F439781

General Info

Members Datasets Scaffolds Average Seq Length
420 206 420 223

Family's Representative Sequence

Representative Sequence 3300035725|Ga0373947_0030048|Ga0373947_0030048_178_1344
Length 245
Sequence MRSSASLLTERGWFVIFEGHSPTGGSVPSQQQVKWSQLRVGITVLVASVTLFILIFFMSGTVSPFSHKIALRAYFENAAGLVKGAPVRLSGVDIGNVDRIRIIDAADRKLTPVEVTMKISARHQSEIRRGNNGSRATLATAGVLGATFVDIDSSRASGPPIRDGDELLTTETPALQDVLKSSQGTIDKLNVILTRLDDIVFAVQNGKGSVGRLINDPELYIESRGLVKAVRENPKKYLTIHFKIF

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
5 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
76 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
77 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
91 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
108 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
166 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
167 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
169 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
170 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
171 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
172 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
173 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
174 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
175 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
176 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
177 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
178 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
179 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
180 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
181 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
182 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
183 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
184 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
185 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
186 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
187 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
188 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
189 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
190 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
191 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
192 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
193 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
194 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
195 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
196 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
197 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
198 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
199 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
200 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
201 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
202 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
203 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
204 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
205 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
206 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.29
Metatranscriptomes 0.71
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.1
Rhizosphere 96.43
Stem 0
Stem Tuber 0
Unclassified 0.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_32475 2162886012 Bacteria 4794
2 MBSR1b_contig_8695791 2162886012 Unclassified 2229
3 JGI24752J21851_1000629 3300001976 Bacteria 4704
4 JGI24743J22301_10007532 3300001991 Eukaryota 1891
5 JGI24748J21848_1001062 3300002074 Bacteria 2994
6 JGI24034J26672_10003965 3300002239 Unclassified 2084
7 JGI24751J29686_10000868 3300002459 Bacteria 6913
8 Ga0065715_10102312 3300005293 Bacteria 3126
9 Ga0070676_10033883 3300005328 Bacteria 2930
10 Ga0070683_100013748 3300005329 Bacteria 7066
11 Ga0070683_100039844 3300005329 Unclassified 4316
12 Ga0070690_100037557 3300005330 Bacteria 3053
13 Ga0070690_100038088 3300005330 Unclassified 3033
14 Ga0070670_100040264 3300005331 Bacteria 4019
15 Ga0068869_100053744 3300005334 Unclassified 2929
16 Ga0068869_100092519 3300005334 Bacteria 2276
17 Ga0070666_10159462 3300005335 Bacteria 1576
18 Ga0070682_100015557 3300005337 Bacteria 4412
19 Ga0068868_100006064 3300005338 Bacteria 8534
20 Ga0068868_100008314 3300005338 Bacteria 7427
21 Ga0068868_100010624 3300005338 Bacteria 6672
22 Ga0068868_100044859 3300005338 Bacteria 3458
23 Ga0068868_100271109 3300005338 Bacteria 1434
24 Ga0070660_100002778 3300005339 Bacteria 12015
25 Ga0070687_100004418 3300005343 Bacteria 5604
26 Ga0070668_100007297 3300005347 Bacteria 8200
27 Ga0070669_100003942 3300005353 Bacteria 10736
28 Ga0070675_100032343 3300005354 Bacteria 4233
29 Ga0070675_100301269 3300005354 Bacteria 1412
30 Ga0070671_100017772 3300005355 Bacteria 5766
31 Ga0070674_100027886 3300005356 Bacteria 3704
32 Ga0070673_100013026 3300005364 Bacteria 5736
33 Ga0070688_100001906 3300005365 Bacteria 10467
34 Ga0070659_100023932 3300005366 Bacteria 4678
35 Ga0070659_100154523 3300005366 Unclassified 1873
36 Ga0070667_100101530 3300005367 Bacteria 2485
37 Ga0070667_100292200 3300005367 Unclassified 1466
38 Ga0070709_10000813 3300005434 Bacteria 17403
39 Ga0070709_10046071 3300005434 Bacteria 2710
40 Ga0070709_10095126 3300005434 Bacteria 1972
41 Ga0070709_10167940 3300005434 Bacteria 1531
42 Ga0070709_10236651 3300005434 Bacteria 1309
43 Ga0070714_100072155 3300005435 Bacteria 2988
44 Ga0070714_100089626 3300005435 Unclassified 2693
45 Ga0070714_100275622 3300005435 Bacteria 1561
46 Ga0070713_100000583 3300005436 Bacteria 23153
47 Ga0070713_100014693 3300005436 Bacteria 5824
48 Ga0070713_100063884 3300005436 Unclassified 3088
49 Ga0070713_100100272 3300005436 Unclassified 2506
50 Ga0070713_100129460 3300005436 Bacteria 2224
51 Ga0070713_100159668 3300005436 Bacteria 2011
52 Ga0070713_100266626 3300005436 Bacteria 1567
53 Ga0070710_10013939 3300005437 Unclassified 4037
54 Ga0070710_10117279 3300005437 Bacteria 1607
55 Ga0070711_100008988 3300005439 Bacteria 6132
56 Ga0070711_100015561 3300005439 Bacteria 4815
57 Ga0070711_100031841 3300005439 Bacteria 3504
58 Ga0070711_100067791 3300005439 Bacteria 2505
