F440032

General Info

Members Datasets Scaffolds Average Seq Length
421 263 842 261

Family's Representative Sequence

Representative Sequence 3300031711|Ga0265314_10009765|Ga0265314_100097655
Length 237
Sequence MHRLAGLFLLAFAVLFGSALSPAFAEDRSLTVFAAASMKNALDDVDAAYTAKTGVKVSASYAASSALAKQIEQGAPADIFVSADTDWMDYAAAKKNIDVPSRVDLLGNSIVLIAPKDSKIDNVTIAQGFDLSKLAGDGKIATGDVKAVPVGKYAQAALEKLSAWQAAAVYSTDAKVEPGVKIVGTFPADSHPPIVYPVAATSTAKPDAAGYLAFLKTSAAKTIFEKYGFRFLITPTA

Samples

Sample ID Description Type Environment
1 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
35 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
36 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
40 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
41 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
54 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
55 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
58 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
60 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
89 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
90 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
91 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
95 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
96 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
97 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
98 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
99 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
100 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
101 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
102 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
103 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
104 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
105 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
106 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
107 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
108 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
109 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
110 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
111 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
112 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
113 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
114 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
115 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
116 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
117 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
118 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
119 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
120 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
121 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
122 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
123 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
124 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
125 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
126 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
127 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
128 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
129 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
130 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
131 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
132 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
133 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
134 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
135 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
136 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
137 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
138 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
139 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
140 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
141 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
142 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
143 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
144 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
145 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
146 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
147 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
148 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
149 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
150 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
151 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
152 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
153 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
154 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
155 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
156 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
157 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
158 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
159 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
160 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
161 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
162 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
163 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
164 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
165 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
166 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
167 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
168 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
169 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
170 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
