F439914

General Info

Members Datasets Scaffolds Average Seq Length
421 225 842 164

Family's Representative Sequence

Representative Sequence 3300005337|Ga0070682_100495831|Ga0070682_1004958311
Length 183
Sequence VRGANGVPVLRALPIKGEPLLISREMAKAFNTQIGHEFGASLQYVSIAAHFQQRHLTLLAKLFFAQAEEERQHALKFVRYILDAKGDLQIPAVAAPTTSFLSAEEAVAAALKWEQEVTAQITGLMEQAVKENDYLAQSFLQWFVDEQLEEVVKMDRLLSVIRQSGEKNLLMVEAYLVHIEKAS

Samples

Sample ID Description Type Environment
1 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
65 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
66 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
148 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
152 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
153 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
154 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
155 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
156 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
157 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
158 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
159 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
160 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
161 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
162 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
163 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
164 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
165 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
166 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
167 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
168 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
169 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
170 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
171 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
172 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
173 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
174 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
175 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
176 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
177 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
178 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
179 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
180 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
181 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
182 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
183 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
184 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
185 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
186 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
187 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
188 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
189 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
190 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
191 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
192 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
193 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
194 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
195 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
196 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
197 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
198 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
199 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
200 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
204 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
205 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
206 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
207 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
208 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
209 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
210 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
211 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
212 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
213 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
214 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
215 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
216 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
217 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
218 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
219 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
220 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
221 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
222 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
223 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
224 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
225 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.09
Nodule 0
Rhizoplane 5.23
Rhizosphere 91.69
Stem 0
Stem Tuber 0
Unclassified 32.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070682_100495831 3300005337 Unclassified 945
2 JGI24751J29686_10002557 3300002459 Bacteria 3654
3 JGI24751J29686_10016907 3300002459 Bacteria 1506