59 Ga0070711_100163269 3300005439 Bacteria 1690
60 Ga0070708_100009935 3300005445 Bacteria 7692
61 Ga0070708_100030389 3300005445 Bacteria 4669
62 Ga0070708_100397877 3300005445 Unclassified 1299
63 Ga0070678_100071879 3300005456 Bacteria 2591
64 Ga0070662_100080757 3300005457 Bacteria 2421
65 Ga0070681_10003480 3300005458 Bacteria 14751
66 Ga0070681_10026935 3300005458 Bacteria 5780
67 Ga0070681_10054380 3300005458 Bacteria 3989
68 Ga0070681_10066389 3300005458 Bacteria 3576
69 Ga0068867_100001538 3300005459 Bacteria 16009
70 Ga0068867_100019358 3300005459 Unclassified 4852
71 Ga0070706_100018304 3300005467 Bacteria 6464
72 Ga0070706_100040318 3300005467 Bacteria 4310
73 Ga0070707_100001244 3300005468 Bacteria 25018
74 Ga0070707_100018017 3300005468 Bacteria 6643
75 Ga0070707_100049620 3300005468 Unclassified 4023
76 Ga0070707_100096240 3300005468 Bacteria 2867
77 Ga0070698_100001005 3300005471 Bacteria 31065
78 Ga0070698_100071193 3300005471 Unclassified 3488
79 Ga0070699_100001100 3300005518 Bacteria 25172
80 Ga0070699_100001665 3300005518 Bacteria 20284
81 Ga0070679_100019657 3300005530 Bacteria 6573
82 Ga0070679_100081914 3300005530 Bacteria 3217
83 Ga0070679_100111331 3300005530 Unclassified 2724
84 Ga0070679_100192216 3300005530 Bacteria 2010
85 Ga0070684_100003438 3300005535 Bacteria 11885
86 Ga0070684_100011720 3300005535 Bacteria 6992
87 Ga0070684_100046026 3300005535 Bacteria 3780
88 Ga0070684_100074080 3300005535 Unclassified 3001
89 Ga0070697_100000701 3300005536 Bacteria 25059
90 Ga0070697_100093187 3300005536 Bacteria 2494
91 Ga0070697_100258466 3300005536 Unclassified 1490
92 Ga0068853_100019704 3300005539 Bacteria 5600
93 Ga0068853_100037690 3300005539 Bacteria 4114
94 Ga0068853_100056995 3300005539 Bacteria 3371
95 Ga0070672_100027651 3300005543 Bacteria 4233
96 Ga0070695_100133837 3300005545 Bacteria 1711
97 Ga0070693_100016141 3300005547 Unclassified 3860
98 Ga0070693_100047487 3300005547 Unclassified 2443
99 Ga0068855_100000561 3300005563 Bacteria 45527
100 Ga0068855_100001183 3300005563 Bacteria 32426
101 Ga0068855_100171312 3300005563 Unclassified 2458
102 Ga0070664_100000538 3300005564 Bacteria 28884
103 Ga0070664_100152309 3300005564 Bacteria 2042
104 Ga0070664_100361065 3300005564 Unclassified 1323
105 Ga0068857_100000081 3300005577 Bacteria 55561
106 Ga0068857_100000434 3300005577 Bacteria 29562
107 Ga0068854_100002731 3300005578 Bacteria 10950
108 Ga0068854_100005142 3300005578 Bacteria 8250
109 Ga0068854_100018911 3300005578 Bacteria 4633
110 Ga0068856_100000394 3300005614 Bacteria 47803
111 Ga0068856_100000798 3300005614 Bacteria 33950
112 Ga0068856_100001986 3300005614 Bacteria 21328
113 Ga0068856_100002599 3300005614 Bacteria 18585
114 Ga0068856_100331083 3300005614 Bacteria 1540
115 Ga0068852_100003679 3300005616 Bacteria 10745
116 Ga0068859_100000124 3300005617 Bacteria 73706
117 Ga0068859_100021705 3300005617 Bacteria 6443
118 Ga0068864_100001275 3300005618 Bacteria 20944
119 Ga0068864_100059568 3300005618 Unclassified 3304
120 Ga0068866_10000921 3300005718 Bacteria 12902
121 Ga0068866_10005935 3300005718 Bacteria 5078
122 Ga0068866_10014371 3300005718 Bacteria 3495
123 Ga0068861_100081956 3300005719 Bacteria 2527
124 Ga0068870_10001795 3300005840 Bacteria 8804
125 Ga0068863_100031880 3300005841 Bacteria 5028
126 Ga0068863_100041570 3300005841 Bacteria 4372
127 Ga0068863_100169905 3300005841 Unclassified 2091
128 Ga0068858_100001752 3300005842 Bacteria 22123
129 Ga0068858_100056685 3300005842 Bacteria 3621
130 Ga0068858_100112320 3300005842 Unclassified 2545
131 Ga0068860_100007948 3300005843 Bacteria 10581
132 Ga0068860_100025408 3300005843 Bacteria 5714
133 Ga0068860_100043150 3300005843 Unclassified 4304
134 Ga0068860_100110089 3300005843 Bacteria 2632
135 Ga0068862_100015636 3300005844 Bacteria 6303
136 Ga0070717_10017247 3300006028 Bacteria 5614
137 Ga0070717_10017344 3300006028 Bacteria 5602
138 Ga0070717_10040778 3300006028 Bacteria 3784
139 Ga0070717_10157573 3300006028 Bacteria 1968
140 Ga0070717_10251668 3300006028 Unclassified 1561
141 Ga0070715_10006278 3300006163 Bacteria 4028
142 Ga0070716_100000188 3300006173 Bacteria 24323
143 Ga0070716_100030309 3300006173 Bacteria 2933
144 Ga0070716_100185105 3300006173 Bacteria 1371
145 Ga0070716_100221473 3300006173 Bacteria 1271
146 Ga0070712_100000130 3300006175 Bacteria 39526
147 Ga0070712_100012850 3300006175 Bacteria 5332
148 Ga0070712_100022176 3300006175 Bacteria 4179
149 Ga0070712_100028996 3300006175 Bacteria 3707
150 Ga0097621_100000234 3300006237 Bacteria 37180
151 Ga0097621_100000296 3300006237 Bacteria 33629
152 Ga0097621_100002603 3300006237 Bacteria 12369
153 Ga0097621_100061503 3300006237 Bacteria 3080
154 Ga0097621_100113721 3300006237 Unclassified 2289
155 Ga0097621_100224232 3300006237 Bacteria 1639
156 Ga0068871_100000137 3300006358 Bacteria 47104
157 Ga0068871_100000528 3300006358 Bacteria 26133
158 Ga0068871_100000663 3300006358 Bacteria 23647
159 Ga0068871_100029637 3300006358 Bacteria 4300
160 Ga0068871_100108467 3300006358 Unclassified 2333
161 Ga0075433_10032416 3300006852 Bacteria 4475
162 Ga0075434_100418980 3300006871 Bacteria 1360
163 Ga0068865_100002241 3300006881 Bacteria 11378
164 Ga0068865_100040185 3300006881 Bacteria 3176
165 Ga0075436_100017386 3300006914 Bacteria 4923
166 Ga0075436_100048757 3300006914 Unclassified 2922
167 Ga0097620_100000124 3300006931 Bacteria 73706
168 Ga0097620_100021701 3300006931 Bacteria 6443
169 Ga0075435_100008722 3300007076 Bacteria 7297
170 Ga0075435_100031628 3300007076 Unclassified 4171
171 Ga0075435_100034400 3300007076 Bacteria 4015
172 Ga0099794_10104401 3300007265 Bacteria 1416
173 Ga0099795_10012893 3300007788 Bacteria 2549
174 Ga0105250_10014142 3300009092 Bacteria 3283
175 Ga0105240_10023963 3300009093 Bacteria 8062
176 Ga0105240_10261099 3300009093 Bacteria 1998
177 Ga0105245_10000516 3300009098 Bacteria 35436
178 Ga0105245_10039960 3300009098 Unclassified 4177
179 Ga0105245_10074015 3300009098 Bacteria 3099
180 Ga0105247_10004260 3300009101 Bacteria 9162
181 Ga0105243_10108825 3300009148 Bacteria 2314
182 Ga0105241_10007799 3300009174 Bacteria 7870
183 Ga0105241_10014537 3300009174 Bacteria 5764
