F439766

General Info

Members Datasets Scaffolds Average Seq Length
420 268 404 107

Family's Representative Sequence

Representative Sequence 3300031251|Ga0265327_10040151|Ga0265327_100401512
Length 116
Sequence MNETVNHLHDYGWTLWLIIIGMAAVTILNRAGFILLSGRFSLPPKVQRALKYAPAAALAAIAMPDIFTSHGHLDVSLENTRLIAGLFGFALAVLARSTMLAIIGGMLALHALQRWL

Samples

Sample ID Description Type Environment
1 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
2 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
3 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
4 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
5 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
6 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
7 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
8 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
9 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
10 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
11 2901300506 Cupriavidus sp. UYMSc13B Isolate Unclassified
12 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
13 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
14 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
15 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
16 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
17 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
18 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
19 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
20 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
21 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
22 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
23 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
24 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
25 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
26 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
27 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
28 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
29 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
30 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
31 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
45 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
46 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
47 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
48 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
49 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
50 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
53 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
54 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
55 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
68 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
74 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
75 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
76 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
77 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
79 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
80 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
81 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
82 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
83 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
98 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
99 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
101 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
102 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
103 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
104 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
105 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
106 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
107 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
108 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
109 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
110 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
111 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
112 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
113 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
114 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
115 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
116 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
117 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
118 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
119 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
120 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
121 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
122 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
123 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
124 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
125 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
126 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
127 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
128 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
129 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
130 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
131 3300044668 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3E2 Metagenome Unclassified
132 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
133 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
134 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
135 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
136 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
137 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
138 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
139 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
140 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
141 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
142 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
143 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
144 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
145 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
146 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
147 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
148 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
149 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
150 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
151 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
152 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
153 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
154 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
155 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
156 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
157 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
158 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
159 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
160 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
161 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
162 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
163 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
164 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
165 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
166 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
167 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
168 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
169 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
170 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
171 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
172 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
173 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
174 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
175 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
176 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
177 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
178 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
179 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
180 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
181 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
182 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
183 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
184 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
185 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
186 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
187 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
188 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
189 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
190 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
191 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
192 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
193 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
194 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
195 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
196 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
197 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
198 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
199 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
200 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
201 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
202 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
203 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
204 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
205 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
206 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
207 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
208 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
209 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
210 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
211 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
212 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
213 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
214 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
215 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
216 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
217 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
218 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
219 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
220 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
221 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
222 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
223 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
224 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
225 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
226 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
227 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
228 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
229 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
230 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
231 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
232 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
233 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
234 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
235 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
236 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
237 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
238 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
239 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
240 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
241 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
242 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
245 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
246 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
247 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
248 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
249 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
250 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
251 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
252 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
253 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
254 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
255 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
256 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
257 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
258 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
259 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
260 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
261 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
262 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
263 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
264 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
265 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
266 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
267 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
268 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.24
Metatranscriptomes 0.95
Isolates 3.81