171 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
172 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
173 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
174 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
175 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
176 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
177 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
178 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
179 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
180 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
181 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
182 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
183 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
184 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
185 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
186 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
187 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
188 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
189 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
190 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
191 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
206 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
207 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
208 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
209 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
210 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
211 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
212 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
213 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
214 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
215 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
216 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
219 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
220 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
221 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
222 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
223 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
224 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
225 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
226 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
227 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
228 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
229 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
230 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
231 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
232 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
233 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
234 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
235 2643221651 Afipia sp. Root123D2 Isolate Unclassified
236 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
237 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
238 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
239 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
240 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
241 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
242 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
243 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
244 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
245 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
246 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
247 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
248 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
249 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
250 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
251 2904699407
252 2906610324
253 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
254 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
255 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
256 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
257 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
258 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
259 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
260 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
261 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
262 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
263 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 91.65
Metatranscriptomes 0.48
Isolates 7.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.14
Nodule 5.94
Rhizoplane 3.8
Rhizosphere 77.43
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265314_10009765 3300031711 Bacteria 8064
2 JGI24740J21852_10023585 3300001979 Bacteria 2099
3 Ga0070658_10381709 3300005327 Bacteria 1209
4 Ga0070683_100006865 3300005329 Bacteria 9565
5 Ga0070683_100767440 3300005329 Bacteria 924
6 Ga0070680_100222893 3300005336 Bacteria 1592
7 Ga0068868_100081582 3300005338 Bacteria 2593
8 Ga0070661_100368241 3300005344 Bacteria 1131
9 Ga0070688_100091221 3300005365 Bacteria 1991
10 Ga0070709_10004185 3300005434 Bacteria 7776
11 Ga0070709_10028097 3300005434 Bacteria 3352
12 Ga0070709_10098667 3300005434 Bacteria 1942
13 Ga0070714_100049323 3300005435 Bacteria 3583
14 Ga0070713_100009121 3300005436 Bacteria 7077
15 Ga0070713_100024205 3300005436 Bacteria 4726
16 Ga0070713_100194389 3300005436 Bacteria 1830
17 Ga0070713_100544080 3300005436 Bacteria 1099
18 Ga0070711_100003658 3300005439 Bacteria 8987
19 Ga0070711_100008185 3300005439 Bacteria 6393
20 Ga0070662_100268123 3300005457 Bacteria 1378
21 Ga0070681_10033789 3300005458 Bacteria 5134
22 Ga0070681_10105115 3300005458 Bacteria 2765
