111539_10000040
567 Ga0111539_10002458
568 Ga0111539_10004553
569 Ga0111539_10006282
570 Ga0111539_10008880
571 Ga0111539_10018008
572 Ga0111539_10033124
573 Ga0111539_10046547
574 Ga0111539_10051194
575 Ga0105245_10001772
576 Ga0105245_10010124
577 Ga0105245_10053653
578 Ga0105245_10122385
579 Ga0114129_10001421
580 Ga0114129_10004206
581 Ga0114129_10042075
582 Ga0114129_10043199
583 Ga0114129_10052038
584 Ga0114129_10155962
585 Ga0114129_10192303
586 Ga0105243_10043470
587 Ga0105241_10018715
588 Ga0105241_10071598
589 Ga0105241_10081200
590 Ga0105242_10020906
591 Ga0105242_10038571
592 Ga0105242_10154413
593 Ga0105248_10000277
594 Ga0105248_10011614
595 Ga0105248_10022546
596 Ga0105248_10054025
597 Ga0105238_10007997
598 Ga0105238_10070175
599 Ga0105238_10083349
600 Ga0105238_10194973
601 Ga0105249_10000590
602 Ga0105249_10023776
603 Ga0157374_10029606
604 Ga0157378_10006402
605 Ga0163162_10016813
606 Ga0163162_10072371
607 Ga0157372_10009101
608 Ga0157375_10001019
609 Ga0157375_10001153
610 Ga0157375_10173954
611 Ga0163163_10004060
612 Ga0163163_10017721
613 Ga0163163_10017830
614 Ga0157380_10001387
615 Ga0157380_10012482
616 Ga0157380_10071058
617 Ga0157380_10159964
618 Ga0157379_10000497
619 Ga0157379_10001547
620 Ga0157379_10003212
621 Ga0157376_10017413
622 Ga0163161_10018006
623 Ga0207697_10000380
624 Ga0207656_10011824
625 Ga0207682_10001942
626 Ga0207682_10015487
627 Ga0207692_10015769
628 Ga0207688_10000558
629 Ga0207688_10038245
630 Ga0207680_10002569
631 Ga0207680_10006798
632 Ga0207699_10009363
633 Ga0207645_10002359
634 Ga0207645_10017320
635 Ga0207645_10024514
636 Ga0207645_10060457
637 Ga0207643_10001063
638 Ga0207654_10003152
639 Ga0207707_10001854
640 Ga0207695_10043974
641 Ga0207663_10085605
642 Ga0207662_10007974
643 Ga0207662_10009747
644 Ga0207649_10031240
645 Ga0207652_10008252
646 Ga0207652_10059649
647 Ga0207646_10006616
648 Ga0207646_10096441
649 Ga0207681_10009938
650 Ga0207694_10002535
651 Ga0207694_10021414
652 Ga0207694_10109684
653 Ga0207650_10002816
654 Ga0207659_10000858
655 Ga0207659_10001289
656 Ga0207659_10002152
657 Ga0207659_10005803
658 Ga0207659_10006495
659 Ga0207659_10014756
660 Ga0207659_10035321
661 Ga0207659_10065272
662 Ga0207687_10001266
663 Ga0207687_10004460
664 Ga0207687_10107216
665 Ga0207700_10000642
666 Ga0207664_10005781
667 Ga0207644_10008979
668 Ga0207690_10060329
669 Ga0207706_10001124
670 Ga0207686_10005181
671 Ga0207686_10040530
672 Ga0207709_10011487
673 Ga0207670_10027754
674 Ga0207669_10001685
675 Ga0207669_10096523
676 Ga0207704_10019925
677 Ga0207691_10002447
678 Ga0207691_10045946
679 Ga0207691_10058883
680 Ga0207711_10002709
681 Ga0207711_10008504
682 Ga0207711_10042434
683 Ga0207711_10043748
684 Ga0207689_10001758
685 Ga0207689_10022753
686 Ga0207689_10113694
687 Ga0207661_10001931
688 Ga0207661_10006343
689 Ga0207661_10086898
690 Ga0207661_10088389
691 Ga0207679_10006537
692 Ga0207679_10119399
693 Ga0207667_10000667
694 Ga0207667_10102640
695 Ga0207651_10010877
696 Ga0207651_10014763
697 Ga0207677_10072479
698 Ga0207703_10027978
699 Ga0207703_10029365
700 Ga0207703_10032633
701 Ga0207703_10057490
702 Ga0207703_10146370
703 Ga0207678_10045254