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.14
Nodule 2.14
Rhizoplane 4.29
Rhizosphere 70.24
Stem 0
Stem Tuber 0
Unclassified 6.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10034611 3300001979 Bacteria 1590
2 JGI24735J21928_10007927 3300002067 Bacteria 3450
3 JGI25151J46595_10003613 3300003187 Bacteria 8458
4 JGI25151J46595_10004726 3300003187 Bacteria 7156
5 JGI25151J46595_10073052 3300003187 Bacteria 1029
6 rootH1_10024297 3300003316 Bacteria 1423
7 rootL2_10025745 3300003322 Bacteria 2563
8 JGI25160J50197_1000112 3300003354 Bacteria 76612
9 Ga0055526_1003944 3300003771 Bacteria 9160
10 Ga0055526_1007181 3300003771 Bacteria 5858
11 Ga0055526_1012310 3300003771 Bacteria 3748
12 Ga0055537_1028775 3300003773 Bacteria 733
13 Ga0055524_1000389 3300003775 Bacteria 37746
14 Ga0055524_1001221 3300003775 Bacteria 15208
15 Ga0055536_1000364 3300003781 Bacteria 33640
16 Ga0055534_1000181 3300003784 Bacteria 46083
17 Ga0055534_1001123 3300003784 Bacteria 11346
18 Ga0055534_1001595 3300003784 Bacteria 8797
19 Ga0055540_1068341 3300003792 Bacteria 697
20 Ga0065165_1000340 3300005262 Bacteria 76653
21 Ga0070658_10006150 3300005327 Bacteria 9732
22 Ga0070670_101619495 3300005331 Bacteria 595
23 Ga0070666_10038950 3300005335 Bacteria 3165
24 Ga0070682_100541377 3300005337 Bacteria 909
25 Ga0070660_100010801 3300005339 Bacteria 6463
26 Ga0070675_100245013 3300005354 Bacteria 1567
27 Ga0070659_100191022 3300005366 Bacteria 1683
28 Ga0070667_100023275 3300005367 Bacteria 5138
29 Ga0070663_100031835 3300005455 Bacteria 3629
30 Ga0070678_100252596 3300005456 Bacteria 1479
31 Ga0068867_102045025 3300005459 Bacteria 542
32 Ga0070672_100838089 3300005543 Bacteria 810
33 Ga0070665_100131205 3300005548 Bacteria 2508
34 Ga0068855_100002626 3300005563 Bacteria 22139
35 Ga0068857_100227177 3300005577 Bacteria 1706
36 Ga0068854_101213502 3300005578 Bacteria 676
37 Ga0068856_100253225 3300005614 Bacteria 1776
38 Ga0075365_10019253 3300006038 Bacteria 4211
39 Ga0075365_10747810 3300006038 Bacteria 690
40 Ga0075364_10000832 3300006051 Bacteria 16270
41 Ga0075364_10495335 3300006051 Bacteria 835
42 Ga0075362_10022330 3300006177 Bacteria 2665
43 Ga0075367_10202867 3300006178 Bacteria 1239
44 Ga0075367_10397481 3300006178 Bacteria 871
45 Ga0075367_10461236 3300006178 Bacteria 805
46 Ga0075369_10123434 3300006186 Bacteria 1173
47 Ga0075366_10138753 3300006195 Bacteria 1469
48 Ga0075366_10418340 3300006195 Bacteria 825
49 Ga0075366_10682028 3300006195 Bacteria 638
50 Ga0075370_10224519 3300006353 Bacteria 1110
51 Ga0075430_100227157 3300006846 Bacteria 1548
52 Ga0075430_100565157 3300006846 Bacteria 938
53 Ga0075436_100228090 3300006914 Bacteria 1323
54 Ga0099826_10000014 3300006948 Bacteria 258520
55 Ga0105251_10016758 3300009011 Bacteria 3948
56 Ga0105244_10088618 3300009036 Bacteria 1524
57 Ga0105240_10009465 3300009093 Bacteria 13794
58 Ga0105240_10458977 3300009093 Bacteria 1424
59 Ga0105245_10589769 3300009098 Bacteria 1137
60 Ga0105237_10017773 3300009545 Bacteria 7373