23 Ga0070698_100076348 3300005471 Bacteria 3353
24 Ga0070679_100037741 3300005530 Bacteria 4801
25 Ga0070679_100056675 3300005530 Bacteria 3904
26 Ga0070684_100003773 3300005535 Bacteria 11439
27 Ga0070684_100004929 3300005535 Bacteria 10187
28 Ga0070684_100285009 3300005535 Bacteria 1514
29 Ga0068853_100275689 3300005539 Bacteria 1550
30 Ga0070665_100122549 3300005548 Bacteria 2602
31 Ga0070704_100349642 3300005549 Bacteria 1247
32 Ga0068855_100017134 3300005563 Bacteria 8716
33 Ga0068855_100232235 3300005563 Bacteria 2065
34 Ga0068857_100002581 3300005577 Bacteria 14846
35 Ga0068857_100092504 3300005577 Bacteria 2708
36 Ga0068854_100015964 3300005578 Bacteria 4993
37 Ga0068856_100000432 3300005614 Bacteria 45968
38 Ga0068856_100002247 3300005614 Bacteria 19946
39 Ga0068852_100008968 3300005616 Bacteria 7402
40 Ga0068859_100199263 3300005617 Bacteria 2087
41 Ga0068851_10224535 3300005834 Bacteria 1056
42 Ga0068858_100083831 3300005842 Bacteria 2965
43 Ga0068860_100001170 3300005843 Bacteria 28729
44 Ga0068862_100081953 3300005844 Bacteria 2799
45 Ga0068862_100148039 3300005844 Bacteria 2088
46 Ga0068862_100370319 3300005844 Bacteria 1333
47 Ga0081455_10117536 3300005937 Bacteria 2101
48 Ga0081540_1042776 3300005983 Bacteria 2332
49 Ga0070717_10004895 3300006028 Bacteria 9741
50 Ga0070717_10013280 3300006028 Bacteria 6304
51 Ga0075363_100024983 3300006048 Bacteria 3042
52 Ga0075363_100123989 3300006048 Bacteria 1445
53 Ga0070712_100174530 3300006175 Bacteria 1670
54 Ga0070712_100193145 3300006175 Bacteria 1594
55 Ga0075367_10006262 3300006178 Bacteria 5997
56 Ga0075367_10020697 3300006178 Bacteria 3667
57 Ga0097621_100522814 3300006237 Bacteria 1077
58 Ga0097620_100199245 3300006931 Bacteria 2087
59 Ga0099825_1033143 3300006941 Bacteria 2030
60 Ga0099824_1012003 3300006942 Bacteria 9592
61 Ga0099822_1010730 3300006943 Bacteria 11312
62 Ga0105240_10317483 3300009093 Bacteria 1777
63 Ga0105247_10012020 3300009101 Bacteria 5199
64 Ga0105241_10001010 3300009174 Bacteria 21381
65 Ga0105248_10016924 3300009177 Bacteria 8027
66 Ga0105248_11208203 3300009177 Bacteria 855
67 Ga0105237_10084669 3300009545 Bacteria 3161
68 Ga0105237_10089781 3300009545 Bacteria 3062
69 Ga0105237_10234085 3300009545 Bacteria 1838
70 Ga0105238_10084427 3300009551 Bacteria 3165
71 Ga0105238_10437862 3300009551 Bacteria 1303
72 Ga0105239_10034818 3300010375 Bacteria 5531
73 Ga0105239_10440979 3300010375 Bacteria 1476
74 Ga0157370_10075638 3300013104 Bacteria 3174
75 Ga0157369_10010902 3300013105 Bacteria 10352
76 Ga0157369_10014675 3300013105 Bacteria 8841
77 Ga0157369_10432231 3300013105 Bacteria 1364
78 Ga0157369_10750850 3300013105 Bacteria 1004
79 Ga0157374_10034703 3300013296 Bacteria 4610
80 Ga0157378_10007777 3300013297 Bacteria 9357
81 Ga0157372_10032225 3300013307 Bacteria 5744
82 Ga0182008_10134685 3300014497 Bacteria 1233
83 Ga0157377_10073424 3300014745 Bacteria 1982
84 Ga0157379_10306677 3300014968 Bacteria 1448
85 Ga0163161_10323990 3300017792 Bacteria 1219
86 Ga0206353_10313528 3300020082 Bacteria 2974
87 Ga0209233_1001368 3300025261 Bacteria 9686
88 Ga0207692_10009760 3300025898 Bacteria 4020
89 Ga0207692_10073104 3300025898 Bacteria 1813
90 Ga0207647_10236125 3300025904 Bacteria 1051
91 Ga0207699_10037650 3300025906 Bacteria 2767
92 Ga0207699_10045696 3300025906 Bacteria 2558
93 Ga0207699_10121825 3300025906 Bacteria 1688
94 Ga0207705_10162537 3300025909 Bacteria 1678
95 Ga0207654_10000073 3300025911 Bacteria 66148
96 Ga0207654_10023602 3300025911 Bacteria 3297
97 Ga0207707_10008913 3300025912 Bacteria 8712
98 Ga0207695_10000366 3300025913 Bacteria 103345
99 Ga0207695_10155452 3300025913 Bacteria 2222
100 Ga0207671_10042343 3300025914 Bacteria 3370
101 Ga0207671_10110453 3300025914 Bacteria 2091
102 Ga0207671_10160518 3300025914 Bacteria 1741
103 Ga0207693_10197950 3300025915 Bacteria 1580
104 Ga0207663_10000167 3300025916 Bacteria 29694
105 Ga0207660_10012853 3300025917 Bacteria 5482
106 Ga0207652_10006663 3300025921 Bacteria 9305
107 Ga0207652_10021066 3300025921 Bacteria 5378
108 Ga0207694_10000139 3300025924 Bacteria 74561
109 Ga0207694_10000268 3300025924 Bacteria 49480
110 Ga0207694_10390591 3300025924 Bacteria 1156
111 Ga0207694_10436935 3300025924 Bacteria 1091
112 Ga0207700_10012946 3300025928 Bacteria 5403
113 Ga0207700_10027679 3300025928 Bacteria 3974
114 Ga0207700_10063108 3300025928 Bacteria 2817
115 Ga0207700_10205752 3300025928 Bacteria 1661
116 Ga0207700_10333549 3300025928 Bacteria 1317
117 Ga0207664_10060320 3300025929 Bacteria 3023
118 Ga0207664_10097099 3300025929 Bacteria 2427
119 Ga0207686_10084320 3300025934 Bacteria 2082
120 Ga0207665_10002618 3300025939 Bacteria 12106
121 Ga0207665_10610572 3300025939 Bacteria 852
122 Ga0207711_10300504 3300025941 Bacteria 1480
123 Ga0207689_10123687 3300025942 Bacteria 2128
124 Ga0207689_10484560 3300025942 Bacteria 1036
125 Ga0207661_10008189 3300025944 Bacteria 7461
126 Ga0207661_10107183 3300025944 Bacteria 2356
127 Ga0207667_10016838 3300025949 Bacteria 8246
128 Ga0207667_10317359 3300025949 Bacteria 1591
129 Ga0207667_10407857 3300025949 Bacteria 1383
130 Ga0207640_10016031 3300025981 Bacteria 4349
131 Ga0207640_10049491 3300025981 Bacteria 2721
132 Ga0207640_10315981 3300025981 Bacteria 1241
133 Ga0207677_10113860 3300026023 Bacteria 2020
134 Ga0207639_10000980 3300026041 Bacteria 19416
135 Ga0207708_10264532 3300026075 Bacteria 1389
136 Ga0207702_10000122 3300026078 Bacteria 91685
137 Ga0207702_10015919 3300026078 Bacteria 6228
138 Ga0207702_10269392 3300026078 Bacteria 1606
139 Ga0207674_10002925 3300026116 Bacteria 21212
