F439776

General Info

Members Datasets Scaffolds Average Seq Length
420 212 840 193

Family's Representative Sequence

Representative Sequence 3300035113|Ga0373936_0287543|Ga0373936_0287543_25_711
Length 228
Sequence LPTPPLAGHQWSKVLYCEASLLYFLAELNEFNNLGKGPGTMKVPYAKKWQKETDKLRQIALDGDLTEELKWGKPCFTFLKKNVAIVIPLKESCAFSFFKGALLKDPKHILQKIGQAQAGRWIKFTSPREIAAVQSTLKDYLYEAIALEKSGRRVVLKKPSDYPIPEELQRKLDDNAVLRSAFQTLTPGRRKSYIFHVSSAKQAKTRAARAEKCVPMILSGRGFNELPS

Samples

Sample ID Description Type Environment
1 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
90 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
91 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
138 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
139 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
140 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
141 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
142 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
143 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
144 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
145 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
146 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
147 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
148 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
149 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
150 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
151 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
152 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
153 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
154 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
155 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
156 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
157 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
158 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
159 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
160 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
161 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
162 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
163 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
164 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
165 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
166 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
167 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
168 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
169 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
170 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
171 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
172 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
173 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
174 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
175 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
176 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
177 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
178 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
179 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
180 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
181 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
194 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
195 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
196 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
197 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
198 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
199 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
200 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
201 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
202 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
203 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
204 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
205 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
207 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
208 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
209 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
210 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
211 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
212 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.67
Rhizosphere 94.76
Stem 0
Stem Tuber 0
Unclassified 25.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373936_0287543 3300035113 Unclassified 740
2 rootL2_10372676 3300003322 Bacteria 1059
3 rootH1_10230584 3300003323 Bacteria 2410
4 Ga0070658_10102300 3300005327 Bacteria 2369
5 Ga0070658_10477940 3300005327 Bacteria 1075
6 Ga0070683_100267385 3300005329 Unclassified 1626
7 Ga0070683_100547380 3300005329 Bacteria 1106
8 Ga0070690_100463539 3300005330 Unclassified 942
9 Ga0070670_100063387 3300005331 Bacteria 3172
10 Ga0070670_100417759 3300005331 Unclassified 1185
11 Ga0068869_100027562 3300005334 Bacteria 3962
12 Ga0070666_10126123 3300005335 Unclassified 1777