4 JGI25406J46586_10174871 3300003203 Unclassified 626
5 Ga0065704_10212250 3300005289 Bacteria 1104
6 Ga0065712_10076630 3300005290 Unclassified 3629
7 Ga0065712_10122068 3300005290 Bacteria 1656
8 Ga0065712_10171659 3300005290 Bacteria 1240
9 Ga0065712_10211874 3300005290 Bacteria 1070
10 Ga0065715_10004810 3300005293 Bacteria 4021
11 Ga0065715_10090682 3300005293 Bacteria 6612
12 Ga0065715_10140070 3300005293 Bacteria 1867
13 Ga0065707_10005759 3300005295 Bacteria 5584
14 Ga0065707_10084090 3300005295 Bacteria 7710
15 Ga0065707_10093935 3300005295 Bacteria 3560
16 Ga0065707_10127308 3300005295 Unclassified 1986
17 Ga0065707_10388599 3300005295 Bacteria 867
18 Ga0065707_10395064 3300005295 Bacteria 860
19 Ga0065707_10521319 3300005295 Unclassified 742
20 Ga0070676_10153636 3300005328 Bacteria 1475
21 Ga0070676_10304122 3300005328 Bacteria 1082
22 Ga0070690_100005342 3300005330 Bacteria 7209
23 Ga0070670_100009157 3300005331 Bacteria 8463
24 Ga0070670_100025292 3300005331 Bacteria 5109
25 Ga0070670_100069997 3300005331 Bacteria 3012
26 Ga0070670_101525299 3300005331 Unclassified 614
27 Ga0070677_10384707 3300005333 Unclassified 736
28 Ga0068869_100199531 3300005334 Bacteria 1577
29 Ga0068869_100362567 3300005334 Bacteria 1184
30 Ga0070666_10288497 3300005335 Bacteria 1167
31 Ga0070666_10312891 3300005335 Bacteria 1119
32 Ga0070680_100299622 3300005336 Unclassified 1363
33 Ga0068868_100331585 3300005338 Unclassified 1299
34 Ga0068868_100797321 3300005338 Bacteria 852
35 Ga0070689_100089795 3300005340 Unclassified 2420
36 Ga0070689_100556902 3300005340 Unclassified 988
37 Ga0070687_100396880 3300005343 Bacteria 903
38 Ga0070661_100513095 3300005344 Bacteria 961
39 Ga0070661_100673501 3300005344 Unclassified 841
40 Ga0070661_100807585 3300005344 Unclassified 770
41 Ga0070692_10493608 3300005345 Unclassified 792
42 Ga0070668_101038369 3300005347 Unclassified 738
43 Ga0070669_100155703 3300005353 Bacteria 1772
44 Ga0070669_100170391 3300005353 Bacteria 1697
45 Ga0070669_100220669 3300005353 Unclassified 1499
46 Ga0070675_100241458 3300005354 Bacteria 1578
47 Ga0070675_100274724 3300005354 Unclassified 1479
48 Ga0070675_100291127 3300005354 Bacteria 1437
49 Ga0070675_101328553 3300005354 Unclassified 663
50 Ga0070671_100018656 3300005355 Bacteria 5636
51 Ga0070671_100413224 3300005355 Bacteria 1155
52 Ga0070671_100454423 3300005355 Bacteria 1099
53 Ga0070671_101269721 3300005355 Unclassified 649
54 Ga0070674_100005452 3300005356 Bacteria 7347
55 Ga0070674_100120402 3300005356 Bacteria 1942
56 Ga0070674_100124087 3300005356 Bacteria 1915
57 Ga0070674_100301655 3300005356 Unclassified 1277
58 Ga0070674_100729144 3300005356 Bacteria 850
59 Ga0070674_100965486 3300005356 Unclassified 746
60 Ga0070673_100015187 3300005364 Bacteria 5399
61 Ga0070673_100144764 3300005364 Bacteria 2008
62 Ga0070673_100571487 3300005364 Bacteria 1029
63 Ga0070688_100014594 3300005365 Bacteria 4455
64 Ga0070688_100313892 3300005365 Unclassified 1137
65 Ga0070688_100350412 3300005365 Bacteria 1081
66 Ga0070659_100143859 3300005366 Bacteria 1942
67 Ga0070667_101563865 3300005367 Unclassified 620
68 Ga0070703_10043127 3300005406 Bacteria 1413
69 Ga0070703_10079175 3300005406 Bacteria 1115
70 Ga0070709_10216691 3300005434 Bacteria 1363
71 Ga0070701_10056574 3300005438 Bacteria 2052
72 Ga0070701_10256793 3300005438 Bacteria 1057
73 Ga0070705_100101158 3300005440 Unclassified 1820
74 Ga0070705_100257485 3300005440 Bacteria 1229
75 Ga0070705_101568876 3300005440 Unclassified 553
76 Ga0070700_100403333 3300005441 Bacteria 1028
77 Ga0070694_100056677 3300005444 Bacteria 2662
78 Ga0070694_100579054 3300005444 Bacteria 902
79 Ga0070708_100328784 3300005445 Bacteria 1440
80 Ga0070663_100307854 3300005455 Unclassified 1270
81 Ga0070663_101349480 3300005455 Bacteria 630
82 Ga0070662_100977689 3300005457 Unclassified 724
83 Ga0070662_101344924 3300005457 Unclassified 615
84 Ga0070681_10099812 3300005458 Unclassified 2849
85 Ga0070681_10627842 3300005458 Unclassified 989
86 Ga0068867_100167736 3300005459 Bacteria 1736
87 Ga0068867_100578291 3300005459 Bacteria 977
88 Ga0070685_10447599 3300005466 Unclassified 904
89 Ga0070706_100139834 3300005467 Bacteria 2260
90 Ga0070707_100555700 3300005468 Bacteria 1110
91 Ga0070679_100658137 3300005530 Bacteria 990
92 Ga0070684_100024152 3300005535 Bacteria 5096
93 Ga0070684_100308376 3300005535 Bacteria 1453
94 Ga0070684_100983190 3300005535 Unclassified 792
95 Ga0070697_100859403 3300005536 Unclassified 804
96 Ga0070686_100045674 3300005544 Unclassified 2760
97 Ga0070695_100016557 3300005545 Bacteria 4464
98 Ga0070696_100109613 3300005546 Archaea 1987
99 Ga0070696_100161062 3300005546 Bacteria 1653
100 Ga0070665_100107668 3300005548 Bacteria 2790
101 Ga0070665_102159076 3300005548 Bacteria 561
102 Ga0070704_100252372 3300005549 Bacteria 1449
103 Ga0070704_100279906 3300005549 Unclassified 1381
104 Ga0070704_100428183 3300005549 Unclassified 1135
105 Ga0070664_100519853 3300005564 Bacteria 1098
106 Ga0070664_100539335 3300005564 Bacteria 1078