140 Ga0207674_10062729 3300026116 Bacteria 3753
141 Ga0207674_10637665 3300026116 Bacteria 1029
142 Ga0207698_10310067 3300026142 Bacteria 1473
143 Ga0209589_1000276 3300027357 Bacteria 65299
144 Ga0209489_100714 3300027361 Bacteria 65299
145 Ga0209700_100732 3300027363 Bacteria 65299
146 Ga0268266_10300014 3300028379 Bacteria 1498
147 Ga0268266_10532825 3300028379 Bacteria 1124
148 Ga0268265_10010826 3300028380 Bacteria 6160
149 Ga0268264_10000187 3300028381 Bacteria 129270
150 Ga0268264_10359927 3300028381 Bacteria 1387
151 Ga0265330_10003331 3300031235 Bacteria 8438
152 Ga0265330_10043318 3300031235 Bacteria 1991
153 Ga0265332_10075728 3300031238 Bacteria 1430
154 Ga0265339_10000326 3300031249 Bacteria 38178
155 Ga0265339_10015307 3300031249 Bacteria 4601
156 Ga0265339_10027906 3300031249 Bacteria 3214
157 Ga0265331_10037066 3300031250 Bacteria 2389
158 Ga0265316_10308063 3300031344 Bacteria 1152
159 Ga0265316_10311551 3300031344 Bacteria 1145
160 Ga0307509_10136274 3300031507 Bacteria 2399
161 Ga0307509_10448562 3300031507 Bacteria 984
162 Ga0265313_10028246 3300031595 Bacteria 2920
163 Ga0307508_10000613 3300031616 Bacteria 42773
164 Ga0265314_10029320 3300031711 Bacteria 4092
165 Ga0265342_10061249 3300031712 Bacteria 2218
166 Ga0265342_10074617 3300031712 Bacteria 1970
167 Ga0307516_10008578 3300031730 Bacteria 11540
168 Ga0307516_10044270 3300031730 Bacteria 4405
169 Ga0307516_10047270 3300031730 Bacteria 4242
170 Ga0307516_10098548 3300031730 Bacteria 2741
171 Ga0307507_10011688 3300033179 Bacteria 11014
172 Ga0315911_1000024 3300033442 Bacteria 97712
173 Ga0316214_1013954 3300033545 Bacteria 1103
174 Ga0373926_0048568 3300035083 Bacteria 1527
175 Ga0373944_0074949 3300035089 Bacteria 1109
176 Ga0373923_0024156 3300035111 Bacteria 2397
177 Ga0373932_0027238 3300035112 Bacteria 1562
178 Ga0373936_0007742 3300035113 Bacteria 4034
179 Ga0373945_0025074 3300035116 Bacteria 2070
180 Ga0373953_0002961 3300035117 Bacteria 5193
181 Ga0373954_0007552 3300035118 Bacteria 4759
182 Ga0373956_0065281 3300035119 Bacteria 1653
183 Ga0373956_0143346 3300035119 Bacteria 1122
184 Ga0373943_0031485 3300035170 Bacteria 2517
185 Ga0373946_0038679 3300035171 Bacteria 1944
186 Ga0373955_0035150 3300035172 Bacteria 2652
187 Ga0373924_0011781 3300035410 Bacteria 3254
188 Ga0373935_0010492 3300035692 Bacteria 5558
189 Ga0373933_0002851 3300035724 Bacteria 9651
190 Ga0373933_0002952 3300035724 Bacteria 9485
191 Ga0373933_0117002 3300035724 Bacteria 1666
192 Ga0373933_0239955 3300035724 Bacteria 1166
193 Ga0373947_0011720 3300035725 Bacteria 5024
194 Ga0373937_0022705 3300036401 Bacteria 5644
195 Ga0373937_0081132 3300036401 Bacteria 3000
196 Ga0372808_016616 3300036459 Bacteria 1055
197 Ga0373925_0198069 3300037068 Bacteria 1596
198 Ga0395900_0033605 3300037418 Bacteria 5278
199 Ga0395900_0037184 3300037418 Bacteria 5021
200 Ga0395900_0107498 3300037418 Bacteria 2866
201 Ga0395900_0123405 3300037418 Bacteria 2657
202 Ga0395898_0014080 3300037466 Bacteria 8219
203 Ga0395898_0087983 3300037466 Bacteria 2992
204 Ga0395905_0226477 3300037471 Bacteria 1749
205 Ga0436364_0014452 3300037853 Bacteria 843
206 Ga0395901_0077053 3300038443 Bacteria 3480
207 Ga0395901_0187968 3300038443 Bacteria 2166
208 Ga0436365_0387129 3300039437 Bacteria 4899
209 Ga0436365_0481208 3300039437 Bacteria 824
210 Ga0436363_0175579 3300039450 Bacteria 4068
211 Ga0436362_0323763 3300039453 Bacteria 961
212 Ga0451807_2058942 3300041486 Bacteria 1143
213 Ga0466972_0000048 3300044658 Bacteria 119165
214 Ga0466966_0034654 3300044684 Bacteria 3263
215 Ga0466966_0055454 3300044684 Bacteria 2508
216 Ga0466966_0070070 3300044684 Bacteria 2199
217 Ga0466961_0000018 3300044693 Bacteria 109837
218 Ga0466963_0198081 3300044694 Bacteria 1404
219 Ga0466963_0320146 3300044694 Bacteria 1091
220 Ga0466959_0001279 3300045049 Bacteria 15211
221 Ga0466959_0060281 3300045049 Bacteria 2761
222 Ga0466959_0079091 3300045049 Bacteria 2371
223 Ga0466958_0148341 3300045836 Bacteria 1479
224 Ga0495592_0018708 3300046454 Bacteria 5273
225 Ga0495592_0062519 3300046454 Bacteria 2733
226 Ga0495603_0095978 3300046455 Bacteria 1732
227 Ga0495651_0098771 3300046462 Bacteria 2178
228 Ga0495651_0104123 3300046462 Bacteria 2107
229 Ga0495653_0007589 3300046463 Bacteria 8868
230 Ga0495582_0036688 3300046473 Bacteria 2696
231 Ga0495582_0065332 3300046473 Bacteria 2010
232 Ga0495639_0069197 3300046475 Bacteria 1628
233 Ga0495608_0027815 3300046511 Bacteria 3845
234 Ga0495618_0028848 3300046514 Bacteria 3459
235 Ga0495618_0161298 3300046514 Bacteria 1429
236 Ga0495628_0048180 3300046516 Bacteria 3378
237 Ga0495628_0489523 3300046516 Bacteria 889
238 Ga0495652_0053735 3300046529 Bacteria 3433
239 Ga0495665_0027908 3300046531 Bacteria 3029
240 Ga0495640_0005819 3300046533 Bacteria 9789
241 Ga0495587_0040149 3300046536 Bacteria 2798
242 Ga0495598_0007953 3300046537 Bacteria 2453
243 Ga0495622_0033484 3300046557 Bacteria 2398
244 Ga0495667_0000340 3300046559 Bacteria 29603
245 Ga0495667_0239735 3300046559 Bacteria 1155
246 Ga0495668_0139642 3300046616 Bacteria 1326
247 Ga0495634_0004607 3300046642 Bacteria 10766
248 Ga0495634_0062033 3300046642 Bacteria 2483
249 Ga0495635_0028050 3300046663 Bacteria 3913
250 Ga0495635_0148737 3300046663 Bacteria 1594
251 Ga0495657_0023297 3300046675 Bacteria 4425
252 Ga0495599_0001834 3300046678 Bacteria 12326
253 Ga0495623_0011771 3300046679 Bacteria 5666
254 Ga0495647_0100301 3300046681 Bacteria 1198
255 Ga0495613_0018770 3300046689 Bacteria 5154
256 Ga0495613_0118273 3300046689 Bacteria 1905
257 Ga0495613_0133664 3300046689 Bacteria 1776