184 Ga0105241_10023758 3300009174 Bacteria 4549
185 Ga0105242_10014705 3300009176 Bacteria 6060
186 Ga0105248_10230774 3300009177 Unclassified 2083
187 Ga0105237_10008041 3300009545 Bacteria 11469
188 Ga0105237_10020028 3300009545 Bacteria 6905
189 Ga0105237_10022155 3300009545 Bacteria 6519
190 Ga0105237_10114644 3300009545 Unclassified 2688
191 Ga0105238_10090188 3300009551 Bacteria 3053
192 Ga0105249_10021965 3300009553 Bacteria 5714
193 Ga0105239_10004089 3300010375 Bacteria 17543
194 Ga0105239_10061602 3300010375 Bacteria 4118
195 Ga0105239_10124797 3300010375 Unclassified 2861
196 Ga0105246_10000221 3300011119 Bacteria 28982
197 Ga0157373_10014129 3300013100 Bacteria 5853
198 Ga0157371_10007152 3300013102 Bacteria 9065
199 Ga0157371_10011518 3300013102 Bacteria 6803
200 Ga0157371_10094612 3300013102 Unclassified 2117
201 Ga0157370_10022724 3300013104 Bacteria 6241
202 Ga0157369_10023402 3300013105 Bacteria 6880
203 Ga0157369_10033049 3300013105 Bacteria 5686
204 Ga0157374_10000407 3300013296 Bacteria 39138
205 Ga0157374_10001052 3300013296 Bacteria 23995
206 Ga0157374_10001435 3300013296 Bacteria 20148
207 Ga0157378_10000169 3300013297 Bacteria 62092
208 Ga0157378_10000541 3300013297 Bacteria 35976
209 Ga0157378_10000632 3300013297 Bacteria 33025
210 Ga0157378_10031186 3300013297 Bacteria 4708
211 Ga0163162_10043516 3300013306 Unclassified 4497
212 Ga0163162_10134983 3300013306 Bacteria 2578
213 Ga0163162_10170356 3300013306 Bacteria 2302
214 Ga0157372_10001168 3300013307 Bacteria 28395
215 Ga0157372_10001754 3300013307 Bacteria 23514
216 Ga0157372_10026055 3300013307 Bacteria 6360
217 Ga0157372_10029320 3300013307 Bacteria 6007
218 Ga0157372_10045801 3300013307 Unclassified 4854
219 Ga0157372_10055320 3300013307 Unclassified 4431
220 Ga0157372_10117544 3300013307 Bacteria 3050
221 Ga0157372_10278748 3300013307 Unclassified 1944
222 Ga0157372_10415738 3300013307 Unclassified 1567
223 Ga0157375_10043102 3300013308 Bacteria 4373
224 Ga0157375_10160637 3300013308 Bacteria 2388
225 Ga0163163_10010385 3300014325 Bacteria 8369
226 Ga0157380_10039343 3300014326 Bacteria 3677
227 Ga0182008_10004314 3300014497 Bacteria 8325
228 Ga0157377_10001179 3300014745 Bacteria 11096
229 Ga0157379_10025135 3300014968 Bacteria 5287
230 Ga0157376_10030473 3300014969 Bacteria 4308
231 Ga0182007_10011691 3300015262 Bacteria 3409
232 Ga0163161_10031120 3300017792 Bacteria 3801
233 Ga0224572_1001166 3300024225 Bacteria 3741
234 Ga0207697_10004779 3300025315 Bacteria 6408
235 Ga0207656_10002578 3300025321 Bacteria 6130
236 Ga0207696_1021749 3300025711 Unclassified 2049
237 Ga0207692_10005061 3300025898 Bacteria 5252
238 Ga0207692_10048776 3300025898 Bacteria 2134
239 Ga0207692_10075263 3300025898 Bacteria 1791
240 Ga0207642_10040670 3300025899 Unclassified 2030
241 Ga0207710_10009012 3300025900 Bacteria 4200
242 Ga0207688_10001831 3300025901 Bacteria 11339
243 Ga0207647_10009782 3300025904 Bacteria 6800
244 Ga0207645_10000011 3300025907 Bacteria 132246
245 Ga0207684_10000274 3300025910 Bacteria 76497
246 Ga0207684_10030673 3300025910 Bacteria 4576
247 Ga0207654_10006512 3300025911 Bacteria 5875
248 Ga0207654_10054634 3300025911 Bacteria 2309
249 Ga0207707_10002614 3300025912 Bacteria 16127
250 Ga0207707_10217919 3300025912 Bacteria 1661
251 Ga0207707_10227332 3300025912 Bacteria 1624
252 Ga0207671_10087505 3300025914 Bacteria 2343
253 Ga0207693_10001306 3300025915 Bacteria 22086
254 Ga0207693_10003899 3300025915 Bacteria 12704
255 Ga0207693_10009985 3300025915 Bacteria 7717
256 Ga0207693_10020850 3300025915 Bacteria 5210
257 Ga0207693_10034996 3300025915 Bacteria 3961
258 Ga0207663_10005632 3300025916 Bacteria 6327
259 Ga0207663_10008984 3300025916 Bacteria 5260
260 Ga0207663_10019479 3300025916 Unclassified 3824
261 Ga0207663_10067720 3300025916 Unclassified 2290
262 Ga0207663_10097558 3300025916 Bacteria 1966
263 Ga0207663_10181545 3300025916 Bacteria 1503
264 Ga0207660_10095977 3300025917 Unclassified 2207
265 Ga0207662_10020455 3300025918 Bacteria 3777
266 Ga0207657_10002376 3300025919 Bacteria 20362
267 Ga0207652_10003503 3300025921 Bacteria 12943
268 Ga0207652_10060271 3300025921 Unclassified 3274
269 Ga0207652_10241524 3300025921 Bacteria 1628
270 Ga0207646_10000240 3300025922 Bacteria 75609
271 Ga0207681_10068804 3300025923 Bacteria 2460
272 Ga0207694_10012765 3300025924 Bacteria 6329
273 Ga0207650_10000063 3300025925 Bacteria 146432
274 Ga0207650_10087044 3300025925 Unclassified 2380
275 Ga0207659_10021276 3300025926 Bacteria 4302
276 Ga0207687_10019187 3300025927 Unclassified 4528
277 Ga0207700_10000346 3300025928 Bacteria 27177
278 Ga0207700_10008555 3300025928 Bacteria 6349
279 Ga0207700_10139527 3300025928 Bacteria 1990
280 Ga0207700_10173588 3300025928 Unclassified 1800
281 Ga0207700_10275059 3300025928 Bacteria 1446
282 Ga0207644_10021804 3300025931 Bacteria 4368
283 Ga0207690_10154759 3300025932 Bacteria 1703
284 Ga0207706_10005153 3300025933 Bacteria 12199
285 Ga0207686_10031546 3300025934 Bacteria 3148
286 Ga0207670_10051036 3300025936 Bacteria 2775
287 Ga0207704_10018435 3300025938 Bacteria 3643
288 Ga0207704_10043207 3300025938 Unclassified 2659
289 Ga0207665_10000211 3300025939 Bacteria 39439
290 Ga0207665_10022542 3300025939 Bacteria 4144
291 Ga0207665_10083437 3300025939 Bacteria 2204
292 Ga0207665_10087206 3300025939 Unclassified 2157
293 Ga0207665_10238113 3300025939 Bacteria 1340
294 Ga0207691_10002600 3300025940 Bacteria 17629
295 Ga0207689_10000199 3300025942 Bacteria 52878
296 Ga0207689_10065358 3300025942 Unclassified 2992
297 Ga0207661_10001402 3300025944 Bacteria 16231
298 Ga0207679_10001195 3300025945 Bacteria 16493
299 Ga0207679_10005386 3300025945 Bacteria 8015
300 Ga0207679_10314645 3300025945 Unclassified 1354
301 Ga0207667_10005679 3300025949 Bacteria 15207
302 Ga0207667_10032656 3300025949 Bacteria 5606
303 Ga0207651_10033684 3300025960 Unclassified 3307
304 Ga0207651_10046346 3300025960 Bacteria 2922
305 Ga0207712_10099599 3300025961 Unclassified 2158
306 Ga0207668_10032095 3300025972 Bacteria 3466
307 Ga0207640_10007329 3300025981 Bacteria 6091
308 Ga0207640_10031145 3300025981 Bacteria 3293
309 Ga0207640_10041953 3300025981 Unclassified 2914