13 Ga0070680_100200931 3300005336 Bacteria 1681
14 Ga0070680_100974639 3300005336 Bacteria 732
15 Ga0070682_100195483 3300005337 Bacteria 1423
16 Ga0068868_100110678 3300005338 Bacteria 2231
17 Ga0070660_100011747 3300005339 Bacteria 6235
18 Ga0070660_100098024 3300005339 Bacteria 2320
19 Ga0070691_10180858 3300005341 Bacteria 1098
20 Ga0070661_100001452 3300005344 Bacteria 16450
21 Ga0070661_100007067 3300005344 Bacteria 7744
22 Ga0070661_100031221 3300005344 Unclassified 3851
23 Ga0070675_100115119 3300005354 Unclassified 2279
24 Ga0070671_100243679 3300005355 Bacteria 1526
25 Ga0070671_100244734 3300005355 Bacteria 1523
26 Ga0070671_100678828 3300005355 Bacteria 893
27 Ga0070659_100077391 3300005366 Bacteria 2653
28 Ga0070667_100338386 3300005367 Unclassified 1360
29 Ga0070714_100076876 3300005435 Bacteria 2899
30 Ga0070714_100614023 3300005435 Bacteria 1045
31 Ga0070714_101102382 3300005435 Bacteria 773
32 Ga0070713_100002052 3300005436 Bacteria 13018
33 Ga0070713_100434259 3300005436 Bacteria 1231
34 Ga0070713_100789638 3300005436 Bacteria 910
35 Ga0070713_101156305 3300005436 Unclassified 749
36 Ga0070711_100500610 3300005439 Unclassified 1001
37 Ga0070700_100652652 3300005441 Unclassified 831
38 Ga0070708_100083727 3300005445 Bacteria 2892
39 Ga0070708_100215575 3300005445 Unclassified 1799
40 Ga0070708_100302324 3300005445 Unclassified 1506
41 Ga0070681_10064516 3300005458 Bacteria 3632
42 Ga0068867_100275629 3300005459 Unclassified 1377
43 Ga0070685_10053453 3300005466 Unclassified 2340
44 Ga0070706_100058608 3300005467 Bacteria 3553
45 Ga0070707_100463142 3300005468 Bacteria 1229
46 Ga0070699_100036989 3300005518 Bacteria 4223
47 Ga0070699_100840006 3300005518 Bacteria 841
48 Ga0070679_100171689 3300005530 Bacteria 2141
49 Ga0070679_100460766 3300005530 Bacteria 1216
50 Ga0070684_100112059 3300005535 Bacteria 2447
51 Ga0070684_100215271 3300005535 Unclassified 1752
52 Ga0070684_100884676 3300005535 Bacteria 836
53 Ga0070697_100290803 3300005536 Bacteria 1403
54 Ga0070697_100598272 3300005536 Bacteria 969
55 Ga0068853_100000389 3300005539 Bacteria 30055
56 Ga0068853_100123756 3300005539 Bacteria 2309
57 Ga0070672_100041991 3300005543 Bacteria 3519
58 Ga0070696_100400970 3300005546 Bacteria 1073
59 Ga0070693_100123100 3300005547 Bacteria 1611
60 Ga0070693_100694033 3300005547 Unclassified 744
61 Ga0070665_100004179 3300005548 Bacteria 15183
62 Ga0070665_100067997 3300005548 Unclassified 3572
63 Ga0070704_100527562 3300005549 Unclassified 1029
64 Ga0068855_100008696 3300005563 Bacteria 12274
65 Ga0068855_100015423 3300005563 Bacteria 9198
66 Ga0068855_100017682 3300005563 Bacteria 8574
67 Ga0068855_100030773 3300005563 Bacteria 6417
68 Ga0068855_100060922 3300005563 Bacteria 4410
69 Ga0068855_100201727 3300005563 Bacteria 2239
70 Ga0068855_100829487 3300005563 Unclassified 981
71 Ga0068855_100990574 3300005563 Unclassified 884
72 Ga0070664_100036094 3300005564 Bacteria 4152
73 Ga0070664_100083092 3300005564 Bacteria 2763
74 Ga0070664_100284363 3300005564 Unclassified 1492
75 Ga0068857_100407776 3300005577 Bacteria 1265
76 Ga0068857_100719916 3300005577 Bacteria 949
77 Ga0068854_100045088 3300005578 Bacteria 3134
78 Ga0068856_100002276 3300005614 Bacteria 19807
79 Ga0068856_100016784 3300005614 Bacteria 7095
80 Ga0068856_100076325 3300005614 Bacteria 3320
81 Ga0068856_100308673 3300005614 Bacteria 1599
82 Ga0068856_100376043 3300005614 Bacteria 1439
83 Ga0068852_100000028 3300005616 Bacteria 113383
84 Ga0068852_100002690 3300005616 Bacteria 12278
85 Ga0068859_100177817 3300005617 Unclassified 2210
86 Ga0068864_100022314 3300005618 Bacteria 5307
87 Ga0068851_10117162 3300005834 Bacteria 1428
88 Ga0068863_100010471 3300005841 Bacteria 9014
89 Ga0068863_100056887 3300005841 Bacteria 3702
90 Ga0068858_100099497 3300005842 Bacteria 2711
91 Ga0068860_100019612 3300005843 Bacteria 6558
92 Ga0068862_100022170 3300005844 Bacteria 5314
93 Ga0081455_10340684 3300005937 Unclassified 1061
94 Ga0070717_10007402 3300006028 Bacteria 8151
95 Ga0070717_10012466 3300006028 Bacteria 6483
96 Ga0070717_10664374 3300006028 Bacteria 946
97 Ga0070717_10706193 3300006028 Unclassified 916
98 Ga0070716_100310498 3300006173 Bacteria 1101
99 Ga0097621_100002055 3300006237 Bacteria 13767
100 Ga0097621_100092902 3300006237 Unclassified 2528
101 Ga0097621_100971546 3300006237 Bacteria 794
102 Ga0068871_100036502 3300006358 Unclassified 3913
103 Ga0068871_100050640 3300006358 Bacteria 3360
104 Ga0068871_100088809 3300006358 Bacteria 2572
105 Ga0068871_100306399 3300006358 Unclassified 1395
106 Ga0068871_100316701 3300006358 Unclassified 1373
107 Ga0075434_100150743 3300006871 Bacteria 2346
108 Ga0075436_100140545 3300006914 Bacteria 1697
109 Ga0097620_100177829 3300006931 Unclassified 2210
110 Ga0075435_100690501 3300007076 Bacteria 887
111 Ga0099794_10134064 3300007265 Bacteria 1252
112 Ga0105240_10000499 3300009093 Bacteria 72315
113 Ga0105240_10011560 3300009093 Bacteria 12284