258 Ga0495624_0021638 3300046690 Bacteria 4262
259 Ga0495581_0063843 3300047315 Bacteria 2127
260 Ga0495581_0089615 3300047315 Bacteria 1784
261 Ga0495604_0325426 3300047317 Bacteria 1026
262 Ga0495674_0007106 3300047319 Bacteria 10710
263 Ga0495674_0131756 3300047319 Bacteria 2106
264 Ga0495672_0014252 3300047320 Bacteria 5453
265 Ga0495672_0057225 3300047320 Bacteria 2265
266 Ga0495680_0016718 3300047322 Bacteria 6291
267 Ga0495675_0010560 3300047444 Bacteria 5771
268 Ga0495684_0008414 3300047471 Bacteria 7992
269 Ga0495684_0028815 3300047471 Bacteria 4263
270 Ga0495593_0010334 3300047673 Bacteria 5395
271 Ga0495593_0014551 3300047673 Bacteria 4471
272 Ga0496100_0482073 3300048903 Bacteria 954
273 Ga0496102_0204742 3300048905 Bacteria 1860
274 Ga0496103_0023060 3300048906 Bacteria 3752
275 Ga0496105_0138960 3300048908 Bacteria 2000
276 Ga0496106_0001984 3300048909 Bacteria 15387
277 Ga0496106_0018724 3300048909 Bacteria 5128
278 Ga0496107_0094737 3300048910 Bacteria 2184
279 Ga0496107_0122170 3300048910 Bacteria 1919
280 Ga0496108_0010010 3300048911 Bacteria 7686
281 Ga0496108_0499370 3300048911 Bacteria 1063
282 Ga0496112_0000051 3300048915 Bacteria 82351
283 Ga0496112_0029029 3300048915 Bacteria 5346
284 Ga0496114_0015931 3300048917 Bacteria 6049
285 Ga0496115_0299303 3300048918 Bacteria 1318
286 Ga0496115_0511492 3300048918 Bacteria 964
287 Ga0496117_0011756 3300048920 Bacteria 7803
288 Ga0496118_0005018 3300048921 Bacteria 15284
289 Ga0496119_0046221 3300048922 Bacteria 2721
290 Ga0496119_0088831 3300048922 Bacteria 1761
291 Ga0496121_0000451 3300048924 Bacteria 80840
292 Ga0496124_0005228 3300048927 Bacteria 14722
293 Ga0496125_0035784 3300048928 Bacteria 4348
294 Ga0496125_0314926 3300048928 Bacteria 952
295 Ga0496126_0005431 3300048929 Bacteria 14534
296 Ga0496126_0016261 3300048929 Bacteria 7447
297 Ga0496126_0085120 3300048929 Bacteria 2788
298 Ga0496126_0101808 3300048929 Bacteria 2512
299 Ga0496126_0156895 3300048929 Bacteria 1947
300 Ga0496126_0169919 3300048929 Bacteria 1858
301 Ga0501031_0006190 3300049568 Bacteria 7811
302 Ga0501031_0008115 3300049568 Bacteria 6839
303 Ga0501031_0182041 3300049568 Bacteria 1372
304 Ga0501031_0230075 3300049568 Bacteria 1206
305 Ga0501032_0000136 3300049569 Bacteria 59896
306 Ga0501032_0014893 3300049569 Bacteria 5503
307 Ga0501032_0025056 3300049569 Bacteria 4114
308 Ga0501032_0049944 3300049569 Bacteria 2821
309 Ga0501033_0000202 3300049570 Bacteria 57109
310 Ga0501033_0001519 3300049570 Bacteria 20512
311 Ga0501033_0008271 3300049570 Bacteria 8057
312 Ga0501033_0126818 3300049570 Bacteria 1850
313 Ga0501033_0301265 3300049570 Bacteria 1128
314 Ga0501034_0000113 3300049571 Bacteria 149824
315 Ga0501034_0021936 3300049571 Bacteria 6506
316 Ga0501034_0152704 3300049571 Bacteria 2284
317 Ga0501034_0255560 3300049571 Bacteria 1696
318 Ga0501036_0000059 3300049572 Bacteria 72347
319 Ga0501036_0015558 3300049572 Bacteria 6356
320 Ga0501036_0623896 3300049572 Bacteria 893
321 Ga0501037_0000214 3300049573 Bacteria 51638
322 Ga0501037_0000618 3300049573 Bacteria 27557
323 Ga0501037_0007119 3300049573 Bacteria 8174
324 Ga0501037_0080486 3300049573 Bacteria 2363
325 Ga0501038_0000655 3300049574 Bacteria 30771
326 Ga0501038_0045998 3300049574 Bacteria 3785
327 Ga0501038_0047359 3300049574 Bacteria 3724
328 Ga0501038_0108329 3300049574 Bacteria 2304
329 Ga0501039_0001981 3300049575 Bacteria 15182
330 Ga0501039_0115805 3300049575 Bacteria 2098
331 Ga0501039_0262276 3300049575 Bacteria 1358
332 Ga0501041_0056977 3300049577 Bacteria 2389
333 Ga0501042_0013197 3300049578 Bacteria 5625
334 Ga0501042_0024942 3300049578 Bacteria 4196
335 Ga0501043_0001020 3300049579 Bacteria 24593
336 Ga0501043_0005353 3300049579 Bacteria 10368
337 Ga0501043_0025973 3300049579 Bacteria 4595
338 Ga0501043_0030133 3300049579 Bacteria 4262
339 Ga0501046_0000174 3300049580 Bacteria 65566
340 Ga0501046_0001866 3300049580 Bacteria 20049
341 Ga0501046_0017980 3300049580 Bacteria 5891
342 Ga0501046_0158188 3300049580 Bacteria 1706
343 Ga0501046_0435971 3300049580 Bacteria 943
344 Ga0501047_0000044 3300049581 Bacteria 174789
345 Ga0501047_0004772 3300049581 Bacteria 12749
346 Ga0501047_0100680 3300049581 Bacteria 2769
347 Ga0501047_0203108 3300049581 Bacteria 1842
348 Ga0501048_0000837 3300049582 Bacteria 22705
349 Ga0501067_0016341 3300049583 Bacteria 4100
350 Ga0501067_0400507 3300049583 Bacteria 765
351 Ga0501068_0000089 3300049584 Bacteria 38379
352 Ga0501068_0005510 3300049584 Bacteria 6934
353 Ga0501070_0024419 3300049586 Bacteria 5071
354 Ga0501072_0003722 3300049588 Bacteria 11502
355 Ga0501073_0000069 3300049589 Bacteria 63198
356 Ga0501074_0000346 3300049590 Bacteria 27099
357 Ga0501076_0068583 3300049592 Bacteria 2833
358 Ga0501079_0014661 3300049741 Bacteria 5976
359 Ga0501079_0066394 3300049741 Bacteria 2784
360 Ga0501080_0000613 3300049742 Bacteria 28256
361 Ga0501080_0165461 3300049742 Bacteria 2041
362 Ga0501081_0582646 3300049743 Bacteria 837
363 Ga0501083_0000838 3300049744 Bacteria 20228
364 Ga0501035_0000393 3300049822 Bacteria 49959
365 Ga0501035_0005222 3300049822 Bacteria 12294
366 Ga0501035_0019524 3300049822 Bacteria 6231
367 Ga0501035_0056018 3300049822 Bacteria 3519
368 Ga0501035_0075983 3300049822 Bacteria 2971
369 Ga0501044_0000108 3300049823 Bacteria 100968
370 Ga0501044_0009278 3300049823 Bacteria 10740
371 Ga0501044_0027875 3300049823 Bacteria 5962
372 Ga0501044_0036324 3300049823 Bacteria 5155
373 Ga0501044_0280661 3300049823 Bacteria 1599
374 Ga0501045_0140557 3300049824 Bacteria 1795
375 Ga0501045_0242924 3300049824 Bacteria 1340
376 nmdc:mga06z11_15039_c1 3300050494 Bacteria 3445