107 Ga0070664_102073057 3300005564 Unclassified 540
108 Ga0068857_100009278 3300005577 Bacteria 8537
109 Ga0068857_100305464 3300005577 Unclassified 1467
110 Ga0068854_100103397 3300005578 Bacteria 2138
111 Ga0068854_100111057 3300005578 Bacteria 2068
112 Ga0068852_100256660 3300005616 Unclassified 1677
113 Ga0068859_100012947 3300005617 Bacteria 8380
114 Ga0068859_100013521 3300005617 Bacteria 8186
115 Ga0068859_100384364 3300005617 Bacteria 1499
116 Ga0068859_100892865 3300005617 Bacteria 974
117 Ga0068864_100007679 3300005618 Bacteria 8885
118 Ga0068864_100046131 3300005618 Bacteria 3738
119 Ga0068864_100160382 3300005618 Bacteria 2044
120 Ga0068866_10106605 3300005718 Unclassified 1555
121 Ga0068861_100223513 3300005719 Bacteria 1593
122 Ga0068861_100266896 3300005719 Unclassified 1468
123 Ga0068861_100519344 3300005719 Unclassified 1080
124 Ga0068861_100568685 3300005719 Bacteria 1036
125 Ga0068863_100055562 3300005841 Bacteria 3749
126 Ga0068863_100696273 3300005841 Bacteria 1010
127 Ga0068863_100723522 3300005841 Unclassified 990
128 Ga0068863_101395260 3300005841 Unclassified 708
129 Ga0068858_100017684 3300005842 Bacteria 6681
130 Ga0068858_100039270 3300005842 Bacteria 4390
131 Ga0068858_100787149 3300005842 Unclassified 928
132 Ga0068858_100804905 3300005842 Bacteria 917
133 Ga0068860_100196679 3300005843 Unclassified 1953
134 Ga0068862_100093411 3300005844 Unclassified 2623
135 Ga0068862_100346312 3300005844 Unclassified 1377
136 Ga0068862_100510872 3300005844 Bacteria 1142
137 Ga0068862_100773647 3300005844 Bacteria 936
138 Ga0068862_100839458 3300005844 Bacteria 900
139 Ga0081539_10044513 3300005985 Bacteria 2562
140 Ga0081539_10280221 3300005985 Bacteria 726
141 Ga0075364_10476896 3300006051 Unclassified 853
142 Ga0075364_10526506 3300006051 Bacteria 808
143 Ga0075362_10000578 3300006177 Bacteria 10698
144 Ga0075366_10006633 3300006195 Bacteria 6355
145 Ga0075366_10483650 3300006195 Bacteria 765
146 Ga0097621_100000461 3300006237 Bacteria 28439
147 Ga0097621_100498258 3300006237 Bacteria 1103
148 Ga0097621_100605105 3300006237 Unclassified 1002
149 Ga0068871_100075616 3300006358 Bacteria 2781
150 Ga0068871_101432637 3300006358 Unclassified 652
151 Ga0075428_100000019 3300006844 Bacteria 137803
152 Ga0075430_100323934 3300006846 Bacteria 1274
153 Ga0075431_100141917 3300006847 Bacteria 2476
154 Ga0075433_10192334 3300006852 Bacteria 1815
155 Ga0075434_100029413 3300006871 Bacteria 5406
156 Ga0075434_100267653 3300006871 Unclassified 1728
157 Ga0075429_100472266 3300006880 Bacteria 1099
158 Ga0068865_100002248 3300006881 Bacteria 11359
159 Ga0097620_100012947 3300006931 Bacteria 8380
160 Ga0097620_100013521 3300006931 Bacteria 8186
161 Ga0097620_100384348 3300006931 Bacteria 1499
162 Ga0097620_100892900 3300006931 Bacteria 974
163 Ga0075435_100001700 3300007076 Bacteria 14284
164 Ga0105251_10135258 3300009011 Bacteria 1116
165 Ga0105240_10369237 3300009093 Unclassified 1623
166 Ga0111539_10000002 3300009094 Bacteria 983359
167 Ga0111539_10633621 3300009094 Unclassified 1245
168 Ga0105245_10027870 3300009098 Bacteria 4978
169 Ga0105245_10029416 3300009098 Bacteria 4853
170 Ga0105245_10119957 3300009098 Bacteria 2456
171 Ga0105247_10042397 3300009101 Bacteria 2788
172 Ga0105243_10095699 3300009148 Bacteria 2455
173 Ga0105243_10413176 3300009148 Bacteria 1256
174 Ga0105243_10864067 3300009148 Unclassified 897
175 Ga0105241_10242894 3300009174 Bacteria 1523
176 Ga0105242_10002755 3300009176 Bacteria 13756
177 Ga0105242_10011588 3300009176 Bacteria 6780
178 Ga0105242_10606636 3300009176 Unclassified 1058
179 Ga0105248_10047314 3300009177 Bacteria 4824
180 Ga0105248_10133080 3300009177 Unclassified 2806
181 Ga0105248_10215876 3300009177 Bacteria 2160
182 Ga0105248_10343211 3300009177 Bacteria 1681
183 Ga0105237_10655603 3300009545 Bacteria 1056
184 Ga0105238_11156159 3300009551 Unclassified 798
185 Ga0105249_10080229 3300009553 Bacteria 3031
186 Ga0105249_10220651 3300009553 Bacteria 1865
187 Ga0105249_10235558 3300009553 Unclassified 1807
188 Ga0105249_10855040 3300009553 Unclassified 975
189 Ga0105239_10658678 3300010375 Unclassified 1196
190 Ga0105239_10659578 3300010375 Bacteria 1195
191 Ga0105239_12212673 3300010375 Unclassified 639
192 Ga0105246_10098107 3300011119 Bacteria 2128
193 Ga0105246_10196154 3300011119 Unclassified 1566
194 Ga0105246_10833107 3300011119 Bacteria 821
195 Ga0157374_12097518 3300013296 Unclassified 592
196 Ga0157378_10051820 3300013297 Unclassified 3651
197 Ga0163162_10593301 3300013306 Bacteria 1234
198 Ga0157375_11060750 3300013308 Bacteria 947
199 Ga0163163_10004878 3300014325 Bacteria 11532
200 Ga0163163_10160464 3300014325 Bacteria 2294
201 Ga0163163_10533224 3300014325 Bacteria 1236
202 Ga0163163_11475214 3300014325 Unclassified 742
203 Ga0157380_10163495 3300014326 Unclassified 1937
204 Ga0157380_12199369 3300014326 Unclassified 615
205 Ga0157377_10807205 3300014745 Bacteria 692
206 Ga0157379_10955699 3300014968 Bacteria 815
207 Ga0157376_10221199 3300014969 Bacteria 1753
208 Ga0157376_11159181 3300014969 Unclassified 800