114 Ga0105240_10025804 3300009093 Bacteria 7717
115 Ga0105240_10029267 3300009093 Bacteria 7180
116 Ga0105240_10042942 3300009093 Bacteria 5759
117 Ga0105240_10065554 3300009093 Bacteria 4508
118 Ga0105240_10075115 3300009093 Bacteria 4169
119 Ga0105240_10302234 3300009093 Bacteria 1830
120 Ga0105240_10347954 3300009093 Bacteria 1682
121 Ga0105240_10743068 3300009093 Unclassified 1067
122 Ga0105240_10996396 3300009093 Unclassified 896
123 Ga0111539_11473703 3300009094 Bacteria 789
124 Ga0105245_10008733 3300009098 Bacteria 8837
125 Ga0114129_10357215 3300009147 Bacteria 1934
126 Ga0105241_10000162 3300009174 Bacteria 48662
127 Ga0105241_10007698 3300009174 Bacteria 7920
128 Ga0105241_10011464 3300009174 Bacteria 6498
129 Ga0105241_10174639 3300009174 Unclassified 1777
130 Ga0105241_10589132 3300009174 Unclassified 1003
131 Ga0105242_10033515 3300009176 Bacteria 4112
132 Ga0105242_10034813 3300009176 Bacteria 4038
133 Ga0105242_10071063 3300009176 Unclassified 2887
134 Ga0105248_10002940 3300009177 Bacteria 18909
135 Ga0105248_10017141 3300009177 Bacteria 7980
136 Ga0105248_10390656 3300009177 Bacteria 1566
137 Ga0105248_10582158 3300009177 Unclassified 1263
138 Ga0105248_10624089 3300009177 Unclassified 1216
139 Ga0105237_10001188 3300009545 Bacteria 34842
140 Ga0105237_10005789 3300009545 Bacteria 13875
141 Ga0105237_10139281 3300009545 Bacteria 2421
142 Ga0105238_10000373 3300009551 Bacteria 48142
143 Ga0105238_10004314 3300009551 Bacteria 14106
144 Ga0105238_10007350 3300009551 Bacteria 11029
145 Ga0105238_10042073 3300009551 Bacteria 4626
146 Ga0105238_10268114 3300009551 Unclassified 1688
147 Ga0105238_10348521 3300009551 Bacteria 1470
148 Ga0105238_10396355 3300009551 Bacteria 1373
149 Ga0105238_10561251 3300009551 Bacteria 1147
150 Ga0105249_10039288 3300009553 Bacteria 4296
151 Ga0105249_10088514 3300009553 Bacteria 2892
152 Ga0105249_10171754 3300009553 Bacteria 2103
153 Ga0099796_10279381 3300010159 Unclassified 702
154 Ga0105239_10000774 3300010375 Bacteria 45307
155 Ga0105239_10002768 3300010375 Bacteria 21990
156 Ga0105239_10370773 3300010375 Bacteria 1618
157 Ga0105239_10643758 3300010375 Bacteria 1210
158 Ga0105246_10003461 3300011119 Bacteria 9569
159 Ga0157373_10082873 3300013100 Bacteria 2260
160 Ga0157373_10204846 3300013100 Bacteria 1391
161 Ga0157373_10593866 3300013100 Bacteria 806
162 Ga0157373_10712214 3300013100 Bacteria 736
163 Ga0157370_10000551 3300013104 Bacteria 46757
164 Ga0157370_10064231 3300013104 Unclassified 3476
165 Ga0157370_10766484 3300013104 Unclassified 879
166 Ga0157369_10003839 3300013105 Bacteria 17854
167 Ga0157369_10007839 3300013105 Bacteria 12284
168 Ga0157369_10015425 3300013105 Bacteria 8611
169 Ga0157369_10030078 3300013105 Bacteria 5993
170 Ga0157369_10044951 3300013105 Unclassified 4805
171 Ga0157369_10108506 3300013105 Bacteria 2952
172 Ga0157369_10418142 3300013105 Bacteria 1390
173 Ga0157369_10853526 3300013105 Unclassified 935
174 Ga0157374_10016347 3300013296 Bacteria 6518
175 Ga0157374_10023970 3300013296 Bacteria 5465
176 Ga0157374_10074553 3300013296 Bacteria 3205
177 Ga0157374_10116240 3300013296 Unclassified 2577
178 Ga0157374_10708799 3300013296 Unclassified 1020
179 Ga0157378_10016783 3300013297 Bacteria 6416
180 Ga0157378_10032514 3300013297 Unclassified 4609
181 Ga0157378_10379873 3300013297 Bacteria 1387
182 Ga0163162_10024673 3300013306 Bacteria 5938
183 Ga0163162_10058550 3300013306 Unclassified 3882
184 Ga0163162_10141803 3300013306 Bacteria 2517
185 Ga0163162_10259429 3300013306 Bacteria 1870
186 Ga0157372_10005803 3300013307 Bacteria 13149
187 Ga0157372_10006668 3300013307 Bacteria 12284
188 Ga0157372_10010703 3300013307 Bacteria 9761
189 Ga0157372_10014027 3300013307 Bacteria 8562
190 Ga0157372_10047024 3300013307 Bacteria 4792
191 Ga0157372_10063009 3300013307 Bacteria 4156
192 Ga0157372_10116382 3300013307 Unclassified 3065
193 Ga0157372_10415637 3300013307 Bacteria 1567
194 Ga0157375_10214497 3300013308 Bacteria 2083
195 Ga0157375_10285207 3300013308 Unclassified 1814
196 Ga0163163_10017078 3300014325 Bacteria 6760
197 Ga0163163_10032735 3300014325 Bacteria 5023
198 Ga0157380_10810029 3300014326 Unclassified 954
199 Ga0157377_10033415 3300014745 Bacteria 2808
200 Ga0157379_10163555 3300014968 Bacteria 2009
201 Ga0157379_10788960 3300014968 Bacteria 896
202 Ga0157379_11327067 3300014968 Unclassified 695
203 Ga0157376_10045790 3300014969 Unclassified 3604
204 Ga0213874_10038429 3300021377 Bacteria 1421
205 Ga0213876_10100797 3300021384 Bacteria 1531
206 Ga0207692_10385213 3300025898 Bacteria 871
207 Ga0207710_10540326 3300025900 Bacteria 607
208 Ga0207680_10368433 3300025903 Bacteria 1011
209 Ga0207680_10733382 3300025903 Unclassified 708
210 Ga0207647_10102334 3300025904 Bacteria 1699
211 Ga0207699_10279718 3300025906 Unclassified 1159
212 Ga0207705_10137292 3300025909 Bacteria 1824
213 Ga0207684_10170016 3300025910 Bacteria 1879
214 Ga0207654_10000199 3300025911 Bacteria 37066