377 nmdc:mga0a205_369808_c1 3300050515 Bacteria 1299
378 Ga0495601_0033467 3300053077 Bacteria 3203
379 Ga0495601_0265119 3300053077 Bacteria 1121
380 Ga0495595_0011500 3300053084 Bacteria 3701
381 Ga0495619_0003325 3300053085 Bacteria 10391
382 Ga0500568_0016236 3300053139 Bacteria 3316
383 Ga0500616_0000038 3300053153 Bacteria 386801
384 Ga0500596_003758 3300053735 Bacteria 2848
385 Ga0501084_0024478 3300054114 Bacteria 5036
386 Ga0501082_0073402 3300060353 Bacteria 2947
387 2513658901 2513237096 Bacteria 8722461
388 2513703157 2513237102 Bacteria 7703324
389 2513858906 2513237137 Bacteria 9558895
390 2513889671 2513237141 Bacteria 8496279
391 2513921165 2513237145 Bacteria 8979722
392 2517889520 2517572143 Bacteria 9484767
393 2644290636 2643221651 Bacteria 4798932
394 2723849202 2721755755 Bacteria 8322773
395 2793071091 2791355197 Bacteria 8420563
396 2824622818 2824617872 Bacteria 8814715
397 2824631906 2824626560 Bacteria 8813858
398 2824639146 2824635225 Bacteria 8785348
399 2824650722 2824644064 Bacteria 8743947
400 2824676089 2824671348 Bacteria 8369588
401 2824692517 2824687955 Bacteria 8360029
402 2824719690 2824714736 Bacteria 8717648
403 2824729284 2824723954 Bacteria 8758240
404 2874608574 2874604998 Bacteria 7834745
405 2881364461 2881364244 Bacteria 7710352
406 2885380048 2885374607 Bacteria 8927485
407 2889036096 2889033259 Bacteria 9099371
408 2903753975 2903748898 Bacteria 9972761
409 2904709340
410 2906613097
411 2906636517 2906635258 Bacteria 8601019
412 2906665757 2906660503 Bacteria 8595048
413 2908748021 2908739725 Bacteria 8628932
414 2935635107 2935630451 Bacteria 8169952
415 2941511614 2941507105 Bacteria 8166816
416 2941519403 2941515067 Bacteria 8166720
417 2941527473 2941523033 Bacteria 8169134
418 3005483243 3005474847 Bacteria 9259049
419 8006935625 8006933436 Bacteria 10410654
420 8006975552 8006973647 Bacteria 10679141
421 8006998408 8006994254 Bacteria 8309700
422 Ga0265314_10009765
423 JGI24740J21852_10023585
424 Ga0070658_10381709
425 Ga0070683_100006865
426 Ga0070683_100767440
427 Ga0070680_100222893
428 Ga0068868_100081582
429 Ga0070661_100368241
430 Ga0070688_100091221
431 Ga0070709_10004185
432 Ga0070709_10028097
433 Ga0070709_10098667
434 Ga0070714_100049323
435 Ga0070713_100009121
436 Ga0070713_100024205
437 Ga0070713_100194389
438 Ga0070713_100544080
439 Ga0070711_100003658
440 Ga0070711_100008185
441 Ga0070662_100268123
442 Ga0070681_10033789
443 Ga0070681_10105115
444 Ga0070698_100076348
445 Ga0070679_100037741
446 Ga0070679_100056675
447 Ga0070684_100003773
448 Ga0070684_100004929
449 Ga0070684_100285009
450 Ga0068853_100275689
451 Ga0070665_100122549
452 Ga0070704_100349642
453 Ga0068855_100017134
454 Ga0068855_100232235
455 Ga0068857_100002581
456 Ga0068857_100092504
457 Ga0068854_100015964
458 Ga0068856_100000432
459 Ga0068856_100002247
460 Ga0068852_100008968
461 Ga0068859_100199263
462 Ga0068851_10224535
463 Ga0068858_100083831
464 Ga0068860_100001170
465 Ga0068862_100081953
466 Ga0068862_100148039
467 Ga0068862_100370319
468 Ga0081455_10117536
469 Ga0081540_1042776
470 Ga0070717_10004895
471 Ga0070717_10013280
472 Ga0075363_100024983
473 Ga0075363_100123989
474 Ga0070712_100174530
475 Ga0070712_100193145
476 Ga0075367_10006262
477 Ga0075367_10020697
478 Ga0097621_100522814
479 Ga0097620_100199245
480 Ga0099825_1033143
481 Ga0099824_1012003
482 Ga0099822_1010730
483 Ga0105240_10317483
484 Ga0105247_10012020
485 Ga0105241_10001010
486 Ga0105248_10016924
487 Ga0105248_11208203
488 Ga0105237_10084669
489 Ga0105237_10089781
490 Ga0105237_10234085
491 Ga0105238_10084427
492 Ga0105238_10437862
493 Ga0105239_10034818
494 Ga0105239_10440979
495 Ga0157370_10075638
496 Ga0157369_10010902
497 Ga0157369_10014675
498 Ga0157369_10432231
499 Ga0157369_10750850
500 Ga0157374_10034703
501 Ga0157378_10007777
502 Ga0157372_10032225
503 Ga0182008_10134685
504 Ga0157377_10073424
505 Ga0157379_10306677
506 Ga0163161_10323990
507 Ga0206353_10313528
508 Ga0209233_1001368
509 Ga0207692_10009760
510 Ga0207692_10073104
511 Ga0207647_10236125
512 Ga0207699_10037650
513 Ga0207699_10045696
514 Ga0207699_10121825
515 Ga0207705_10162537
516 Ga0207654_10000073
517 Ga0207654_10023602
518 Ga0207707_10008913
519 Ga0207695_10000366
520 Ga0207695_10155452
521 Ga0207671_10042343
522 Ga0207671_10110453
523 Ga0207671_10160518
524 Ga0207693_10197950
525 Ga0207663_10000167
526 Ga0207660_10012853
527 Ga0207652_10006663
528 Ga0207652_10021066
529 Ga0207694_10000139
530 Ga0207694_10000268
531 Ga0207694_10390591
532 Ga0207694_10436935
533 Ga0207700_10012946
534 Ga0207700_10027679
535 Ga0207700_10063108
536 Ga0207700_10205752
537 Ga0207700_10333549
538 Ga0207664_10060320
539 Ga0207664_10097099
540 Ga0207686_10084320
541 Ga0207665_10002618
542 Ga0207665_10610572
543 Ga0207711_10300504
544 Ga0207689_10123687
545 Ga0207689_10484560
546 Ga0207661_10008189
547 Ga0207661_10107183
548 Ga0207667_10016838
549 Ga0207667_10317359
550 Ga0207667_10407857
551 Ga0207640_10016031
552 Ga0207640_10049491
553 Ga0207640_10315981
554 Ga0207677_10113860
555 Ga0207639_10000980
556 Ga0207708_10264532
557 Ga0207702_10000122
558 Ga0207702_10015919
559 Ga0207702_10269392
560 Ga0207674_10002925
561 Ga0207674_10062729
562 Ga0207674_10637665
563 Ga0207698_10310067
564 Ga0209589_1000276
565 Ga0209489_100714
566 Ga0209700_100732
567 Ga0268266_10300014
568 Ga0268266_10532825
569 Ga0268265_10010826
570 Ga0268264_10000187
571 Ga0268264_10359927
572 Ga0265330_10003331
573 Ga0265330_10043318
574 Ga0265332_10075728
575 Ga0265339_10000326
576 Ga0265339_10015307
577 Ga0265339_10027906
578 Ga0265331_10037066