61 Ga0105237_10273960 3300009545 Bacteria 1690
62 Ga0105238_10386023 3300009551 Bacteria 1392
63 Ga0105238_10469070 3300009551 Bacteria 1257
64 Ga0157373_10007517 3300013100 Bacteria 8102
65 Ga0157370_10002724 3300013104 Bacteria 21137
66 Ga0157370_10008825 3300013104 Bacteria 10835
67 Ga0157370_10936573 3300013104 Bacteria 785
68 Ga0157369_10000082 3300013105 Bacteria 131859
69 Ga0157369_10002846 3300013105 Bacteria 20661
70 Ga0157374_10000172 3300013296 Bacteria 59888
71 Ga0163162_10049144 3300013306 Bacteria 4227
72 Ga0163162_10065770 3300013306 Bacteria 3673
73 Ga0163162_10901754 3300013306 Bacteria 997
74 Ga0157372_10026846 3300013307 Bacteria 6269
75 Ga0157372_10109568 3300013307 Bacteria 3162
76 Ga0157372_10700622 3300013307 Bacteria 1178
77 Ga0157375_10181728 3300013308 Bacteria 2255
78 Ga0182007_10152067 3300015262 Bacteria 787
79 Ga0206356_11508442 3300020070 Bacteria 6445
80 Ga0206354_11054812 3300020081 Bacteria 908
81 Ga0206353_11146855 3300020082 Bacteria 6336
82 Ga0224712_10001964 3300022467 Bacteria 4970
83 Ga0209672_105374 3300025228 Bacteria 2213
84 Ga0209759_1005991 3300025256 Bacteria 4151
85 Ga0209565_1000045 3300025263 Bacteria 226864
86 Ga0209565_1002216 3300025263 Bacteria 7277
87 Ga0209130_1007745 3300025284 Bacteria 3266
88 Ga0209675_1000173 3300025291 Bacteria 74892
89 Ga0209675_1000636 3300025291 Bacteria 24928
90 Ga0209675_1009241 3300025291 Bacteria 3501
91 Ga0209676_1000064 3300025292 Bacteria 321700
92 Ga0209025_1001692 3300025294 Bacteria 26926
93 Ga0209025_1004115 3300025294 Bacteria 12936
94 Ga0209025_1004326 3300025294 Bacteria 12410
95 Ga0209025_1024040 3300025294 Bacteria 3161
96 Ga0209564_1000107 3300025295 Bacteria 214040
97 Ga0209564_1000371 3300025295 Bacteria 83128
98 Ga0209564_1000741 3300025295 Bacteria 46301
99 Ga0209564_1004049 3300025295 Bacteria 9245
100 Ga0209758_1019063 3300025297 Bacteria 3331
101 Ga0209256_1000105 3300025299 Bacteria 188238
102 Ga0207426_1000007 3300025302 Bacteria 971011
103 Ga0209051_1007895 3300025303 Bacteria 5738
104 Ga0209051_1021412 3300025303 Bacteria 2754
105 Ga0207647_10002297 3300025904 Bacteria 14555
106 Ga0207705_10001073 3300025909 Bacteria 22198
107 Ga0207695_10022290 3300025913 Bacteria 7197
108 Ga0207695_10104659 3300025913 Bacteria 2818
109 Ga0207671_10069651 3300025914 Bacteria 2622
110 Ga0207671_11084397 3300025914 Bacteria 629
111 Ga0207657_10038281 3300025919 Bacteria 4271
112 Ga0207694_10194474 3300025924 Bacteria 1649
113 Ga0207694_10303232 3300025924 Bacteria 1315
114 Ga0207691_10862292 3300025940 Bacteria 759
115 Ga0207667_10003865 3300025949 Bacteria 18430
116 Ga0207667_10007418 3300025949 Bacteria 13179
117 Ga0207640_10230712 3300025981 Bacteria 1424
118 Ga0207640_10594761 3300025981 Bacteria 936
119 Ga0207658_10053787 3300025986 Bacteria 2976
120 Ga0207678_10081680 3300026067 Bacteria 2766
121 Ga0207678_10264628 3300026067 Bacteria 1474
122 Ga0207674_10285958 3300026116 Bacteria 1597
123 Ga0207683_10312175 3300026121 Bacteria 1439