215 Ga0207654_10000895 3300025911 Bacteria 16506
216 Ga0207654_10068570 3300025911 Unclassified 2099
217 Ga0207654_10382050 3300025911 Unclassified 976
218 Ga0207654_10757775 3300025911 Unclassified 700
219 Ga0207707_10028131 3300025912 Bacteria 4914
220 Ga0207707_10079823 3300025912 Bacteria 2857
221 Ga0207695_10000140 3300025913 Bacteria 216271
222 Ga0207695_10000598 3300025913 Bacteria 72240
223 Ga0207695_10003747 3300025913 Bacteria 21137
224 Ga0207695_10006234 3300025913 Bacteria 15533
225 Ga0207695_10009144 3300025913 Bacteria 12296
226 Ga0207695_10027625 3300025913 Bacteria 6314
227 Ga0207695_10050325 3300025913 Bacteria 4384
228 Ga0207695_10059352 3300025913 Bacteria 3967
229 Ga0207695_10070209 3300025913 Bacteria 3582
230 Ga0207695_10244346 3300025913 Bacteria 1695
231 Ga0207671_10000238 3300025914 Bacteria 82806
232 Ga0207671_10021522 3300025914 Bacteria 4889
233 Ga0207671_10083537 3300025914 Bacteria 2397
234 Ga0207671_10208312 3300025914 Unclassified 1529
235 Ga0207693_10094815 3300025915 Unclassified 2339
236 Ga0207693_10398528 3300025915 Bacteria 1076
237 Ga0207663_10091672 3300025916 Bacteria 2018
238 Ga0207657_10016644 3300025919 Bacteria 7084
239 Ga0207657_10111521 3300025919 Bacteria 2258
240 Ga0207657_10148791 3300025919 Unclassified 1908
241 Ga0207649_10005989 3300025920 Bacteria 6600
242 Ga0207649_10010222 3300025920 Bacteria 5152
243 Ga0207649_10027404 3300025920 Bacteria 3342
244 Ga0207652_10093605 3300025921 Bacteria 2644
245 Ga0207652_10414776 3300025921 Unclassified 1214
246 Ga0207646_10531634 3300025922 Unclassified 1058
247 Ga0207646_10738136 3300025922 Bacteria 879
248 Ga0207694_10000089 3300025924 Bacteria 103520
249 Ga0207694_10010521 3300025924 Bacteria 6979
250 Ga0207694_10133418 3300025924 Bacteria 1992
251 Ga0207694_10408270 3300025924 Unclassified 1130
252 Ga0207650_10366431 3300025925 Unclassified 1188
253 Ga0207687_10049294 3300025927 Unclassified 2928
254 Ga0207687_10094432 3300025927 Bacteria 2189
255 Ga0207700_10007625 3300025928 Bacteria 6639
256 Ga0207700_11034987 3300025928 Bacteria 734
257 Ga0207664_10097944 3300025929 Bacteria 2417
258 Ga0207664_10207992 3300025929 Bacteria 1692
259 Ga0207644_10100681 3300025931 Bacteria 2170
260 Ga0207644_10555685 3300025931 Bacteria 950
261 Ga0207690_10080188 3300025932 Bacteria 2277
262 Ga0207690_10164842 3300025932 Bacteria 1655
263 Ga0207686_10172529 3300025934 Bacteria 1526
264 Ga0207709_10508780 3300025935 Unclassified 941
265 Ga0207665_10027767 3300025939 Bacteria 3739
266 Ga0207665_10177772 3300025939 Bacteria 1540
267 Ga0207665_10626344 3300025939 Bacteria 842
268 Ga0207711_10011350 3300025941 Bacteria 7401
269 Ga0207711_10276489 3300025941 Unclassified 1546
270 Ga0207711_10876909 3300025941 Unclassified 835
271 Ga0207689_10016215 3300025942 Bacteria 6310
272 Ga0207661_10420771 3300025944 Unclassified 1213
273 Ga0207661_10582042 3300025944 Bacteria 1027
274 Ga0207661_10762629 3300025944 Bacteria 891
275 Ga0207679_10117883 3300025945 Bacteria 2107
276 Ga0207667_10003663 3300025949 Bacteria 18947
277 Ga0207667_10015492 3300025949 Bacteria 8655
278 Ga0207667_10024692 3300025949 Bacteria 6593
279 Ga0207667_10268997 3300025949 Bacteria 1742
280 Ga0207667_10483402 3300025949 Unclassified 1257
281 Ga0207712_10149745 3300025961 Bacteria 1801
282 Ga0207640_10005029 3300025981 Bacteria 7193
283 Ga0207677_10117985 3300026023 Bacteria 1990
284 Ga0207703_10626090 3300026035 Unclassified 1019
285 Ga0207639_10000103 3300026041 Bacteria 70103
286 Ga0207639_10350905 3300026041 Bacteria 1318
287 Ga0207702_10000476 3300026078 Bacteria 45021
288 Ga0207702_10056874 3300026078 Bacteria 3322
289 Ga0207702_10082161 3300026078 Unclassified 2801
290 Ga0207702_10162907 3300026078 Bacteria 2038
291 Ga0207702_10217070 3300026078 Bacteria 1781
292 Ga0207641_10043481 3300026088 Bacteria 3773
293 Ga0207641_10189111 3300026088 Unclassified 1891
294 Ga0207641_10532668 3300026088 Bacteria 1144
295 Ga0207641_10966959 3300026088 Unclassified 847
296 Ga0207648_10195419 3300026089 Bacteria 1794
297 Ga0207674_10033118 3300026116 Bacteria 5411
298 Ga0207674_10257727 3300026116 Bacteria 1691
299 Ga0207683_11264264 3300026121 Unclassified 684
300 Ga0207698_10000384 3300026142 Bacteria 25551
301 Ga0207698_10000478 3300026142 Bacteria 23262
302 Ga0207698_10701802 3300026142 Bacteria 1007
303 Ga0207698_10705369 3300026142 Bacteria 1004
304 Ga0207698_10934886 3300026142 Bacteria 875
305 Ga0268266_10005700 3300028379 Bacteria 11547
306 Ga0268266_10009337 3300028379 Bacteria 8645
307 Ga0268266_10104666 3300028379 Unclassified 2499
308 Ga0268266_10422850 3300028379 Bacteria 1263
309 Ga0268265_10060108 3300028380 Bacteria 2911
310 Ga0268264_10002796 3300028381 Bacteria 15247
311 Ga0268264_10366970 3300028381 Bacteria 1375
312 Ga0265338_10005935 3300028800 Bacteria 15731
313 Ga0265330_10003108 3300031235 Bacteria 8790
314 Ga0265325_10014967 3300031241 Bacteria 4372