310 Ga0207658_10074299 3300025986 Bacteria 2583
311 Ga0207658_10086256 3300025986 Bacteria 2420
312 Ga0207658_10115829 3300025986 Unclassified 2128
313 Ga0207677_10006319 3300026023 Bacteria 6490
314 Ga0207677_10016218 3300026023 Unclassified 4405
315 Ga0207677_10032789 3300026023 Bacteria 3343
316 Ga0207677_10036675 3300026023 Unclassified 3198
317 Ga0207677_10210917 3300026023 Bacteria 1551
318 Ga0207703_10001866 3300026035 Bacteria 18734
319 Ga0207703_10013896 3300026035 Bacteria 6276
320 Ga0207703_10085693 3300026035 Bacteria 2637
321 Ga0207639_10016522 3300026041 Bacteria 5225
322 Ga0207639_10018100 3300026041 Bacteria 5000
323 Ga0207639_10065272 3300026041 Unclassified 2825
324 Ga0207678_10000516 3300026067 Bacteria 34999
325 Ga0207708_10065673 3300026075 Bacteria 2774
326 Ga0207702_10000482 3300026078 Bacteria 44849
327 Ga0207702_10000907 3300026078 Bacteria 30729
328 Ga0207702_10014861 3300026078 Bacteria 6458
329 Ga0207702_10049528 3300026078 Bacteria 3545
330 Ga0207702_10058298 3300026078 Bacteria 3286
331 Ga0207702_10071798 3300026078 Bacteria 2982
332 Ga0207702_10144586 3300026078 Unclassified 2156
333 Ga0207641_10000361 3300026088 Bacteria 54249
334 Ga0207641_10067687 3300026088 Unclassified 3060
335 Ga0207648_10001198 3300026089 Bacteria 29024
336 Ga0207648_10030180 3300026089 Unclassified 4805
337 Ga0207676_10000306 3300026095 Bacteria 41992
338 Ga0207676_10002377 3300026095 Bacteria 13429
339 Ga0207676_10010467 3300026095 Bacteria 6607
340 Ga0207674_10000034 3300026116 Bacteria 137337
341 Ga0207674_10000229 3300026116 Bacteria 69982
342 Ga0207683_10060972 3300026121 Bacteria 3318
343 Ga0207683_10238355 3300026121 Unclassified 1659
344 Ga0207698_10065806 3300026142 Bacteria 2849
345 Ga0268265_10078370 3300028380 Bacteria 2598
346 Ga0268264_10028356 3300028381 Bacteria 4579
347 Ga0268264_10030670 3300028381 Unclassified 4407
348 Ga0268264_10514742 3300028381 Unclassified 1169
349 Ga0265338_10129368 3300028800 Bacteria 1997
350 Ga0265338_10206350 3300028800 Bacteria 1478
351 Ga0265770_1001704 3300030878 Bacteria 3015
352 Ga0265760_10012114 3300031090 Bacteria 2464
353 Ga0265760_10016906 3300031090 Unclassified 2094
354 Ga0265340_10079457 3300031247 Unclassified 1546
355 Ga0265339_10112064 3300031249 Unclassified 1411
356 Ga0265316_10051517 3300031344 Unclassified 3233
357 Ga0265314_10002015 3300031711 Bacteria 21569
358 Ga0265314_10028066 3300031711 Bacteria 4202
359 Ga0265314_10080638 3300031711 Unclassified 2148
360 Ga0373926_0022091 3300035083 Unclassified 2207
361 Ga0373943_0034718 3300035170 Unclassified 2407
362 Ga0373943_0074595 3300035170 Bacteria 1725
363 Ga0373946_0144901 3300035171 Bacteria 1104
364 Ga0373935_0056230 3300035692 Unclassified 2508
365 Ga0373935_0071686 3300035692 Bacteria 2236
366 Ga0373935_0077929 3300035692 Bacteria 2149
367 Ga0373947_0010874 3300035725 Bacteria 5223
368 Ga0373947_0030048 3300035725 Bacteria 3191
369 Ga0373947_0065296 3300035725 Bacteria 2220
370 Ga0373937_0042372 3300036401 Unclassified 4153
371 Ga0373925_0004377 3300037068 Bacteria 10674
372 Ga0373925_0006757 3300037068 Bacteria 8411
373 Ga0373925_0272831 3300037068 Bacteria 1361
374 Ga0395898_0153235 3300037466 Bacteria 2205
375 Ga0395905_0007595 3300037471 Bacteria 10766
376 Ga0395905_0033765 3300037471 Bacteria 4805
377 Ga0395905_0034489 3300037471 Bacteria 4752
378 Ga0395905_0115121 3300037471 Unclassified 2527
379 Ga0395905_0129454 3300037471 Bacteria 2374
380 Ga0436364_0447989 3300037853 Unclassified 3632
381 Ga0395901_0141161 3300038443 Bacteria 2532
382 Ga0436365_1603610 3300039437 Bacteria 2901
383 Ga0466957_0046133 3300044842 Bacteria 2645
384 Ga0466957_0056506 3300044842 Bacteria 2400
385 Ga0466958_0013604 3300045836 Bacteria 4636
386 Ga0466967_0008986 3300045976 Bacteria 7382
387 Ga0466967_0103747 3300045976 Bacteria 2602
388 Ga0495603_0078968 3300046455 Bacteria 1929
389 Ga0495580_0005251 3300046472 Bacteria 10763
390 Ga0495580_0007040 3300046472 Bacteria 9069
391 Ga0495580_0019126 3300046472 Bacteria 5091
392 Ga0495580_0026199 3300046472 Bacteria 4254
393 Ga0495580_0118539 3300046472 Bacteria 1838
394 Ga0495582_0006372 3300046473 Bacteria 6559
395 Ga0495639_0020384 3300046475 Unclassified 2898
396 Ga0495630_0297597 3300046517 Bacteria 1233
397 Ga0495665_0008478 3300046531 Bacteria 5577
398 Ga0495665_0019269 3300046531 Bacteria 3668
399 Ga0495604_0056105 3300047317 Unclassified 3034
400 Ga0496100_0042812 3300048903 Bacteria 2894
401 Ga0496102_0011553 3300048905 Bacteria 7619
402 Ga0496108_0000038 3300048911 Bacteria 149482
403 Ga0496109_0000082 3300048912 Bacteria 99164
404 Ga0496110_0000617 3300048913 Bacteria 24469
405 Ga0496111_0004810 3300048914 Bacteria 8566
406 Ga0496112_0000220 3300048915 Bacteria 36982
407 Ga0496112_0001157 3300048915 Bacteria 19703
408 Ga0496112_0129748 3300048915 Unclassified 2492
409 Ga0496112_0157120 3300048915 Bacteria 2241
410 Ga0496113_0002416 3300048916 Bacteria 10855
411 Ga0496115_0043387 3300048918 Bacteria 3587
412 Ga0496115_0060059 3300048918 Bacteria 3063
413 nmdc:mga0n895_293525_c1 3300050512 Unclassified 1648
414 nmdc:mga0n895_7057_c1 3300050512 Bacteria 9598
415 nmdc:mga0rr50_154837_c1 3300050513 Bacteria 1856
416 nmdc:mga0rr50_28969_c1 3300050513 Bacteria 3898
417 nmdc:mga0rr50_9716_c1 3300050513 Bacteria 6067
418 nmdc:mga08x19_4721_c1 3300050514 Bacteria 8082
419 nmdc:mga08x19_7558_c1 3300050514 Bacteria 6459
420 nmdc:mga0a205_5922_c1 3300050515 Bacteria 4988

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035171 Ga0373946_0144901 Ga0373946_0144901_10_987 193
2 3300046475 Ga0495639_0020384 Ga0495639_0020384_38_1015 193
3 3300037471 Ga0395905_0033765 Ga0395905_0033765_3346_4347 194
4 3300030878 Ga0265770_1001704 Ga0265770_10017042 196
5 3300031090 Ga0265760_10012114 Ga0265760_100121142 196
6 3300024225 Ga0224572_1001166 Ga0224572_10011661 197
7 3300031090 Ga0265760_10016906 Ga0265760_100169062 197
8 3300037853 Ga0436364_0447989 Ga0436364_0447989_636_1706 199
9 3300006028 Ga0070717_10251668 Ga0070717_102516682 200
10 3300025915 Ga0207693_10003899 Ga0207693_100038996 200
11 3300005436 Ga0070713_100100272 Ga0070713_1001002722 201