209 Ga0207697_10134254 3300025315 Unclassified 1070
210 Ga0207697_10149207 3300025315 Bacteria 1017
211 Ga0207653_10024022 3300025885 Unclassified 1944
212 Ga0207653_10087493 3300025885 Unclassified 1087
213 Ga0207642_10099079 3300025899 Unclassified 1459
214 Ga0207642_10235282 3300025899 Bacteria 1031
215 Ga0207710_10060396 3300025900 Bacteria 1718
216 Ga0207688_10191374 3300025901 Bacteria 1224
217 Ga0207680_10291508 3300025903 Bacteria 1136
218 Ga0207699_10615297 3300025906 Unclassified 792
219 Ga0207645_10063155 3300025907 Bacteria 2366
220 Ga0207645_10132473 3300025907 Unclassified 1623
221 Ga0207654_10085571 3300025911 Unclassified 1909
222 Ga0207707_10312224 3300025912 Unclassified 1358
223 Ga0207662_10000844 3300025918 Bacteria 14114
224 Ga0207662_10488064 3300025918 Bacteria 847
225 Ga0207652_10583880 3300025921 Unclassified 1003
226 Ga0207646_10865345 3300025922 Unclassified 803
227 Ga0207646_11417921 3300025922 Unclassified 604
228 Ga0207681_10021340 3300025923 Bacteria 4116
229 Ga0207681_10239988 3300025923 Bacteria 1410
230 Ga0207694_10359237 3300025924 Unclassified 1207
231 Ga0207694_10909439 3300025924 Unclassified 744
232 Ga0207650_10037226 3300025925 Bacteria 3544
233 Ga0207650_10129435 3300025925 Bacteria 1974
234 Ga0207650_10228182 3300025925 Unclassified 1501
235 Ga0207650_11007150 3300025925 Unclassified 709
236 Ga0207659_10112770 3300025926 Bacteria 2070
237 Ga0207659_10594090 3300025926 Bacteria 943
238 Ga0207659_10610600 3300025926 Bacteria 930
239 Ga0207687_10103550 3300025927 Bacteria 2099
240 Ga0207687_10118730 3300025927 Bacteria 1974
241 Ga0207687_10417302 3300025927 Bacteria 1107
242 Ga0207644_10403315 3300025931 Bacteria 1118
243 Ga0207644_10690990 3300025931 Bacteria 850
244 Ga0207690_10308320 3300025932 Unclassified 1241
245 Ga0207706_10178215 3300025933 Bacteria 1867
246 Ga0207686_10044644 3300025934 Bacteria 2722
247 Ga0207686_10179614 3300025934 Unclassified 1500
248 Ga0207709_10061977 3300025935 Bacteria 2339
249 Ga0207709_10760242 3300025935 Bacteria 780
250 Ga0207670_10019347 3300025936 Bacteria 4158
251 Ga0207670_10134232 3300025936 Bacteria 1818
252 Ga0207669_10015700 3300025937 Bacteria 3827
253 Ga0207669_10405842 3300025937 Bacteria 1069
254 Ga0207669_10465816 3300025937 Bacteria 1004
255 Ga0207669_10607380 3300025937 Bacteria 890
256 Ga0207704_10032033 3300025938 Bacteria 2969
257 Ga0207704_10266968 3300025938 Bacteria 1293
258 Ga0207704_10438285 3300025938 Bacteria 1040
259 Ga0207691_10085311 3300025940 Bacteria 2834
260 Ga0207711_10010352 3300025941 Bacteria 7747
261 Ga0207711_10042990 3300025941 Bacteria 3852
262 Ga0207711_10622905 3300025941 Bacteria 1007
263 Ga0207689_10290780 3300025942 Bacteria 1353
264 Ga0207661_10003342 3300025944 Bacteria 11128
265 Ga0207679_10158161 3300025945 Unclassified 1852
266 Ga0207679_10471994 3300025945 Bacteria 1116
267 Ga0207651_10063795 3300025960 Bacteria 2575
268 Ga0207651_10157007 3300025960 Unclassified 1778
269 Ga0207651_10446722 3300025960 Bacteria 1109
270 Ga0207712_10021254 3300025961 Bacteria 4259
271 Ga0207712_10111202 3300025961 Unclassified 2055
272 Ga0207712_10745312 3300025961 Bacteria 858
273 Ga0207668_10713942 3300025972 Bacteria 882
274 Ga0207640_10072835 3300025981 Bacteria 2319
275 Ga0207640_10204853 3300025981 Bacteria 1498
276 Ga0207640_10252602 3300025981 Bacteria 1369
277 Ga0207658_10794188 3300025986 Unclassified 859
278 Ga0207677_10107154 3300026023 Bacteria 2072
279 Ga0207677_10127916 3300026023 Bacteria 1923
280 Ga0207677_10439556 3300026023 Bacteria 1115
281 Ga0207703_10018904 3300026035 Bacteria 5383
282 Ga0207703_10221392 3300026035 Bacteria 1692
283 Ga0207678_10433349 3300026067 Unclassified 1141
284 Ga0207708_10010923 3300026075 Bacteria 6752
285 Ga0207641_10447915 3300026088 Bacteria 1247
286 Ga0207641_11428525 3300026088 Unclassified 693
287 Ga0207648_10006917 3300026089 Bacteria 11240
288 Ga0207648_10036148 3300026089 Bacteria 4351
289 Ga0207676_10016673 3300026095 Bacteria 5321
290 Ga0207676_10047723 3300026095 Unclassified 3320
291 Ga0207676_10060129 3300026095 Unclassified 3004
292 Ga0207676_10153987 3300026095 Bacteria 1983
293 Ga0207674_10018598 3300026116 Bacteria 7547
294 Ga0207675_100053935 3300026118 Bacteria 3751
295 Ga0207675_100099799 3300026118 Bacteria 2735
296 Ga0207675_100126292 3300026118 Bacteria 2423
297 Ga0207675_100412292 3300026118 Bacteria 1333
298 Ga0207675_100793451 3300026118 Unclassified 960
299 Ga0207675_101556357 3300026118 Bacteria 682
300 Ga0207683_10191691 3300026121 Bacteria 1856
301 Ga0207683_10648199 3300026121 Bacteria 978
302 Ga0207683_11586381 3300026121 Bacteria 604
303 Ga0207428_10000004 3300027907 Bacteria 727800
304 Ga0268266_10065114 3300028379 Bacteria 3150
305 Ga0268265_10237072 3300028380 Bacteria 1607
306 Ga0268265_11337186 3300028380 Bacteria 717
307 Ga0268264_10055586 3300028381 Bacteria 3308
308 Ga0268264_10292784 3300028381 Bacteria 1529
309 Ga0265323_10014931 3300028653 Unclassified 3062
310 Ga0265322_10012501 3300028654 Unclassified 2457
311 Ga0265316_10099316 3300031344 Bacteria 2214