315 Ga0265340_10013862 3300031247 Bacteria 4224
316 Ga0265340_10033712 3300031247 Unclassified 2548
317 Ga0265339_10000115 3300031249 Bacteria 65607
318 Ga0265316_10000483 3300031344 Bacteria 45211
319 Ga0265316_10011046 3300031344 Bacteria 8183
320 Ga0265313_10014671 3300031595 Bacteria 4615
321 Ga0265314_10005286 3300031711 Bacteria 11686
322 Ga0265342_10003593 3300031712 Bacteria 12653
323 Ga0373934_0029018 3300035086 Bacteria 2159
324 Ga0373954_0002366 3300035118 Bacteria 7883
325 Ga0373937_0018848 3300036401 Bacteria 6170
326 Ga0373937_0131977 3300036401 Unclassified 2333
327 Ga0373937_0203395 3300036401 Unclassified 1862
328 Ga0373925_0509378 3300037068 Bacteria 988
329 Ga0395900_0988160 3300037418 Unclassified 762
330 Ga0395905_1033671 3300037471 Bacteria 725
331 Ga0436364_0431530 3300037853 Bacteria 1340
332 Ga0436364_0652936 3300037853 Bacteria 2313
333 Ga0436364_0664343 3300037853 Bacteria 1302
334 Ga0436364_0689426 3300037853 Unclassified 1623
335 Ga0436364_1409782 3300037853 Bacteria 1389
336 Ga0395901_0479660 3300038443 Bacteria 1269
337 Ga0436365_0840158 3300039437 Unclassified 1022
338 Ga0436365_1012460 3300039437 Bacteria 3299
339 Ga0436363_0548304 3300039450 Unclassified 2246
340 Ga0436363_0616505 3300039450 Bacteria 1041
341 Ga0436363_0928621 3300039450 Bacteria 1243
342 Ga0436363_1669288 3300039450 Bacteria 3169
343 Ga0436362_0502258 3300039453 Bacteria 1557
344 Ga0466969_0010407 3300044656 Bacteria 4931
345 Ga0466961_0073960 3300044693 Bacteria 2161
346 Ga0466961_0346133 3300044693 Unclassified 905
347 Ga0466959_0105907 3300045049 Unclassified 2011
348 Ga0466959_0112983 3300045049 Bacteria 1937
349 Ga0466959_0246305 3300045049 Bacteria 1233
350 Ga0466959_0288680 3300045049 Unclassified 1125
351 Ga0466967_0088177 3300045976 Bacteria 2815
352 Ga0466967_0794303 3300045976 Unclassified 940
353 Ga0466967_1003725 3300045976 Bacteria 831
354 Ga0495580_0148865 3300046472 Bacteria 1622
355 Ga0495580_0307649 3300046472 Bacteria 1078
356 Ga0495582_0168196 3300046473 Unclassified 1248
357 Ga0495664_0092329 3300046477 Bacteria 1821
358 Ga0495583_0015467 3300046506 Bacteria 4148
359 Ga0495630_0229486 3300046517 Bacteria 1418
360 Ga0495587_0087732 3300046536 Unclassified 1800
361 Ga0495645_0159360 3300046543 Unclassified 1561
362 Ga0495659_0190159 3300046664 Bacteria 839
363 Ga0495623_0146466 3300046679 Unclassified 1400
364 Ga0495669_0238500 3300046684 Bacteria 873
365 Ga0495649_0034599 3300046694 Bacteria 2780
366 Ga0495674_0210794 3300047319 Bacteria 1609
367 Ga0495680_0055464 3300047322 Unclassified 3074
368 Ga0495675_0067335 3300047444 Unclassified 2263
369 Ga0495602_0179302 3300048088 Bacteria 1636
370 Ga0496107_1002715 3300048910 Unclassified 606
371 Ga0496109_0639478 3300048912 Unclassified 1001
372 Ga0496112_0030904 3300048915 Bacteria 5189
373 Ga0496112_0129860 3300048915 Bacteria 2491
374 Ga0496112_0794540 3300048915 Unclassified 871
375 Ga0496113_0551288 3300048916 Unclassified 925
376 Ga0496115_0341216 3300048918 Bacteria 1223
377 Ga0501031_0069011 3300049568 Bacteria 2302
378 Ga0501032_0005694 3300049569 Bacteria 9227
379 Ga0501033_0016470 3300049570 Bacteria 5599
380 Ga0501034_0032539 3300049571 Bacteria 5294
381 Ga0501034_0107538 3300049571 Bacteria 2781
382 Ga0501036_0002362 3300049572 Bacteria 14758
383 Ga0501037_0098611 3300049573 Bacteria 2110
384 Ga0501037_0531684 3300049573 Unclassified 795
385 Ga0501038_0001714 3300049574 Bacteria 20367
386 Ga0501039_0026679 3300049575 Bacteria 4440
387 Ga0501043_0001558 3300049579 Bacteria 19956
388 Ga0501046_0017839 3300049580 Bacteria 5918
389 Ga0501046_0139341 3300049580 Bacteria 1837
390 Ga0501046_0556477 3300049580 Unclassified 817
391 Ga0501047_0030142 3300049581 Bacteria 5231
392 Ga0501047_0038439 3300049581 Bacteria 4630
393 Ga0501047_0073647 3300049581 Unclassified 3288
394 Ga0501048_0032174 3300049582 Bacteria 3792
395 Ga0501067_0003293 3300049583 Bacteria 8885
396 Ga0501068_0003742 3300049584 Bacteria 8229
397 Ga0501069_0001370 3300049585 Bacteria 11959
398 Ga0501070_0006167 3300049586 Bacteria 10216
399 Ga0501070_0065249 3300049586 Unclassified 3014
400 Ga0501070_0247561 3300049586 Unclassified 1458
401 Ga0501072_0437121 3300049588 Unclassified 1036
402 Ga0501073_0014857 3300049589 Bacteria 5650
403 Ga0501074_0016298 3300049590 Bacteria 5395
404 Ga0501076_0075402 3300049592 Bacteria 2703
405 Ga0501077_0038685 3300049593 Bacteria 3038
406 Ga0501079_0039504 3300049741 Bacteria 3639
407 Ga0501080_0002238 3300049742 Bacteria 16814
408 Ga0501083_0037014 3300049744 Bacteria 3325
409 Ga0501035_0093966 3300049822 Bacteria 2637
410 Ga0501044_0001033 3300049823 Bacteria 33524
411 Ga0501044_0015346 3300049823 Bacteria 8249
412 Ga0501044_0187134 3300049823 Bacteria 2035
413 nmdc:mga05p37_312819_c1 3300050507 Bacteria 1861
414 nmdc:mga08y16_1562744_c1 3300050511 Unclassified 618
415 nmdc:mga0n895_420573_c1 3300050512 Unclassified 1351
416 nmdc:mga0n895_994206_c1 3300050512 Bacteria 820