12 3300005439 Ga0070711_100015561 Ga0070711_1000155615 201
13 3300025916 Ga0207663_10005632 Ga0207663_100056323 201
14 3300047317 Ga0495604_0056105 Ga0495604_0056105_244_1299 201
15 3300005467 Ga0070706_100040318 Ga0070706_1000403183 202
16 3300005841 Ga0068863_100169905 Ga0068863_1001699052 202
17 3300037471 Ga0395905_0129454 Ga0395905_0129454_40_1113 203
18 3300005434 Ga0070709_10236651 Ga0070709_102366511 204
19 3300005435 Ga0070714_100275622 Ga0070714_1002756222 204
20 3300005458 Ga0070681_10054380 Ga0070681_100543802 204
21 3300005530 Ga0070679_100192216 Ga0070679_1001922162 204
22 3300005614 Ga0068856_100331083 Ga0068856_1003310832 204
23 3300006173 Ga0070716_100030309 Ga0070716_1000303092 204
24 3300009174 Ga0105241_10023758 Ga0105241_100237582 204
25 3300009545 Ga0105237_10020028 Ga0105237_100200282 204
26 3300013104 Ga0157370_10022724 Ga0157370_100227242 204
27 3300013105 Ga0157369_10033049 Ga0157369_100330494 204
28 3300013307 Ga0157372_10026055 Ga0157372_100260554 204
29 3300025911 Ga0207654_10054634 Ga0207654_100546342 204
30 3300025912 Ga0207707_10217919 Ga0207707_102179192 204
31 3300025914 Ga0207671_10087505 Ga0207671_100875052 204
32 3300025939 Ga0207665_10083437 Ga0207665_100834371 204
33 3300026078 Ga0207702_10049528 Ga0207702_100495282 204
34 3300035170 Ga0373943_0074595 Ga0373943_0074595_32_1102 204
35 3300037068 Ga0373925_0004377 Ga0373925_0004377_4092_5162 204
36 3300009098 Ga0105245_10000516 Ga0105245_1000051619 205
37 3300013297 Ga0157378_10000632 Ga0157378_1000063230 205
38 3300013306 Ga0163162_10043516 Ga0163162_100435162 205
39 3300013307 Ga0157372_10278748 Ga0157372_102787481 205
40 3300006914 Ga0075436_100017386 Ga0075436_1000173862 206
41 3300010375 Ga0105239_10124797 Ga0105239_101247972 206
42 3300013102 Ga0157371_10094612 Ga0157371_100946121 206
43 3300013296 Ga0157374_10001052 Ga0157374_1000105216 206
44 3300014497 Ga0182008_10004314 Ga0182008_100043145 206
45 3300015262 Ga0182007_10011691 Ga0182007_100116913 206
46 3300037068 Ga0373925_0272831 Ga0373925_0272831_26_1042 206
47 3300045976 Ga0466967_0008986 Ga0466967_0008986_2509_3594 206
48 3300048915 Ga0496112_0001157 Ga0496112_0001157_3250_4305 206
49 3300048915 Ga0496112_0157120 Ga0496112_0157120_442_1476 206
50 3300050514 nmdc:mga08x19_7558_c1 nmdc:mga08x19_7558_c1_1289_2395 206
51 3300046472 Ga0495580_0118539 Ga0495580_0118539_129_1157 207
52 3300013296 Ga0157374_10000407 Ga0157374_100004075 208
53 3300013297 Ga0157378_10000169 Ga0157378_1000016946 208
54 3300013307 Ga0157372_10001754 Ga0157372_100017547 208
55 3300007265 Ga0099794_10104401 Ga0099794_101044011 209
56 3300036401 Ga0373937_0042372 Ga0373937_0042372_2097_3170 209
57 3300005445 Ga0070708_100397877 Ga0070708_1003978771 210
58 3300005468 Ga0070707_100049620 Ga0070707_1000496202 210
59 3300006852 Ga0075433_10032416 Ga0075433_100324164 210
60 3300007076 Ga0075435_100034400 Ga0075435_1000344002 210
61 3300046472 Ga0495580_0019126 Ga0495580_0019126_3396_4436 211
62 3300005338 Ga0068868_100271109 Ga0068868_1002711091 212
63 3300005436 Ga0070713_100266626 Ga0070713_1002666262 212
64 3300005458 Ga0070681_10003480 Ga0070681_100034802 212
65 3300005530 Ga0070679_100019657 Ga0070679_1000196572 212
66 3300005535 Ga0070684_100046026 Ga0070684_1000460262 212
67 3300005539 Ga0068853_100019704 Ga0068853_1000197042 212
68 3300005563 Ga0068855_100000561 Ga0068855_10000056130 212
69 3300005614 Ga0068856_100001986 Ga0068856_10000198610 212
70 3300006237 Ga0097621_100002603 Ga0097621_1000026031 212
71 3300006358 Ga0068871_100000663 Ga0068871_10000066317 212
72 3300025912 Ga0207707_10227332 Ga0207707_102273321 212
73 3300025917 Ga0207660_10095977 Ga0207660_100959772 212
74 3300025921 Ga0207652_10003503 Ga0207652_100035036 212
75 3300025924 Ga0207694_10012765 Ga0207694_100127652 212
76 3300025928 Ga0207700_10139527 Ga0207700_101395272 212
77 3300025949 Ga0207667_10005679 Ga0207667_1000567912 212
78 3300026023 Ga0207677_10210917 Ga0207677_102109172 212
79 3300026041 Ga0207639_10016522 Ga0207639_100165222 212
80 3300026078 Ga0207702_10000482 Ga0207702_1000048229 212
81 3300026121 Ga0207683_10238355 Ga0207683_102383552 212
82 3300005355 Ga0070671_100017772 Ga0070671_1000177723 214
83 3300005437 Ga0070710_10117279 Ga0070710_101172792 214
84 3300005439 Ga0070711_100067791 Ga0070711_1000677912 214
85 3300005530 Ga0070679_100081914 Ga0070679_1000819142 214
86 3300005535 Ga0070684_100011720 Ga0070684_1000117205 214
87 3300005547 Ga0070693_100047487 Ga0070693_1000474871 214
88 3300005563 Ga0068855_100001183 Ga0068855_10000118311 214
89 3300005564 Ga0070664_100361065 Ga0070664_1003610651 214
90 3300005578 Ga0068854_100005142 Ga0068854_1000051422 214
91 3300005614 Ga0068856_100000798 Ga0068856_1000007985 214
92 3300005618 Ga0068864_100059568 Ga0068864_1000595682 214
93 3300005718 Ga0068866_10014371 Ga0068866_100143712 214
94 3300005842 Ga0068858_100112320 Ga0068858_1001123202 214
95 3300006237 Ga0097621_100000234 Ga0097621_1000002347 214
96 3300006358 Ga0068871_100000528 Ga0068871_10000052817 214
97 3300009098 Ga0105245_10039960 Ga0105245_100399602 214
98 3300009174 Ga0105241_10007799 Ga0105241_100077993 214
99 3300009177 Ga0105248_10230774 Ga0105248_102307742 214
100 3300013102 Ga0157371_10011518 Ga0157371_100115182 214
101 3300013296 Ga0157374_10001435 Ga0157374_1000143510 214
102 3300013297 Ga0157378_10000541 Ga0157378_1000054112 214
103 3300013307 Ga0157372_10001168 Ga0157372_100011689 214
104 3300025916 Ga0207663_10181545 Ga0207663_101815452 214
105 3300025931 Ga0207644_10021804 Ga0207644_100218042 214
106 3300025945 Ga0207679_10314645 Ga0207679_103146451 214
107 3300025949 Ga0207667_10032656 Ga0207667_100326561 214
108 3300025981 Ga0207640_10041953 Ga0207640_100419532 214
109 3300026023 Ga0207677_10036675 Ga0207677_100366752 214
110 3300026035 Ga0207703_10013896 Ga0207703_100138965 214
111 3300026078 Ga0207702_10000907 Ga0207702_1000090717 214
112 3300026088 Ga0207641_10067687 Ga0207641_100676872 214
113 3300026095 Ga0207676_10010467 Ga0207676_100104673 214
114 3300028381 Ga0268264_10514742 Ga0268264_105147421 214
115 3300035725 Ga0373947_0030048 Ga0373947_0030048_178_1344 214
116 3300035725 Ga0373947_0065296 Ga0373947_0065296_772_1857 214