704 Ga0207708_10024647
705 Ga0207708_10100678
706 Ga0207702_10003025
707 Ga0207702_10087954
708 Ga0207641_10001278
709 Ga0207648_10005564
710 Ga0207648_10157095
711 Ga0207676_10008059
712 Ga0207674_10002402
713 Ga0207674_10167059
714 Ga0207675_100011359
715 Ga0207683_10026009
716 Ga0207683_10028916
717 Ga0207428_10000135
718 Ga0207428_10004182
719 Ga0207428_10006631
720 Ga0207428_10017582
721 Ga0207428_10017802
722 Ga0207428_10070453
723 Ga0268264_10007802
724 Ga0268264_10056913
725 Ga0268264_10057361
726 Ga0268264_10127004
727 Ga0265314_10001974
728 Ga0373929_0000361
729 Ga0373934_0004193
730 Ga0373934_0024053
731 Ga0373949_0006101
732 Ga0373951_0001831
733 Ga0373923_0018140
734 Ga0373939_0006257
735 Ga0373941_0002605
736 Ga0373943_0004970
737 Ga0373943_0085272
738 Ga0373955_0006886
739 Ga0373955_0012202
740 Ga0373942_0003739
741 Ga0373962_0001555
742 Ga0373924_0020709
743 Ga0373931_0023037
744 Ga0373931_0078938
745 Ga0373935_0045321
746 Ga0373935_0063049
747 Ga0373933_0025067
748 Ga0373933_0049304
749 Ga0373933_0105418
750 Ga0373947_0011765
751 Ga0373947_0053412
752 Ga0373947_0092192
753 Ga0373937_0002833
754 Ga0373937_0017677
755 Ga0373937_0035279
756 Ga0373937_0081796
757 Ga0373937_0101437
758 Ga0373937_0283611
759 Ga0373925_0005722
760 Ga0373925_0015488
761 Ga0373925_0023120
762 Ga0373925_0046293
763 Ga0436364_0442474
764 Ga0436364_0948665
765 Ga0436364_0991701
766 Ga0436365_1247504
767 Ga0439435_0019412
768 Ga0451576_0005817
769 Ga0495592_0005320
770 Ga0495592_0016732
771 Ga0495653_0093045
772 Ga0495580_0029542
773 Ga0495594_0035781
774 Ga0495608_0006964
775 Ga0495608_0041688
776 Ga0495618_0014859
777 Ga0495587_0019278
778 Ga0495587_0076167
779 Ga0495667_0001971
780 Ga0495667_0024238
781 Ga0495657_0040736
782 Ga0495599_0041035
783 Ga0495599_0087363
784 Ga0495658_0023549
785 Ga0495658_0043404
786 Ga0495669_0005852
787 Ga0495613_0003129
788 Ga0495613_0045145
789 Ga0495604_0070940
790 Ga0495674_0012899
791 Ga0495674_0026720
792 Ga0495680_0000614
793 Ga0495684_0000761
794 Ga0495684_0026377
795 Ga0495602_0120654
796 Ga0496100_0022615
797 Ga0496101_0038337
798 Ga0496104_0045917
799 Ga0496105_0039627
800 Ga0496106_0080818
801 Ga0496107_0057895
802 Ga0496108_0119801
803 Ga0496111_0082111
804 Ga0496112_0131459
805 Ga0496113_0048647
806 Ga0501046_0050077
807 Ga0501249_006744
808 nmdc:mga05p37_19379_c1
809 nmdc:mga05p37_33394_c1
810 nmdc:mga05p37_46127_c1
811 nmdc:mga05p37_6809_c1
812 nmdc:mga09592_10962_c1
813 nmdc:mga09592_16355_c1
814 nmdc:mga09592_40128_c1
815 nmdc:mga0qj67_4892_c1
816 nmdc:mga06r32_11960_c1
817 nmdc:mga06r32_14803_c1
818 nmdc:mga06r32_5558_c1
819 nmdc:mga08y16_119712_c1
820 nmdc:mga08y16_1391_c1
821 nmdc:mga08y16_205355_c1
822 nmdc:mga08y16_22229_c1
823 nmdc:mga08y16_37971_c1
824 nmdc:mga08y16_39568_c1
825 nmdc:mga08y16_4468_c1
826 nmdc:mga08y16_8160_c1
827 nmdc:mga08y16_9814_c1
828 nmdc:mga0n895_123890_c1
829 nmdc:mga0n895_244596_c1
830 nmdc:mga0n895_61466_c1
831 nmdc:mga0n895_64498_c1
832 nmdc:mga0a205_15529_c1
833 nmdc:mga0a205_18254_c1
834 nmdc:mga0a205_7071_c1
835 nmdc:mga0a205_74_c1
836 nmdc:mga0a205_9703_c1
837 Ga0495601_0001746
838 Ga0495619_0004374
839 Ga0500568_0004037
840 Ga0500645_008949