417 nmdc:mga08x19_37414_c1 3300050514 Bacteria 3079
418 nmdc:mga08x19_498157_c1 3300050514 Unclassified 860
419 Ga0495619_0222029 3300053085 Bacteria 1309
420 Ga0501082_0003190 3300060353 Bacteria 14302
421 Ga0373936_0287543
422 rootL2_10372676
423 rootH1_10230584
424 Ga0070658_10102300
425 Ga0070658_10477940
426 Ga0070683_100267385
427 Ga0070683_100547380
428 Ga0070690_100463539
429 Ga0070670_100063387
430 Ga0070670_100417759
431 Ga0068869_100027562
432 Ga0070666_10126123
433 Ga0070680_100200931
434 Ga0070680_100974639
435 Ga0070682_100195483
436 Ga0068868_100110678
437 Ga0070660_100011747
438 Ga0070660_100098024
439 Ga0070691_10180858
440 Ga0070661_100001452
441 Ga0070661_100007067
442 Ga0070661_100031221
443 Ga0070675_100115119
444 Ga0070671_100243679
445 Ga0070671_100244734
446 Ga0070671_100678828
447 Ga0070659_100077391
448 Ga0070667_100338386
449 Ga0070714_100076876
450 Ga0070714_100614023
451 Ga0070714_101102382
452 Ga0070713_100002052
453 Ga0070713_100434259
454 Ga0070713_100789638
455 Ga0070713_101156305
456 Ga0070711_100500610
457 Ga0070700_100652652
458 Ga0070708_100083727
459 Ga0070708_100215575
460 Ga0070708_100302324
461 Ga0070681_10064516
462 Ga0068867_100275629
463 Ga0070685_10053453
464 Ga0070706_100058608
465 Ga0070707_100463142
466 Ga0070699_100036989
467 Ga0070699_100840006
468 Ga0070679_100171689
469 Ga0070679_100460766
470 Ga0070684_100112059
471 Ga0070684_100215271
472 Ga0070684_100884676
473 Ga0070697_100290803
474 Ga0070697_100598272
475 Ga0068853_100000389
476 Ga0068853_100123756
477 Ga0070672_100041991
478 Ga0070696_100400970
479 Ga0070693_100123100
480 Ga0070693_100694033
481 Ga0070665_100004179
482 Ga0070665_100067997
483 Ga0070704_100527562
484 Ga0068855_100008696
485 Ga0068855_100015423
486 Ga0068855_100017682
487 Ga0068855_100030773
488 Ga0068855_100060922
489 Ga0068855_100201727
490 Ga0068855_100829487
491 Ga0068855_100990574
492 Ga0070664_100036094
493 Ga0070664_100083092
494 Ga0070664_100284363
495 Ga0068857_100407776
496 Ga0068857_100719916
497 Ga0068854_100045088
498 Ga0068856_100002276
499 Ga0068856_100016784
500 Ga0068856_100076325
501 Ga0068856_100308673
502 Ga0068856_100376043
503 Ga0068852_100000028
504 Ga0068852_100002690
505 Ga0068859_100177817
506 Ga0068864_100022314
507 Ga0068851_10117162
508 Ga0068863_100010471
509 Ga0068863_100056887
510 Ga0068858_100099497
511 Ga0068860_100019612
512 Ga0068862_100022170
513 Ga0081455_10340684
514 Ga0070717_10007402
515 Ga0070717_10012466
516 Ga0070717_10664374
517 Ga0070717_10706193
518 Ga0070716_100310498
519 Ga0097621_100002055
520 Ga0097621_100092902
521 Ga0097621_100971546
522 Ga0068871_100036502
523 Ga0068871_100050640
524 Ga0068871_100088809
525 Ga0068871_100306399
526 Ga0068871_100316701
527 Ga0075434_100150743
528 Ga0075436_100140545
529 Ga0097620_100177829
530 Ga0075435_100690501
531 Ga0099794_10134064
532 Ga0105240_10000499
533 Ga0105240_10011560
534 Ga0105240_10025804
535 Ga0105240_10029267
536 Ga0105240_10042942
537 Ga0105240_10065554
538 Ga0105240_10075115
539 Ga0105240_10302234
540 Ga0105240_10347954
541 Ga0105240_10743068
542 Ga0105240_10996396
543 Ga0111539_11473703
544 Ga0105245_10008733
545 Ga0114129_10357215
546 Ga0105241_10000162
547 Ga0105241_10007698
548 Ga0105241_10011464
549 Ga0105241_10174639
550 Ga0105241_10589132
551 Ga0105242_10033515
552 Ga0105242_10034813
553 Ga0105242_10071063
554 Ga0105248_10002940
555 Ga0105248_10017141
556 Ga0105248_10390656
557 Ga0105248_10582158
558 Ga0105248_10624089
559 Ga0105237_10001188
560 Ga0105237_10005789
561 Ga0105237_10139281
562 Ga0105238_10000373
563 Ga0105238_10004314
564 Ga0105238_10007350
565 Ga0105238_10042073
566 Ga0105238_10268114
567 Ga0105238_10348521
568 Ga0105238_10396355
569 Ga0105238_10561251
570 Ga0105249_10039288
571 Ga0105249_10088514
572 Ga0105249_10171754
573 Ga0099796_10279381
574 Ga0105239_10000774
575 Ga0105239_10002768
576 Ga0105239_10370773
577 Ga0105239_10643758
578 Ga0105246_10003461
579 Ga0157373_10082873
580 Ga0157373_10204846
581 Ga0157373_10593866
582 Ga0157373_10712214
583 Ga0157370_10000551
584 Ga0157370_10064231
585 Ga0157370_10766484
586 Ga0157369_10003839
587 Ga0157369_10007839
588 Ga0157369_10015425
589 Ga0157369_10030078
590 Ga0157369_10044951
591 Ga0157369_10108506
592 Ga0157369_10418142
593 Ga0157369_10853526
594 Ga0157374_10016347
595 Ga0157374_10023970
596 Ga0157374_10074553
597 Ga0157374_10116240
598 Ga0157374_10708799
599 Ga0157378_10016783
600 Ga0157378_10032514
601 Ga0157378_10379873
602 Ga0163162_10024673
603 Ga0163162_10058550
604 Ga0163162_10141803
605 Ga0163162_10259429
606 Ga0157372_10005803
607 Ga0157372_10006668
608 Ga0157372_10010703
609 Ga0157372_10014027
610 Ga0157372_10047024
611 Ga0157372_10063009
612 Ga0157372_10116382
613 Ga0157372_10415637
614 Ga0157375_10214497
615 Ga0157375_10285207
616 Ga0163163_10017078
617 Ga0163163_10032735
618 Ga0157380_10810029
619 Ga0157377_10033415
620 Ga0157379_10163555
621 Ga0157379_10788960
622 Ga0157379_11327067
623 Ga0157376_10045790