312 Ga0307408_100308230 3300031548 Bacteria 1329
313 Ga0316576_10509487 3300031727 Bacteria 885
314 Ga0307405_11537050 3300031731 Unclassified 586
315 Ga0307407_10484945 3300031903 Bacteria 903
316 Ga0307409_100577077 3300031995 Bacteria 1108
317 Ga0307416_100455374 3300032002 Bacteria 1333
318 Ga0307416_102202058 3300032002 Unclassified 652
319 Ga0307414_10253560 3300032004 Bacteria 1464
320 Ga0307414_10673068 3300032004 Bacteria 935
321 Ga0307414_10823269 3300032004 Unclassified 848
322 Ga0307411_10052133 3300032005 Bacteria 2673
323 Ga0307411_11182105 3300032005 Bacteria 693
324 Ga0307415_100682969 3300032126 Unclassified 924
325 Ga0373949_0084980 3300035090 Unclassified 848
326 Ga0373936_0059249 3300035113 Bacteria 1560
327 Ga0373939_0394906 3300035114 Unclassified 572
328 Ga0373960_0018683 3300035121 Bacteria 1812
329 Ga0373931_0153372 3300035691 Unclassified 1345
330 Ga0373935_0294297 3300035692 Bacteria 1146
331 Ga0373935_0489694 3300035692 Bacteria 892
332 Ga0373937_0223434 3300036401 Bacteria 1773
333 Ga0373937_0588589 3300036401 Unclassified 1056
334 Ga0373937_1330584 3300036401 Bacteria 666
335 Ga0373925_0005061 3300037068 Bacteria 9870
336 Ga0373925_0072050 3300037068 Unclassified 2614
337 Ga0373925_0295489 3300037068 Bacteria 1307
338 Ga0373925_0773895 3300037068 Unclassified 791
339 Ga0439461_0022378 3300041410 Bacteria 1266
340 Ga0439431_0042905 3300041997 Bacteria 1156
341 Ga0439443_023311 3300042003 Bacteria 987
342 Ga0450920_117728 3300042122 Bacteria 557
343 Ga0439446_0010245 3300042156 Bacteria 2523
344 Ga0439460_0170093 3300042461 Bacteria 733
345 Ga0451577_0461392 3300042876 Bacteria 1154
346 Ga0495629_0162335 3300046459 Unclassified 1552
347 Ga0495639_0322293 3300046475 Unclassified 773
348 Ga0495664_0073991 3300046477 Bacteria 2038
349 Ga0495618_0279845 3300046514 Bacteria 1041
350 Ga0495618_0518402 3300046514 Unclassified 717
351 Ga0495634_0178950 3300046642 Bacteria 1329
352 Ga0495634_0516391 3300046642 Bacteria 699
353 Ga0495635_0159512 3300046663 Unclassified 1535
354 Ga0495635_0543611 3300046663 Bacteria 762
355 Ga0495599_0561153 3300046678 Unclassified 668
356 Ga0495647_0264160 3300046681 Unclassified 769
357 Ga0495658_0029068 3300046683 Bacteria 2988
358 Ga0495658_0380863 3300046683 Unclassified 898
359 Ga0495669_0108228 3300046684 Unclassified 1296
360 Ga0495613_0028513 3300046689 Bacteria 4153
361 Ga0495613_0292657 3300046689 Bacteria 1129
362 Ga0495674_0155949 3300047319 Unclassified 1913
363 Ga0495680_0437824 3300047322 Bacteria 897
364 Ga0495602_0134482 3300048088 Bacteria 1967
365 Ga0496104_0112756 3300048907 Bacteria 2608
366 Ga0496104_0121274 3300048907 Bacteria 2510
367 Ga0496104_0863966 3300048907 Unclassified 810
368 Ga0496105_0657544 3300048908 Bacteria 808
369 Ga0496108_0125240 3300048911 Bacteria 2205
370 Ga0496108_0417127 3300048911 Bacteria 1172
371 Ga0496108_0655936 3300048911 Bacteria 912
372 Ga0496109_0102041 3300048912 Unclassified 2663
373 Ga0496109_0655168 3300048912 Bacteria 987
374 Ga0496109_1139875 3300048912 Unclassified 717
375 Ga0496110_0082275 3300048913 Unclassified 2871
376 Ga0496110_1022280 3300048913 Bacteria 734
377 Ga0496112_0012200 3300048915 Bacteria 7887
378 Ga0496112_0022921 3300048915 Bacteria 5958
379 Ga0496112_0268112 3300048915 Unclassified 1656
380 Ga0496112_0343879 3300048915 Bacteria 1435
381 Ga0496112_0494074 3300048915 Unclassified 1159
382 Ga0496112_0504650 3300048915 Bacteria 1145
383 Ga0496113_0131395 3300048916 Bacteria 1965
384 Ga0496113_0221669 3300048916 Bacteria 1507
385 Ga0496114_0242517 3300048917 Bacteria 1585
386 Ga0496114_0483654 3300048917 Bacteria 1095
387 Ga0501034_0003236 3300049571 Bacteria 18625
388 Ga0501034_0096629 3300049571 Bacteria 2950
389 Ga0501036_0131286 3300049572 Unclassified 2115
390 Ga0501047_0282769 3300049581 Bacteria 1503
391 Ga0501067_0302878 3300049583 Unclassified 890
392 Ga0501074_0181417 3300049590 Unclassified 1502
393 Ga0501075_0090060 3300049591 Unclassified 2327
394 Ga0501076_0109307 3300049592 Unclassified 2234
395 Ga0501239_066130 3300049672 Unclassified 554
396 Ga0501081_0363050 3300049743 Bacteria 1068
397 Ga0501268_119515 3300049765 Bacteria 583
398 nmdc:mga03683_65931_c1 3300050489 Bacteria 1539
399 nmdc:mga00v17_35865_c1 3300050491 Bacteria 2954
400 nmdc:mga0k408_12472_c1 3300050493 Bacteria 4646
401 nmdc:mga0k408_12568_c1 3300050493 Bacteria 4629
402 nmdc:mga0k408_292916_c1 3300050493 Bacteria 971
403 nmdc:mga06z11_114140_c1 3300050494 Bacteria 1499
404 nmdc:mga06z11_306559_c1 3300050494 Bacteria 945
405 nmdc:mga0qj67_54669_c1 3300050509 Bacteria 3161
406 nmdc:mga08y16_2_c1 3300050511 Bacteria 983367
407 nmdc:mga0n895_255154_c1 3300050512 Unclassified 1779
408 nmdc:mga0rr50_300944_c1 3300050513 Unclassified 1342
409 nmdc:mga08x19_684926_c1 3300050514 Bacteria 727
410 Ga0495601_0049063 3300053077 Bacteria 2661
411 Ga0495601_0447497 3300053077 Unclassified 836
412 Ga0495601_0991668 3300053077 Unclassified 528
413 Ga0495595_0015254 3300053084 Bacteria 3275
414 Ga0495595_0407405 3300053084 Unclassified 689
415 Ga0495619_0021994 3300053085 Bacteria 4076