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01011

PQQ

PQQ enzyme repeat

136

162

0.96

PF01011

PQQ

PQQ enzyme repeat

534

572

0.95

PF13570

PQQ_3

PQQ-like domain

504

553

0.92

PF13360

PQQ_2

PQQ-like domain

499

596

0.84

PF01011

PQQ

PQQ enzyme repeat

184

221

0.8

PF13360

PQQ_2

PQQ-like domain

109

336

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
6zcw-assembly1.cif.gz_A crystal structure of lanthanide-dependent alcohol dehydrogenase pedh from pseudomonas putida kt2440 0.9234 11 551
6zcv-assembly1.cif.gz_A crystal structure of lanthanide-dependent alcohol dehydrogenase pedh from pseudomonas putida kt2440 0.9231 11 551
6oc6-assembly2.cif.gz_B lanthanide-dependent methanol dehydrogenase xoxf from methylobacterium extorquens, in complex with lanthanum and pyrroloquinoline quinone 0.9218 35 551
7cdl-assembly2.cif.gz_D holo-methanol dehydrogenase (mdh) with cys131-cys132 reduced from methylococcus capsulatus (bath) 0.9217 14 550
1h4j-assembly1.cif.gz_A methylobacterium extorquens methanol dehydrogenase d303e mutant 0.921 14 550
ID Description Score Start End Superfamily
2ymsB00 Mainly Beta;Beta Barrel;Thrombin, subunit H; 0.9093 115 197 2.40.10.480
1flgA00 Mainly Beta;8 Propeller;Methanol Dehydrogenase; Chain A;Quinoprotein alcohol dehydrogenase-like superfamily 0.9092 10 551 2.140.10.10
4tqoD00 Mainly Beta;8 Propeller;Methanol Dehydrogenase; Chain A;Quinoprotein alcohol dehydrogenase-like superfamily 0.9052 14 550 2.140.10.10
6damA00 Mainly Beta;8 Propeller;Methanol Dehydrogenase; Chain A;Quinoprotein alcohol dehydrogenase-like superfamily 0.9012 17 551 2.140.10.10
1flgA00 Mainly Beta;8 Propeller;Methanol Dehydrogenase; Chain A;Quinoprotein alcohol dehydrogenase-like superfamily 0.8931 10 551 2.140.10.10
ID Description Score Start End GO Terms
AF-A0A352VMG5-F1-model_v4 PQQ-dependent dehydrogenase, methanol/ethanol family 0.9836 34 551 GO:0005509
GO:0016020
GO:0016614
AF-A0A2V9DCH2-F1-model_v4 PQQ-dependent dehydrogenase, methanol/ethanol family 0.9806 2 474 GO:0005509
GO:0016020
GO:0016614
AF-A0A7C7NVH5-F1-model_v4 PQQ-dependent dehydrogenase, methanol/ethanol family 0.9798 143 551 GO:0016491
AF-A0A352VMG5-F1-model_v4 PQQ-dependent dehydrogenase, methanol/ethanol family 0.978 34 551 GO:0005509
GO:0016020
GO:0016614
AF-A0A537RDS0-F1-model_v4 PQQ-dependent dehydrogenase, methanol/ethanol family 0.9768 2 367 GO:0016491

Map