624 Ga0213874_10038429
625 Ga0213876_10100797
626 Ga0207692_10385213
627 Ga0207710_10540326
628 Ga0207680_10368433
629 Ga0207680_10733382
630 Ga0207647_10102334
631 Ga0207699_10279718
632 Ga0207705_10137292
633 Ga0207684_10170016
634 Ga0207654_10000199
635 Ga0207654_10000895
636 Ga0207654_10068570
637 Ga0207654_10382050
638 Ga0207654_10757775
639 Ga0207707_10028131
640 Ga0207707_10079823
641 Ga0207695_10000140
642 Ga0207695_10000598
643 Ga0207695_10003747
644 Ga0207695_10006234
645 Ga0207695_10009144
646 Ga0207695_10027625
647 Ga0207695_10050325
648 Ga0207695_10059352
649 Ga0207695_10070209
650 Ga0207695_10244346
651 Ga0207671_10000238
652 Ga0207671_10021522
653 Ga0207671_10083537
654 Ga0207671_10208312
655 Ga0207693_10094815
656 Ga0207693_10398528
657 Ga0207663_10091672
658 Ga0207657_10016644
659 Ga0207657_10111521
660 Ga0207657_10148791
661 Ga0207649_10005989
662 Ga0207649_10010222
663 Ga0207649_10027404
664 Ga0207652_10093605
665 Ga0207652_10414776
666 Ga0207646_10531634
667 Ga0207646_10738136
668 Ga0207694_10000089
669 Ga0207694_10010521
670 Ga0207694_10133418
671 Ga0207694_10408270
672 Ga0207650_10366431
673 Ga0207687_10049294
674 Ga0207687_10094432
675 Ga0207700_10007625
676 Ga0207700_11034987
677 Ga0207664_10097944
678 Ga0207664_10207992
679 Ga0207644_10100681
680 Ga0207644_10555685
681 Ga0207690_10080188
682 Ga0207690_10164842
683 Ga0207686_10172529
684 Ga0207709_10508780
685 Ga0207665_10027767
686 Ga0207665_10177772
687 Ga0207665_10626344
688 Ga0207711_10011350
689 Ga0207711_10276489
690 Ga0207711_10876909
691 Ga0207689_10016215
692 Ga0207661_10420771
693 Ga0207661_10582042
694 Ga0207661_10762629
695 Ga0207679_10117883
696 Ga0207667_10003663
697 Ga0207667_10015492
698 Ga0207667_10024692
699 Ga0207667_10268997
700 Ga0207667_10483402
701 Ga0207712_10149745
702 Ga0207640_10005029
703 Ga0207677_10117985
704 Ga0207703_10626090
705 Ga0207639_10000103
706 Ga0207639_10350905
707 Ga0207702_10000476
708 Ga0207702_10056874
709 Ga0207702_10082161
710 Ga0207702_10162907
711 Ga0207702_10217070
712 Ga0207641_10043481
713 Ga0207641_10189111
714 Ga0207641_10532668
715 Ga0207641_10966959
716 Ga0207648_10195419
717 Ga0207674_10033118
718 Ga0207674_10257727
719 Ga0207683_11264264
720 Ga0207698_10000384
721 Ga0207698_10000478
722 Ga0207698_10701802
723 Ga0207698_10705369
724 Ga0207698_10934886
725 Ga0268266_10005700
726 Ga0268266_10009337
727 Ga0268266_10104666
728 Ga0268266_10422850
729 Ga0268265_10060108
730 Ga0268264_10002796
731 Ga0268264_10366970
732 Ga0265338_10005935
733 Ga0265330_10003108
734 Ga0265325_10014967
735 Ga0265340_10013862
736 Ga0265340_10033712
737 Ga0265339_10000115
738 Ga0265316_10000483
739 Ga0265316_10011046
740 Ga0265313_10014671
741 Ga0265314_10005286
742 Ga0265342_10003593
743 Ga0373934_0029018
744 Ga0373954_0002366
745 Ga0373937_0018848
746 Ga0373937_0131977
747 Ga0373937_0203395
748 Ga0373925_0509378
749 Ga0395900_0988160
750 Ga0395905_1033671
751 Ga0436364_0431530
752 Ga0436364_0652936
753 Ga0436364_0664343
754 Ga0436364_0689426
755 Ga0436364_1409782
756 Ga0395901_0479660
757 Ga0436365_0840158
758 Ga0436365_1012460
759 Ga0436363_0548304
760 Ga0436363_0616505
761 Ga0436363_0928621
762 Ga0436363_1669288
763 Ga0436362_0502258
764 Ga0466969_0010407
765 Ga0466961_0073960
766 Ga0466961_0346133
767 Ga0466959_0105907
768 Ga0466959_0112983
769 Ga0466959_0246305
770 Ga0466959_0288680
771 Ga0466967_0088177
772 Ga0466967_0794303
773 Ga0466967_1003725
774 Ga0495580_0148865
775 Ga0495580_0307649
776 Ga0495582_0168196
777 Ga0495664_0092329
778 Ga0495583_0015467
779 Ga0495630_0229486
780 Ga0495587_0087732
781 Ga0495645_0159360
782 Ga0495659_0190159
783 Ga0495623_0146466
784 Ga0495669_0238500
785 Ga0495649_0034599
786 Ga0495674_0210794
787 Ga0495680_0055464
788 Ga0495675_0067335
789 Ga0495602_0179302
790 Ga0496107_1002715
791 Ga0496109_0639478
792 Ga0496112_0030904
793 Ga0496112_0129860
794 Ga0496112_0794540
795 Ga0496113_0551288
796 Ga0496115_0341216
797 Ga0501031_0069011
798 Ga0501032_0005694
799 Ga0501033_0016470
800 Ga0501034_0032539
801 Ga0501034_0107538
802 Ga0501036_0002362
803 Ga0501037_0098611
804 Ga0501037_0531684
805 Ga0501038_0001714
806 Ga0501039_0026679
807 Ga0501043_0001558
808 Ga0501046_0017839
809 Ga0501046_0139341
810 Ga0501046_0556477
811 Ga0501047_0030142
812 Ga0501047_0038439
813 Ga0501047_0073647
814 Ga0501048_0032174
815 Ga0501067_0003293
816 Ga0501068_0003742
817 Ga0501069_0001370
818 Ga0501070_0006167
819 Ga0501070_0065249
820 Ga0501070_0247561
821 Ga0501072_0437121
822 Ga0501073_0014857
823 Ga0501074_0016298
824 Ga0501076_0075402
825 Ga0501077_0038685
826 Ga0501079_0039504
827 Ga0501080_0002238
828 Ga0501083_0037014
829 Ga0501035_0093966
830 Ga0501044_0001033
831 Ga0501044_0015346
832 Ga0501044_0187134
833 nmdc:mga05p37_312819_c1
834 nmdc:mga08y16_1562744_c1
835 nmdc:mga0n895_420573_c1
836 nmdc:mga0n895_994206_c1
837 nmdc:mga08x19_37414_c1
838 nmdc:mga08x19_498157_c1
839 Ga0495619_0222029
840 Ga0501082_0003190