117 3300044842 Ga0466957_0046133 Ga0466957_0046133_1045_2124 214
118 3300006173 Ga0070716_100185105 Ga0070716_1001851051 215
119 3300025939 Ga0207665_10238113 Ga0207665_102381131 215
120 3300037471 Ga0395905_0034489 Ga0395905_0034489_3235_4308 215
121 3300044842 Ga0466957_0056506 Ga0466957_0056506_692_1837 215
122 3300045836 Ga0466958_0013604 Ga0466958_0013604_2124_3269 215
123 3300005434 Ga0070709_10000813 Ga0070709_100008136 216
124 3300005435 Ga0070714_100089626 Ga0070714_1000896263 216
125 3300005436 Ga0070713_100000583 Ga0070713_10000058320 216
126 3300005437 Ga0070710_10013939 Ga0070710_100139392 216
127 3300005439 Ga0070711_100031841 Ga0070711_1000318411 216
128 3300006028 Ga0070717_10017247 Ga0070717_100172472 216
129 3300006175 Ga0070712_100000130 Ga0070712_10000013016 216
130 3300025898 Ga0207692_10005061 Ga0207692_100050612 216
131 3300025915 Ga0207693_10001306 Ga0207693_1000130614 216
132 3300025916 Ga0207663_10019479 Ga0207663_100194791 216
133 3300025928 Ga0207700_10000346 Ga0207700_100003462 216
134 3300037466 Ga0395898_0153235 Ga0395898_0153235_1000_2151 216
135 3300037471 Ga0395905_0007595 Ga0395905_0007595_9159_10232 216
136 3300037471 Ga0395905_0115121 Ga0395905_0115121_1005_2156 216
137 3300045976 Ga0466967_0103747 Ga0466967_0103747_315_1385 216
138 3300046472 Ga0495580_0026199 Ga0495580_0026199_1293_2366 216
139 3300048918 Ga0496115_0043387 Ga0496115_0043387_94_1167 216
140 3300005436 Ga0070713_100014693 Ga0070713_1000146932 217
141 3300005436 Ga0070713_100063884 Ga0070713_1000638844 217
142 3300006028 Ga0070717_10017344 Ga0070717_100173442 217
143 3300006175 Ga0070712_100012850 Ga0070712_1000128504 217
144 3300025898 Ga0207692_10048776 Ga0207692_100487763 217
145 3300025928 Ga0207700_10008555 Ga0207700_100085554 217
146 3300025928 Ga0207700_10275059 Ga0207700_102750592 217
147 3300028800 Ga0265338_10129368 Ga0265338_101293682 217
148 3300028800 Ga0265338_10206350 Ga0265338_102063501 217
149 3300031247 Ga0265340_10079457 Ga0265340_100794571 217
150 3300031711 Ga0265314_10080638 Ga0265314_100806382 217
151 3300038443 Ga0395901_0141161 Ga0395901_0141161_422_1495 217
152 3300005436 Ga0070713_100129460 Ga0070713_1001294602 218
153 3300005458 Ga0070681_10066389 Ga0070681_100663895 218
154 3300006173 Ga0070716_100221473 Ga0070716_1002214731 218
155 3300009093 Ga0105240_10023963 Ga0105240_100239635 218
156 3300009545 Ga0105237_10114644 Ga0105237_101146442 218
157 3300013307 Ga0157372_10415738 Ga0157372_104157382 218
158 3300025939 Ga0207665_10087206 Ga0207665_100872062 218
159 3300039437 Ga0436365_1603610 Ga0436365_1603610_1465_2517 218
160 3300005434 Ga0070709_10046071 Ga0070709_100460712 219
161 3300005436 Ga0070713_100159668 Ga0070713_1001596683 219
162 3300005564 Ga0070664_100152309 Ga0070664_1001523092 219
163 3300005614 Ga0068856_100002599 Ga0068856_1000025995 219
164 3300007788 Ga0099795_10012893 Ga0099795_100128932 219
165 3300025915 Ga0207693_10034996 Ga0207693_100349965 219
166 3300026078 Ga0207702_10058298 Ga0207702_100582982 219
167 3300031249 Ga0265339_10112064 Ga0265339_101120642 219
168 3300035692 Ga0373935_0071686 Ga0373935_0071686_76_1149 219
169 3300046531 Ga0495665_0019269 Ga0495665_0019269_2320_3393 219
170 3300050512 nmdc:mga0n895_7057_c1 nmdc:mga0n895_7057_c1_3052_4107 219
171 3300050513 nmdc:mga0rr50_154837_c1 nmdc:mga0rr50_154837_c1_664_1719 219
172 3300005329 Ga0070683_100039844 Ga0070683_1000398442 220
173 3300005330 Ga0070690_100038088 Ga0070690_1000380881 220
174 3300005334 Ga0068869_100053744 Ga0068869_1000537442 220
175 3300005338 Ga0068868_100006064 Ga0068868_1000060647 220
176 3300005364 Ga0070673_100013026 Ga0070673_1000130266 220
177 3300005366 Ga0070659_100154523 Ga0070659_1001545232 220
178 3300005445 Ga0070708_100009935 Ga0070708_1000099353 220
179 3300005458 Ga0070681_10026935 Ga0070681_100269354 220
180 3300005459 Ga0068867_100019358 Ga0068867_1000193582 220
181 3300005467 Ga0070706_100018304 Ga0070706_1000183042 220
182 3300005468 Ga0070707_100096240 Ga0070707_1000962402 220
183 3300005471 Ga0070698_100071193 Ga0070698_1000711932 220
184 3300005530 Ga0070679_100111331 Ga0070679_1001113312 220
185 3300005535 Ga0070684_100074080 Ga0070684_1000740801 220
186 3300005536 Ga0070697_100258466 Ga0070697_1002584661 220
187 3300005545 Ga0070695_100133837 Ga0070695_1001338371 220
188 3300005564 Ga0070664_100000538 Ga0070664_1000005385 220
189 3300005577 Ga0068857_100000081 Ga0068857_10000008112 220
190 3300005578 Ga0068854_100002731 Ga0068854_1000027314 220
191 3300005614 Ga0068856_100000394 Ga0068856_10000039410 220
192 3300005617 Ga0068859_100000124 Ga0068859_1000001246 220
193 3300005618 Ga0068864_100001275 Ga0068864_1000012754 220
194 3300005718 Ga0068866_10005935 Ga0068866_100059352 220
195 3300005842 Ga0068858_100001752 Ga0068858_1000017528 220
196 3300005843 Ga0068860_100043150 Ga0068860_1000431502 220
197 3300006237 Ga0097621_100113721 Ga0097621_1001137212 220
198 3300006881 Ga0068865_100002241 Ga0068865_1000022418 220
199 3300006931 Ga0097620_100000124 Ga0097620_1000001246 220
200 3300025911 Ga0207654_10006512 Ga0207654_100065122 220
201 3300025912 Ga0207707_10002614 Ga0207707_100026142 220
202 3300025921 Ga0207652_10060271 Ga0207652_100602712 220
203 3300025932 Ga0207690_10154759 Ga0207690_101547592 220
204 3300025938 Ga0207704_10043207 Ga0207704_100432072 220
205 3300025942 Ga0207689_10065358 Ga0207689_100653582 220
206 3300025945 Ga0207679_10005386 Ga0207679_100053864 220
207 3300025960 Ga0207651_10033684 Ga0207651_100336843 220
208 3300025981 Ga0207640_10007329 Ga0207640_100073292 220
209 3300026023 Ga0207677_10006319 Ga0207677_100063195 220
210 3300026035 Ga0207703_10001866 Ga0207703_1000186615 220
211 3300026041 Ga0207639_10065272 Ga0207639_100652722 220
212 3300026078 Ga0207702_10014861 Ga0207702_100148616 220
213 3300026089 Ga0207648_10030180 Ga0207648_100301803 220
214 3300026095 Ga0207676_10002377 Ga0207676_100023773 220
215 3300026116 Ga0207674_10000229 Ga0207674_1000022911 220
216 3300028381 Ga0268264_10030670 Ga0268264_100306702 220
217 3300005354 Ga0070675_100301269 Ga0070675_1003012692 221
218 3300005539 Ga0068853_100056995 Ga0068853_1000569952 221