579 Ga0265316_10308063
580 Ga0265316_10311551
581 Ga0307509_10136274
582 Ga0307509_10448562
583 Ga0265313_10028246
584 Ga0307508_10000613
585 Ga0265314_10029320
586 Ga0265342_10061249
587 Ga0265342_10074617
588 Ga0307516_10008578
589 Ga0307516_10044270
590 Ga0307516_10047270
591 Ga0307516_10098548
592 Ga0307507_10011688
593 Ga0315911_1000024
594 Ga0316214_1013954
595 Ga0373926_0048568
596 Ga0373944_0074949
597 Ga0373923_0024156
598 Ga0373932_0027238
599 Ga0373936_0007742
600 Ga0373945_0025074
601 Ga0373953_0002961
602 Ga0373954_0007552
603 Ga0373956_0065281
604 Ga0373956_0143346
605 Ga0373943_0031485
606 Ga0373946_0038679
607 Ga0373955_0035150
608 Ga0373924_0011781
609 Ga0373935_0010492
610 Ga0373933_0002851
611 Ga0373933_0002952
612 Ga0373933_0117002
613 Ga0373933_0239955
614 Ga0373947_0011720
615 Ga0373937_0022705
616 Ga0373937_0081132
617 Ga0372808_016616
618 Ga0373925_0198069
619 Ga0395900_0033605
620 Ga0395900_0037184
621 Ga0395900_0107498
622 Ga0395900_0123405
623 Ga0395898_0014080
624 Ga0395898_0087983
625 Ga0395905_0226477
626 Ga0436364_0014452
627 Ga0395901_0077053
628 Ga0395901_0187968
629 Ga0436365_0387129
630 Ga0436365_0481208
631 Ga0436363_0175579
632 Ga0436362_0323763
633 Ga0451807_2058942
634 Ga0466972_0000048
635 Ga0466966_0034654
636 Ga0466966_0055454
637 Ga0466966_0070070
638 Ga0466961_0000018
639 Ga0466963_0198081
640 Ga0466963_0320146
641 Ga0466959_0001279
642 Ga0466959_0060281
643 Ga0466959_0079091
644 Ga0466958_0148341
645 Ga0495592_0018708
646 Ga0495592_0062519
647 Ga0495603_0095978
648 Ga0495651_0098771
649 Ga0495651_0104123
650 Ga0495653_0007589
651 Ga0495582_0036688
652 Ga0495582_0065332
653 Ga0495639_0069197
654 Ga0495608_0027815
655 Ga0495618_0028848
656 Ga0495618_0161298
657 Ga0495628_0048180
658 Ga0495628_0489523
659 Ga0495652_0053735
660 Ga0495665_0027908
661 Ga0495640_0005819
662 Ga0495587_0040149
663 Ga0495598_0007953
664 Ga0495622_0033484
665 Ga0495667_0000340
666 Ga0495667_0239735
667 Ga0495668_0139642
668 Ga0495634_0004607
669 Ga0495634_0062033
670 Ga0495635_0028050
671 Ga0495635_0148737
672 Ga0495657_0023297
673 Ga0495599_0001834
674 Ga0495623_0011771
675 Ga0495647_0100301
676 Ga0495613_0018770
677 Ga0495613_0118273
678 Ga0495613_0133664
679 Ga0495624_0021638
680 Ga0495581_0063843
681 Ga0495581_0089615
682 Ga0495604_0325426
683 Ga0495674_0007106
684 Ga0495674_0131756
685 Ga0495672_0014252
686 Ga0495672_0057225
687 Ga0495680_0016718
688 Ga0495675_0010560
689 Ga0495684_0008414
690 Ga0495684_0028815
691 Ga0495593_0010334
692 Ga0495593_0014551
693 Ga0496100_0482073
694 Ga0496102_0204742
695 Ga0496103_0023060
696 Ga0496105_0138960
697 Ga0496106_0001984
698 Ga0496106_0018724
699 Ga0496107_0094737
700 Ga0496107_0122170
701 Ga0496108_0010010
702 Ga0496108_0499370
703 Ga0496112_0000051
704 Ga0496112_0029029
705 Ga0496114_0015931
706 Ga0496115_0299303
707 Ga0496115_0511492
708 Ga0496117_0011756
709 Ga0496118_0005018
710 Ga0496119_0046221
711 Ga0496119_0088831
712 Ga0496121_0000451
713 Ga0496124_0005228
714 Ga0496125_0035784
715 Ga0496125_0314926
716 Ga0496126_0005431
717 Ga0496126_0016261
718 Ga0496126_0085120
719 Ga0496126_0101808
720 Ga0496126_0156895
721 Ga0496126_0169919
722 Ga0501031_0006190
723 Ga0501031_0008115
724 Ga0501031_0182041
725 Ga0501031_0230075
726 Ga0501032_0000136
727 Ga0501032_0014893
728 Ga0501032_0025056
729 Ga0501032_0049944
730 Ga0501033_0000202
731 Ga0501033_0001519
732 Ga0501033_0008271
733 Ga0501033_0126818
734 Ga0501033_0301265
735 Ga0501034_0000113
736 Ga0501034_0021936
737 Ga0501034_0152704
738 Ga0501034_0255560
739 Ga0501036_0000059
740 Ga0501036_0015558
741 Ga0501036_0623896
742 Ga0501037_0000214
743 Ga0501037_0000618
744 Ga0501037_0007119
745 Ga0501037_0080486
746 Ga0501038_0000655
747 Ga0501038_0045998
748 Ga0501038_0047359
749 Ga0501038_0108329
750 Ga0501039_0001981
751 Ga0501039_0115805
752 Ga0501039_0262276
753 Ga0501041_0056977
754 Ga0501042_0013197
755 Ga0501042_0024942
756 Ga0501043_0001020
757 Ga0501043_0005353
758 Ga0501043_0025973
759 Ga0501043_0030133
760 Ga0501046_0000174
761 Ga0501046_0001866
762 Ga0501046_0017980
763 Ga0501046_0158188
764 Ga0501046_0435971
765 Ga0501047_0000044
766 Ga0501047_0004772
767 Ga0501047_0100680
768 Ga0501047_0203108
769 Ga0501048_0000837
770 Ga0501067_0016341
771 Ga0501067_0400507
772 Ga0501068_0000089
773 Ga0501068_0005510
774 Ga0501070_0024419
775 Ga0501072_0003722
776 Ga0501073_0000069
777 Ga0501074_0000346
778 Ga0501076_0068583
779 Ga0501079_0014661
780 Ga0501079_0066394
781 Ga0501080_0000613
782 Ga0501080_0165461
783 Ga0501081_0582646
784 Ga0501083_0000838
785 Ga0501035_0000393
786 Ga0501035_0005222
787 Ga0501035_0019524
788 Ga0501035_0056018
789 Ga0501035_0075983
790 Ga0501044_0000108
791 Ga0501044_0009278
792 Ga0501044_0027875
793 Ga0501044_0036324
794 Ga0501044_0280661
795 Ga0501045_0140557
796 Ga0501045_0242924
797 nmdc:mga06z11_15039_c1
798 nmdc:mga0a205_369808_c1
799 Ga0495601_0033467
800 Ga0495601_0265119
801 Ga0495595_0011500
802 Ga0495619_0003325
803 Ga0500568_0016236
804 Ga0500616_0000038
805 Ga0500596_003758
806 Ga0501084_0024478
807 Ga0501082_0073402
808 2513658901
809 2513703157
810 2513858906
811 2513889671
812 2513921165
813 2517889520
814 2644290636
815 2723849202
816 2793071091
817 2824622818
818 2824631906
819 2824639146
820 2824650722
821 2824676089
822 2824692517
823 2824719690
824 2824729284
825 2874608574
826 2881364461
827 2885380048
828 2889036096
829 2903753975
830 2904709340
831 2906613097
832 2906636517
833 2906665757
834 2908748021
835 2935635107
836 2941511614
837 2941519403
838 2941527473
839 3005483243
840 8006935625
841 8006975552
842 8006998408