416 Ga0495619_0043677 3300053085 Bacteria 2939
417 Ga0495619_0180908 3300053085 Bacteria 1459
418 Ga0500658_0246342 3300053134 Unclassified 821
419 Ga0501084_0543810 3300054114 Bacteria 981
420 Ga0501082_0031778 3300060353 Bacteria 4553
421 Ga0530510_0248636 3300061734 Unclassified 1325
422 Ga0070682_100495831
423 JGI24751J29686_10002557
424 JGI24751J29686_10016907
425 JGI25406J46586_10174871
426 Ga0065704_10212250
427 Ga0065712_10076630
428 Ga0065712_10122068
429 Ga0065712_10171659
430 Ga0065712_10211874
431 Ga0065715_10004810
432 Ga0065715_10090682
433 Ga0065715_10140070
434 Ga0065707_10005759
435 Ga0065707_10084090
436 Ga0065707_10093935
437 Ga0065707_10127308
438 Ga0065707_10388599
439 Ga0065707_10395064
440 Ga0065707_10521319
441 Ga0070676_10153636
442 Ga0070676_10304122
443 Ga0070690_100005342
444 Ga0070670_100009157
445 Ga0070670_100025292
446 Ga0070670_100069997
447 Ga0070670_101525299
448 Ga0070677_10384707
449 Ga0068869_100199531
450 Ga0068869_100362567
451 Ga0070666_10288497
452 Ga0070666_10312891
453 Ga0070680_100299622
454 Ga0068868_100331585
455 Ga0068868_100797321
456 Ga0070689_100089795
457 Ga0070689_100556902
458 Ga0070687_100396880
459 Ga0070661_100513095
460 Ga0070661_100673501
461 Ga0070661_100807585
462 Ga0070692_10493608
463 Ga0070668_101038369
464 Ga0070669_100155703
465 Ga0070669_100170391
466 Ga0070669_100220669
467 Ga0070675_100241458
468 Ga0070675_100274724
469 Ga0070675_100291127
470 Ga0070675_101328553
471 Ga0070671_100018656
472 Ga0070671_100413224
473 Ga0070671_100454423
474 Ga0070671_101269721
475 Ga0070674_100005452
476 Ga0070674_100120402
477 Ga0070674_100124087
478 Ga0070674_100301655
479 Ga0070674_100729144
480 Ga0070674_100965486
481 Ga0070673_100015187
482 Ga0070673_100144764
483 Ga0070673_100571487
484 Ga0070688_100014594
485 Ga0070688_100313892
486 Ga0070688_100350412
487 Ga0070659_100143859
488 Ga0070667_101563865
489 Ga0070703_10043127
490 Ga0070703_10079175
491 Ga0070709_10216691
492 Ga0070701_10056574
493 Ga0070701_10256793
494 Ga0070705_100101158
495 Ga0070705_100257485
496 Ga0070705_101568876
497 Ga0070700_100403333
498 Ga0070694_100056677
499 Ga0070694_100579054
500 Ga0070708_100328784
501 Ga0070663_100307854
502 Ga0070663_101349480
503 Ga0070662_100977689
504 Ga0070662_101344924
505 Ga0070681_10099812
506 Ga0070681_10627842
507 Ga0068867_100167736
508 Ga0068867_100578291
509 Ga0070685_10447599
510 Ga0070706_100139834
511 Ga0070707_100555700
512 Ga0070679_100658137
513 Ga0070684_100024152
514 Ga0070684_100308376
515 Ga0070684_100983190
516 Ga0070697_100859403
517 Ga0070686_100045674
518 Ga0070695_100016557
519 Ga0070696_100109613
520 Ga0070696_100161062
521 Ga0070665_100107668
522 Ga0070665_102159076
523 Ga0070704_100252372
524 Ga0070704_100279906
525 Ga0070704_100428183
526 Ga0070664_100519853
527 Ga0070664_100539335
528 Ga0070664_102073057
529 Ga0068857_100009278
530 Ga0068857_100305464
531 Ga0068854_100103397
532 Ga0068854_100111057
533 Ga0068852_100256660
534 Ga0068859_100012947
535 Ga0068859_100013521
536 Ga0068859_100384364
537 Ga0068859_100892865
538 Ga0068864_100007679
539 Ga0068864_100046131
540 Ga0068864_100160382
541 Ga0068866_10106605
542 Ga0068861_100223513
543 Ga0068861_100266896
544 Ga0068861_100519344
545 Ga0068861_100568685
546 Ga0068863_100055562
547 Ga0068863_100696273
548 Ga0068863_100723522
549 Ga0068863_101395260
550 Ga0068858_100017684
551 Ga0068858_100039270
552 Ga0068858_100787149
553 Ga0068858_100804905
554 Ga0068860_100196679
555 Ga0068862_100093411
556 Ga0068862_100346312
557 Ga0068862_100510872
558 Ga0068862_100773647
559 Ga0068862_100839458
560 Ga0081539_10044513
561 Ga0081539_10280221
562 Ga0075364_10476896
563 Ga0075364_10526506
564 Ga0075362_10000578
565 Ga0075366_10006633
566 Ga0075366_10483650
567 Ga0097621_100000461
568 Ga0097621_100498258
569 Ga0097621_100605105
570 Ga0068871_100075616
571 Ga0068871_101432637
572 Ga0075428_100000019
573 Ga0075430_100323934
574 Ga0075431_100141917
575 Ga0075433_10192334
576 Ga0075434_100029413
577 Ga0075434_100267653
578 Ga0075429_100472266
579 Ga0068865_100002248
580 Ga0097620_100012947
581 Ga0097620_100013521
582 Ga0097620_100384348
583 Ga0097620_100892900
584 Ga0075435_100001700
585 Ga0105251_10135258
586 Ga0105240_10369237
587 Ga0111539_10000002
588 Ga0111539_10633621
589 Ga0105245_10027870
590 Ga0105245_10029416
591 Ga0105245_10119957
592 Ga0105247_10042397
593 Ga0105243_10095699
594 Ga0105243_10413176
595 Ga0105243_10864067
596 Ga0105241_10242894
597 Ga0105242_10002755
598 Ga0105242_10011588
599 Ga0105242_10606636
600 Ga0105248_10047314
601 Ga0105248_10133080
602 Ga0105248_10215876
603 Ga0105248_10343211
604 Ga0105237_10655603
605 Ga0105238_11156159
606 Ga0105249_10080229
607 Ga0105249_10220651
608 Ga0105249_10235558
609 Ga0105249_10855040
610 Ga0105239_10658678
611 Ga0105239_10659578
612 Ga0105239_12212673
613 Ga0105246_10098107
614 Ga0105246_10196154
615 Ga0105246_10833107
616 Ga0157374_12097518
617 Ga0157378_10051820
618 Ga0163162_10593301
619 Ga0157375_11060750
620 Ga0163163_10004878
621 Ga0163163_10160464