219 3300005841 Ga0068863_100041570 Ga0068863_1000415704 221
220 3300005842 Ga0068858_100056685 Ga0068858_1000566853 221
221 3300005843 Ga0068860_100007948 Ga0068860_1000079486 221
222 3300006358 Ga0068871_100108467 Ga0068871_1001084672 221
223 3300009545 Ga0105237_10022155 Ga0105237_100221552 221
224 3300010375 Ga0105239_10004089 Ga0105239_100040892 221
225 3300013297 Ga0157378_10031186 Ga0157378_100311862 221
226 3300013306 Ga0163162_10134983 Ga0163162_101349832 221
227 3300013308 Ga0157375_10043102 Ga0157375_100431023 221
228 3300050513 nmdc:mga0rr50_28969_c1 nmdc:mga0rr50_28969_c1_1431_2504 221
229 3300050515 nmdc:mga0a205_5922_c1 nmdc:mga0a205_5922_c1_2743_3816 221
230 3300005338 Ga0068868_100010624 Ga0068868_1000106245 223
231 3300005367 Ga0070667_100101530 Ga0070667_1001015302 223
232 3300005547 Ga0070693_100016141 Ga0070693_1000161412 223
233 3300005843 Ga0068860_100025408 Ga0068860_1000254084 223
234 3300006028 Ga0070717_10040778 Ga0070717_100407782 223
235 3300006237 Ga0097621_100000296 Ga0097621_10000029631 223
236 3300006358 Ga0068871_100000137 Ga0068871_10000013725 223
237 3300009093 Ga0105240_10261099 Ga0105240_102610992 223
238 3300025927 Ga0207687_10019187 Ga0207687_100191873 223
239 3300025986 Ga0207658_10074299 Ga0207658_100742992 223
240 3300026023 Ga0207677_10016218 Ga0207677_100162182 223
241 3300005434 Ga0070709_10095126 Ga0070709_100951262 224
242 3300005439 Ga0070711_100008988 Ga0070711_1000089882 224
243 3300005439 Ga0070711_100163269 Ga0070711_1001632691 224
244 3300005445 Ga0070708_100030389 Ga0070708_1000303895 224
245 3300005468 Ga0070707_100018017 Ga0070707_1000180173 224
246 3300005518 Ga0070699_100001665 Ga0070699_1000016657 224
247 3300005536 Ga0070697_100093187 Ga0070697_1000931872 224
248 3300006163 Ga0070715_10006278 Ga0070715_100062782 224
249 3300006173 Ga0070716_100000188 Ga0070716_1000001882 224
250 3300006175 Ga0070712_100022176 Ga0070712_1000221762 224
251 3300006175 Ga0070712_100028996 Ga0070712_1000289962 224
252 3300006358 Ga0068871_100029637 Ga0068871_1000296371 224
253 3300006871 Ga0075434_100418980 Ga0075434_1004189801 224
254 3300006914 Ga0075436_100048757 Ga0075436_1000487572 224
255 3300007076 Ga0075435_100031628 Ga0075435_1000316282 224
256 3300025898 Ga0207692_10075263 Ga0207692_100752632 224
257 3300025915 Ga0207693_10009985 Ga0207693_1000998510 224
258 3300025915 Ga0207693_10020850 Ga0207693_100208505 224
259 3300025916 Ga0207663_10008984 Ga0207663_100089842 224
260 3300025916 Ga0207663_10067720 Ga0207663_100677202 224
261 3300025916 Ga0207663_10097558 Ga0207663_100975582 224
262 3300025939 Ga0207665_10000211 Ga0207665_1000021127 224
263 3300025939 Ga0207665_10022542 Ga0207665_100225422 224
264 3300035083 Ga0373926_0022091 Ga0373926_0022091_899_1969 224
265 3300035170 Ga0373943_0034718 Ga0373943_0034718_122_1192 224
266 3300035692 Ga0373935_0056230 Ga0373935_0056230_755_1825 224
267 3300035725 Ga0373947_0010874 Ga0373947_0010874_2524_3594 224
268 3300037068 Ga0373925_0006757 Ga0373925_0006757_6568_7638 224
269 3300046455 Ga0495603_0078968 Ga0495603_0078968_600_1718 224
270 3300046472 Ga0495580_0005251 Ga0495580_0005251_7077_8147 224
271 3300046472 Ga0495580_0007040 Ga0495580_0007040_7129_8247 224
272 3300046473 Ga0495582_0006372 Ga0495582_0006372_4874_5944 224
273 3300046517 Ga0495630_0297597 Ga0495630_0297597_97_1167 224
274 3300046531 Ga0495665_0008478 Ga0495665_0008478_12_1082 224
275 3300050512 nmdc:mga0n895_293525_c1 nmdc:mga0n895_293525_c1_537_1607 224
276 3300050513 nmdc:mga0rr50_9716_c1 nmdc:mga0rr50_9716_c1_1471_2541 224
277 3300050514 nmdc:mga08x19_4721_c1 nmdc:mga08x19_4721_c1_3305_4375 224
278 3300007076 Ga0075435_100008722 Ga0075435_1000087229 225
279 3300013307 Ga0157372_10055320 Ga0157372_100553204 225
280 3300025928 Ga0207700_10173588 Ga0207700_101735882 225
281 3300035692 Ga0373935_0077929 Ga0373935_0077929_100_1185 225
282 3300005434 Ga0070709_10167940 Ga0070709_101679402 226
283 3300005435 Ga0070714_100072155 Ga0070714_1000721552 226
284 3300025921 Ga0207652_10241524 Ga0207652_102415243 226
285 3300026078 Ga0207702_10071798 Ga0207702_100717982 226
286 3300006237 Ga0097621_100224232 Ga0097621_1002242321 227
287 3300013307 Ga0157372_10029320 Ga0157372_100293202 227
288 3300031344 Ga0265316_10051517 Ga0265316_100515172 227
289 3300031711 Ga0265314_10002015 Ga0265314_1000201516 227
290 3300006028 Ga0070717_10157573 Ga0070717_101575732 228
291 3300009551 Ga0105238_10090188 Ga0105238_100901883 228
292 3300013307 Ga0157372_10045801 Ga0157372_100458012 228
293 3300025910 Ga0207684_10030673 Ga0207684_100306734 228
294 3300005468 Ga0070707_100001244 Ga0070707_1000012446 229
295 3300005471 Ga0070698_100001005 Ga0070698_1000010056 229
296 3300005518 Ga0070699_100001100 Ga0070699_10000110022 229
297 3300005536 Ga0070697_100000701 Ga0070697_10000070119 229
298 3300025910 Ga0207684_10000274 Ga0207684_100002747 229
299 3300025922 Ga0207646_10000240 Ga0207646_100002407 229
300 2162886012 MBSR1b_contig_32475 MBSR1b_0615.00007330 230
301 2162886012 MBSR1b_contig_8695791 MBSR1b_0879.00007580 230
302 3300001976 JGI24752J21851_1000629 JGI24752J21851_10006293 230
303 3300001991 JGI24743J22301_10007532 JGI24743J22301_100075322 230
304 3300002074 JGI24748J21848_1001062 JGI24748J21848_10010622 230
305 3300002239 JGI24034J26672_10003965 JGI24034J26672_100039652 230
306 3300002459 JGI24751J29686_10000868 JGI24751J29686_100008684 230
307 3300005293 Ga0065715_10102312 Ga0065715_101023121 230
308 3300005328 Ga0070676_10033883 Ga0070676_100338832 230
309 3300005329 Ga0070683_100013748 Ga0070683_1000137482 230
310 3300005330 Ga0070690_100037557 Ga0070690_1000375572 230
311 3300005331 Ga0070670_100040264 Ga0070670_1000402642 230
312 3300005334 Ga0068869_100092519 Ga0068869_1000925192 230
313 3300005335 Ga0070666_10159462 Ga0070666_101594621 230
314 3300005337 Ga0070682_100015557 Ga0070682_1000155573 230
315 3300005338 Ga0068868_100008314 Ga0068868_1000083142 230
316 3300005338 Ga0068868_100044859 Ga0068868_1000448592 230
317 3300005339 Ga0070660_100002778 Ga0070660_1000027788 230
318 3300005343 Ga0070687_100004418 Ga0070687_1000044184 230
319 3300005347 Ga0070668_100007297 Ga0070668_1000072975 230
320 3300005353 Ga0070669_100003942 Ga0070669_1000039428 230