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13531

SBP_bac_11

Bacterial extracellular solute-binding protein

162

230

0.95

PF13531

SBP_bac_11

Bacterial extracellular solute-binding protein

30

168

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
8k8k-assembly1.cif.gz_A structure of klebsiella pneumonia moda 0.9737 29 255
8k8k-assembly1.cif.gz_A structure of klebsiella pneumonia moda 0.9572 29 255
6nio-assembly1.cif.gz_A crystal structure of the molybdate transporter periplasmic protein moda from yersinia pestis 0.9461 28 255
6nio-assembly1.cif.gz_A crystal structure of the molybdate transporter periplasmic protein moda from yersinia pestis 0.9305 28 255
4kd5-assembly1.cif.gz_C substrate binding domain of putative molybdenum abc transporter from clostridium difficile 0.928 28 257
ID Description Score Start End Superfamily
af_P9WGU3_42_110_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9902 31 92 3.40.190.10
af_P37329_30_103_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9874 31 102 3.40.190.10
6nioA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9705 108 216 3.40.190.10
2h5yB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9682 28 255 3.40.190.10
af_Q2FVX4_42_108_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9563 29 93 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A376YDG5-F1-model_v4 Molybdate transporter periplasmic protein 0.9649 68 255 GO:0015689
GO:0030288
GO:0030973
GO:0046872
AF-I5BYI5-F1-model_v4 Molybdenum ABC transporter periplasmic molybdenum-binding protein 0.9616 37 258 GO:0015689
GO:0030288
GO:0030973
GO:0046872
AF-I5BYI5-F1-model_v4 Molybdenum ABC transporter periplasmic molybdenum-binding protein 0.9572 37 258 GO:0015689
GO:0030288
GO:0030973
GO:0046872
AF-A0A5M4AET4-F1-model_v4 Molybdate ABC transporter substrate-binding protein 0.951 42 256 GO:0015689
GO:0030288
GO:0030973
GO:0046872
AF-A0A2U3KPH0-F1-model_v4 ABC transporter substrate-binding lipoprotein YvgL (Modular protein) 0.9223 22 258 GO:0015689
GO:0030973

Map