622 Ga0163163_10533224
623 Ga0163163_11475214
624 Ga0157380_10163495
625 Ga0157380_12199369
626 Ga0157377_10807205
627 Ga0157379_10955699
628 Ga0157376_10221199
629 Ga0157376_11159181
630 Ga0207697_10134254
631 Ga0207697_10149207
632 Ga0207653_10024022
633 Ga0207653_10087493
634 Ga0207642_10099079
635 Ga0207642_10235282
636 Ga0207710_10060396
637 Ga0207688_10191374
638 Ga0207680_10291508
639 Ga0207699_10615297
640 Ga0207645_10063155
641 Ga0207645_10132473
642 Ga0207654_10085571
643 Ga0207707_10312224
644 Ga0207662_10000844
645 Ga0207662_10488064
646 Ga0207652_10583880
647 Ga0207646_10865345
648 Ga0207646_11417921
649 Ga0207681_10021340
650 Ga0207681_10239988
651 Ga0207694_10359237
652 Ga0207694_10909439
653 Ga0207650_10037226
654 Ga0207650_10129435
655 Ga0207650_10228182
656 Ga0207650_11007150
657 Ga0207659_10112770
658 Ga0207659_10594090
659 Ga0207659_10610600
660 Ga0207687_10103550
661 Ga0207687_10118730
662 Ga0207687_10417302
663 Ga0207644_10403315
664 Ga0207644_10690990
665 Ga0207690_10308320
666 Ga0207706_10178215
667 Ga0207686_10044644
668 Ga0207686_10179614
669 Ga0207709_10061977
670 Ga0207709_10760242
671 Ga0207670_10019347
672 Ga0207670_10134232
673 Ga0207669_10015700
674 Ga0207669_10405842
675 Ga0207669_10465816
676 Ga0207669_10607380
677 Ga0207704_10032033
678 Ga0207704_10266968
679 Ga0207704_10438285
680 Ga0207691_10085311
681 Ga0207711_10010352
682 Ga0207711_10042990
683 Ga0207711_10622905
684 Ga0207689_10290780
685 Ga0207661_10003342
686 Ga0207679_10158161
687 Ga0207679_10471994
688 Ga0207651_10063795
689 Ga0207651_10157007
690 Ga0207651_10446722
691 Ga0207712_10021254
692 Ga0207712_10111202
693 Ga0207712_10745312
694 Ga0207668_10713942
695 Ga0207640_10072835
696 Ga0207640_10204853
697 Ga0207640_10252602
698 Ga0207658_10794188
699 Ga0207677_10107154
700 Ga0207677_10127916
701 Ga0207677_10439556
702 Ga0207703_10018904
703 Ga0207703_10221392
704 Ga0207678_10433349
705 Ga0207708_10010923
706 Ga0207641_10447915
707 Ga0207641_11428525
708 Ga0207648_10006917
709 Ga0207648_10036148
710 Ga0207676_10016673
711 Ga0207676_10047723
712 Ga0207676_10060129
713 Ga0207676_10153987
714 Ga0207674_10018598
715 Ga0207675_100053935
716 Ga0207675_100099799
717 Ga0207675_100126292
718 Ga0207675_100412292
719 Ga0207675_100793451
720 Ga0207675_101556357
721 Ga0207683_10191691
722 Ga0207683_10648199
723 Ga0207683_11586381
724 Ga0207428_10000004
725 Ga0268266_10065114
726 Ga0268265_10237072
727 Ga0268265_11337186
728 Ga0268264_10055586
729 Ga0268264_10292784
730 Ga0265323_10014931
731 Ga0265322_10012501
732 Ga0265316_10099316
733 Ga0307408_100308230
734 Ga0316576_10509487
735 Ga0307405_11537050
736 Ga0307407_10484945
737 Ga0307409_100577077
738 Ga0307416_100455374
739 Ga0307416_102202058
740 Ga0307414_10253560
741 Ga0307414_10673068
742 Ga0307414_10823269
743 Ga0307411_10052133
744 Ga0307411_11182105
745 Ga0307415_100682969
746 Ga0373949_0084980
747 Ga0373936_0059249
748 Ga0373939_0394906
749 Ga0373960_0018683
750 Ga0373931_0153372
751 Ga0373935_0294297
752 Ga0373935_0489694
753 Ga0373937_0223434
754 Ga0373937_0588589
755 Ga0373937_1330584
756 Ga0373925_0005061
757 Ga0373925_0072050
758 Ga0373925_0295489
759 Ga0373925_0773895
760 Ga0439461_0022378
761 Ga0439431_0042905
762 Ga0439443_023311
763 Ga0450920_117728
764 Ga0439446_0010245
765 Ga0439460_0170093
766 Ga0451577_0461392
767 Ga0495629_0162335
768 Ga0495639_0322293
769 Ga0495664_0073991
770 Ga0495618_0279845
771 Ga0495618_0518402
772 Ga0495634_0178950
773 Ga0495634_0516391
774 Ga0495635_0159512
775 Ga0495635_0543611
776 Ga0495599_0561153
777 Ga0495647_0264160
778 Ga0495658_0029068
779 Ga0495658_0380863
780 Ga0495669_0108228
781 Ga0495613_0028513
782 Ga0495613_0292657
783 Ga0495674_0155949
784 Ga0495680_0437824
785 Ga0495602_0134482
786 Ga0496104_0112756
787 Ga0496104_0121274
788 Ga0496104_0863966
789 Ga0496105_0657544
790 Ga0496108_0125240
791 Ga0496108_0417127
792 Ga0496108_0655936
793 Ga0496109_0102041
794 Ga0496109_0655168
795 Ga0496109_1139875
796 Ga0496110_0082275
797 Ga0496110_1022280
798 Ga0496112_0012200
799 Ga0496112_0022921
800 Ga0496112_0268112
801 Ga0496112_0343879
802 Ga0496112_0494074
803 Ga0496112_0504650
804 Ga0496113_0131395
805 Ga0496113_0221669
806 Ga0496114_0242517
807 Ga0496114_0483654
808 Ga0501034_0003236
809 Ga0501034_0096629
810 Ga0501036_0131286
811 Ga0501047_0282769
812 Ga0501067_0302878
813 Ga0501074_0181417
814 Ga0501075_0090060
815 Ga0501076_0109307
816 Ga0501239_066130
817 Ga0501081_0363050
818 Ga0501268_119515
819 nmdc:mga03683_65931_c1
820 nmdc:mga00v17_35865_c1
821 nmdc:mga0k408_12472_c1
822 nmdc:mga0k408_12568_c1
823 nmdc:mga0k408_292916_c1
824 nmdc:mga06z11_114140_c1
825 nmdc:mga06z11_306559_c1
826 nmdc:mga0qj67_54669_c1
827 nmdc:mga08y16_2_c1
828 nmdc:mga0n895_255154_c1
829 nmdc:mga0rr50_300944_c1
830 nmdc:mga08x19_684926_c1
831 Ga0495601_0049063
832 Ga0495601_0447497
833 Ga0495601_0991668
834 Ga0495595_0015254
835 Ga0495595_0407405
836 Ga0495619_0021994
837 Ga0495619_0043677
838 Ga0495619_0180908
839 Ga0500658_0246342
840 Ga0501084_0543810
841 Ga0501082_0031778
842 Ga0530510_0248636