321 3300005354 Ga0070675_100032343 Ga0070675_1000323434 230
322 3300005356 Ga0070674_100027886 Ga0070674_1000278862 230
323 3300005365 Ga0070688_100001906 Ga0070688_1000019067 230
324 3300005366 Ga0070659_100023932 Ga0070659_1000239322 230
325 3300005367 Ga0070667_100292200 Ga0070667_1002922001 230
326 3300005456 Ga0070678_100071879 Ga0070678_1000718793 230
327 3300005457 Ga0070662_100080757 Ga0070662_1000807571 230
328 3300005459 Ga0068867_100001538 Ga0068867_10000153813 230
329 3300005535 Ga0070684_100003438 Ga0070684_1000034388 230
330 3300005539 Ga0068853_100037690 Ga0068853_1000376902 230
331 3300005543 Ga0070672_100027651 Ga0070672_1000276514 230
332 3300005563 Ga0068855_100171312 Ga0068855_1001713123 230
333 3300005577 Ga0068857_100000434 Ga0068857_10000043426 230
334 3300005578 Ga0068854_100018911 Ga0068854_1000189113 230
335 3300005616 Ga0068852_100003679 Ga0068852_1000036794 230
336 3300005617 Ga0068859_100021705 Ga0068859_1000217052 230
337 3300005718 Ga0068866_10000921 Ga0068866_100009213 230
338 3300005719 Ga0068861_100081956 Ga0068861_1000819563 230
339 3300005840 Ga0068870_10001795 Ga0068870_100017954 230
340 3300005841 Ga0068863_100031880 Ga0068863_1000318802 230
341 3300005843 Ga0068860_100110089 Ga0068860_1001100893 230
342 3300005844 Ga0068862_100015636 Ga0068862_1000156364 230
343 3300006237 Ga0097621_100061503 Ga0097621_1000615032 230
344 3300006881 Ga0068865_100040185 Ga0068865_1000401852 230
345 3300006931 Ga0097620_100021701 Ga0097620_1000217014 230
346 3300009092 Ga0105250_10014142 Ga0105250_100141424 230
347 3300009098 Ga0105245_10074015 Ga0105245_100740152 230
348 3300009101 Ga0105247_10004260 Ga0105247_100042605 230
349 3300009148 Ga0105243_10108825 Ga0105243_101088253 230
350 3300009174 Ga0105241_10014537 Ga0105241_100145374 230
351 3300009176 Ga0105242_10014705 Ga0105242_100147054 230
352 3300009545 Ga0105237_10008041 Ga0105237_100080418 230
353 3300009553 Ga0105249_10021965 Ga0105249_100219652 230
354 3300010375 Ga0105239_10061602 Ga0105239_100616024 230
355 3300011119 Ga0105246_10000221 Ga0105246_100002214 230
356 3300013100 Ga0157373_10014129 Ga0157373_100141294 230
357 3300013102 Ga0157371_10007152 Ga0157371_100071526 230
358 3300013105 Ga0157369_10023402 Ga0157369_100234022 230
359 3300013306 Ga0163162_10170356 Ga0163162_101703561 230
360 3300013307 Ga0157372_10117544 Ga0157372_101175443 230
361 3300013308 Ga0157375_10160637 Ga0157375_101606371 230
362 3300014325 Ga0163163_10010385 Ga0163163_100103851 230
363 3300014326 Ga0157380_10039343 Ga0157380_100393434 230
364 3300014745 Ga0157377_10001179 Ga0157377_100011798 230
365 3300014968 Ga0157379_10025135 Ga0157379_100251354 230
366 3300014969 Ga0157376_10030473 Ga0157376_100304732 230
367 3300017792 Ga0163161_10031120 Ga0163161_100311202 230
368 3300025315 Ga0207697_10004779 Ga0207697_100047794 230
369 3300025321 Ga0207656_10002578 Ga0207656_100025784 230
370 3300025711 Ga0207696_1021749 Ga0207696_10217493 230
371 3300025899 Ga0207642_10040670 Ga0207642_100406702 230
372 3300025900 Ga0207710_10009012 Ga0207710_100090123 230
373 3300025901 Ga0207688_10001831 Ga0207688_100018312 230
374 3300025904 Ga0207647_10009782 Ga0207647_100097825 230
375 3300025907 Ga0207645_10000011 Ga0207645_1000001114 230
376 3300025918 Ga0207662_10020455 Ga0207662_100204554 230
377 3300025919 Ga0207657_10002376 Ga0207657_1000237611 230
378 3300025923 Ga0207681_10068804 Ga0207681_100688042 230
379 3300025925 Ga0207650_10000063 Ga0207650_1000006342 230
380 3300025925 Ga0207650_10087044 Ga0207650_100870442 230
381 3300025926 Ga0207659_10021276 Ga0207659_100212762 230
382 3300025933 Ga0207706_10005153 Ga0207706_100051533 230
383 3300025934 Ga0207686_10031546 Ga0207686_100315461 230
384 3300025936 Ga0207670_10051036 Ga0207670_100510361 230
385 3300025938 Ga0207704_10018435 Ga0207704_100184352 230
386 3300025940 Ga0207691_10002600 Ga0207691_1000260014 230
387 3300025942 Ga0207689_10000199 Ga0207689_1000019916 230
388 3300025944 Ga0207661_10001402 Ga0207661_100014029 230
389 3300025945 Ga0207679_10001195 Ga0207679_100011958 230
390 3300025960 Ga0207651_10046346 Ga0207651_100463461 230
391 3300025961 Ga0207712_10099599 Ga0207712_100995992 230
392 3300025972 Ga0207668_10032095 Ga0207668_100320952 230
393 3300025981 Ga0207640_10031145 Ga0207640_100311452 230
394 3300025986 Ga0207658_10086256 Ga0207658_100862561 230
395 3300025986 Ga0207658_10115829 Ga0207658_101158293 230
396 3300026023 Ga0207677_10032789 Ga0207677_100327892 230
397 3300026035 Ga0207703_10085693 Ga0207703_100856931 230
398 3300026041 Ga0207639_10018100 Ga0207639_100181004 230
399 3300026067 Ga0207678_10000516 Ga0207678_100005164 230
400 3300026075 Ga0207708_10065673 Ga0207708_100656732 230
401 3300026078 Ga0207702_10144586 Ga0207702_101445863 230
402 3300026088 Ga0207641_10000361 Ga0207641_1000036118 230
403 3300026089 Ga0207648_10001198 Ga0207648_1000119814 230
404 3300026095 Ga0207676_10000306 Ga0207676_1000030632 230
405 3300026116 Ga0207674_10000034 Ga0207674_1000003421 230
406 3300026121 Ga0207683_10060972 Ga0207683_100609723 230
407 3300026142 Ga0207698_10065806 Ga0207698_100658063 230
408 3300028380 Ga0268265_10078370 Ga0268265_100783704 230
409 3300028381 Ga0268264_10028356 Ga0268264_100283562 230
410 3300031711 Ga0265314_10028066 Ga0265314_100280663 230
411 3300048903 Ga0496100_0042812 Ga0496100_0042812_1700_2773 230
412 3300048905 Ga0496102_0011553 Ga0496102_0011553_1561_2691 230
413 3300048911 Ga0496108_0000038 Ga0496108_0000038_67998_69071 230
414 3300048912 Ga0496109_0000082 Ga0496109_0000082_72807_73880 230
415 3300048913 Ga0496110_0000617 Ga0496110_0000617_14112_15185 230
416 3300048914 Ga0496111_0004810 Ga0496111_0004810_5528_6601 230
417 3300048915 Ga0496112_0000220 Ga0496112_0000220_29595_30668 230
418 3300048915 Ga0496112_0129748 Ga0496112_0129748_475_1605 230
419 3300048916 Ga0496113_0002416 Ga0496113_0002416_4160_5233 230
420 3300048918 Ga0496115_0060059 Ga0496115_0060059_950_2023 230

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02470

MlaD

MlaD protein

67

154

0.9

Feature Viewer

pLDDT pTM Quality
68.36 0.47 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map