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08818

DUF1801

Domain of unknown function (DU1801)

49

145

0.97

PF13376

OmdA

Bacteriocin-protection, YdeI or OmpD-Associated

161

220

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2kl4-assembly1.cif.gz_A nmr structure of the protein nb7804a 0.5915 3 109
3s0h-assembly1.cif.gz_A the crystal structure of the periplasmic domain of helicobacter pylori motb (residues 90-256). 0.5825 44 65
2oc6-assembly2.cif.gz_B crystal structure of a protein from the duf1801 family (ydhg, bsu05750) from bacillus subtilis at 1.75 a resolution 0.5687 10 114
3ckg-assembly1.cif.gz_A the crystal structure of ospa deletion mutant 0.5592 25 94
6kwu-assembly1.cif.gz_O a crystal structure of ospa mutant 0.5558 25 94
ID Description Score Start End Superfamily
af_Q2FVG5_6_119_3.90.1150.200 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.9702 9 106 3.90.1150.200
af_Q2FVG5_6_119_3.90.1150.200 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.8299 9 106 3.90.1150.200
af_P0AAT2_2_121_3.90.1150.30 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.6924 10 114 3.90.1150.30
3swgA02 Alpha Beta;Alpha-beta prism;UDP-n-acetylglucosamine1-carboxyvinyl-transferase; Chain;Enolpyruvate transferase domain 0.6808 13 43 3.65.10.10
1dq3A02 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.6706 12 43 3.30.160.90
ID Description Score Start End GO Terms
AF-A0A3D3JG60-F1-model_v4 YdhG-like domain-containing protein 0.9887 9 119
AF-A0A316DEU9-F1-model_v4 Uncharacterized protein DUF1801 0.9887 7 101
AF-A0A7V9ZMH7-F1-model_v4 DUF1801 domain-containing protein 0.9846 6 119
AF-Q4A027-F1-model_v4 Uncharacterized protein 0.9842 125 186
AF-A0A5C7FL00-F1-model_v4 deleted 0.9822 23 108

Map