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00210

Ferritin

Ferritin-like domain

27

164

0.97

PF02915

Rubrerythrin

Rubrerythrin

28

148

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3qd8-assembly1.cif.gz_B crystal structure of mycobacterium tuberculosis bfrb 0.973 7 158
3uno-assembly1.cif.gz_U mycobacterium tuberculosis ferritin homolog, bfrb 0.9693 4 158
3uno-assembly1.cif.gz_G mycobacterium tuberculosis ferritin homolog, bfrb 0.9693 4 158
3uno-assembly1.cif.gz_C mycobacterium tuberculosis ferritin homolog, bfrb 0.9693 4 158
3uno-assembly1.cif.gz_N mycobacterium tuberculosis ferritin homolog, bfrb 0.9692 4 158
ID Description Score Start End Superfamily
3qd8H00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.973 7 158 1.20.1260.10
3unoN00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9692 4 158 1.20.1260.10
3oj5A00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9689 4 158 1.20.1260.10
5gouO00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9672 3 122 1.20.1260.10
6ipoB00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9671 4 125 1.20.1260.10
ID Description Score Start End GO Terms
AF-A0A7C3HXA8-F1-model_v4 Ferritin (EC 1.16.3.2) 0.993 3 155 GO:0004322
GO:0005829
GO:0006826
GO:0006880
GO:0008198
GO:0008199
AF-A0A3N5Y5E2-F1-model_v4 Ferritin (EC 1.16.3.2) 0.992 3 159 GO:0004322
GO:0005829
GO:0006826
GO:0006880
GO:0008198
GO:0008199
AF-A0A533SSI7-F1-model_v4 Ferritin (EC 1.16.3.2) 0.9874 3 135 GO:0004322
GO:0005829
GO:0006826
GO:0006880
GO:0008198
GO:0008199
AF-A0A3D4ND60-F1-model_v4 Ferritin (EC 1.16.3.2) 0.9871 1 159 GO:0004322
GO:0005829
GO:0006826
GO:0006880
GO:0008198
GO:0008199
AF-A0A7V1RE00-F1-model_v4 Ferritin (EC 1.16.3.2) 0.9857 9 159 GO:0004322
GO:0005829
GO:0006826
GO:0006880
GO:0008198
GO:0008199

Map