124 Ga0209282_1000046 3300027666 Bacteria 115032
125 Ga0209813_10110058 3300027866 Bacteria 948
126 Ga0268266_11305045 3300028379 Bacteria 701
127 Ga0265338_10001025 3300028800 Bacteria 46870
128 Ga0307511_10000164 3300030521 Bacteria 64605
129 Ga0265327_10040151 3300031251 Bacteria 2534
130 Ga0307507_10042982 3300033179 Bacteria 4492
131 Ga0307507_10450255 3300033179 Bacteria 711
132 Ga0373934_0051845 3300035086 Bacteria 1626
133 Ga0373923_0002682 3300035111 Bacteria 5539
134 Ga0373936_0059745 3300035113 Bacteria 1554
135 Ga0373953_0101584 3300035117 Bacteria 1210
136 Ga0373953_0486829 3300035117 Bacteria 546
137 Ga0373954_0008978 3300035118 Bacteria 4399
138 Ga0373954_0047844 3300035118 Bacteria 2002
139 Ga0373956_0008632 3300035119 Bacteria 4126
140 Ga0373956_0071684 3300035119 Bacteria 1581
141 Ga0373957_0036366 3300035120 Bacteria 1834
142 Ga0373943_0352386 3300035170 Bacteria 844
143 Ga0373946_0042931 3300035171 Bacteria 1861
144 Ga0373946_0050470 3300035171 Bacteria 1738
145 Ga0373955_0005786 3300035172 Bacteria 5581
146 Ga0373924_0035048 3300035410 Bacteria 2034
147 Ga0373927_0352462 3300035695 Bacteria 970
148 Ga0373933_0024054 3300035724 Bacteria 3486
149 Ga0373933_0029163 3300035724 Bacteria 3188
150 Ga0373947_0211549 3300035725 Bacteria 1272
151 Ga0373937_0070882 3300036401 Bacteria 3214
152 Ga0373925_0050845 3300037068 Bacteria 3092
153 Ga0395899_0000054 3300037312 Bacteria 220952
154 Ga0395899_0002578 3300037312 Bacteria 14617
155 Ga0395899_0006220 3300037312 Bacteria 9252
156 Ga0395899_0062199 3300037312 Bacteria 2749
157 Ga0395900_0000385 3300037418 Bacteria 63693
158 Ga0395900_0000649 3300037418 Bacteria 46581
159 Ga0395900_0015192 3300037418 Bacteria 7851
160 Ga0395900_0125798 3300037418 Bacteria 2629
161 Ga0395900_0236029 3300037418 Bacteria 1837
162 Ga0395900_0269969 3300037418 Bacteria 1696
163 Ga0395898_0000543 3300037466 Bacteria 71571
164 Ga0395898_0017854 3300037466 Bacteria 7238
165 Ga0395898_0042811 3300037466 Bacteria 4465
166 Ga0395898_0063621 3300037466 Bacteria 3579
167 Ga0395898_0229766 3300037466 Bacteria 1769
168 Ga0395905_0000014 3300037471 Bacteria 394209
169 Ga0395905_0000137 3300037471 Bacteria 120800
170 Ga0395901_0000002 3300038443 Bacteria 761045
171 Ga0395901_0002292 3300038443 Bacteria 19510
172 Ga0395901_0017195 3300038443 Bacteria 7378
173 Ga0395901_0020360 3300038443 Bacteria 6791
174 Ga0395901_0619146 3300038443 Bacteria 1089
175 Ga0395901_1567210 3300038443 Bacteria 613
176 Ga0439448_0012557 3300042005 Bacteria 2536
177 Ga0439452_010847 3300042010 Bacteria 2636
178 Ga0451577_0017016 3300042876 Bacteria 6725
179 Ga0451577_0110548 3300042876 Bacteria 2458
180 Ga0451577_0319856 3300042876 Bacteria 1407
181 Ga0451577_1770473 3300042876 Bacteria 543
182 Ga0466969_0000237 3300044656 Bacteria 30147
183 Ga0466969_0001232 3300044656 Bacteria 13838
184 Ga0466969_0077038 3300044656 Bacteria 1596
185 Ga0466972_0019589 3300044658 Bacteria 3383
186 Ga0466972_0198268 3300044658 Bacteria 940
187 Ga0466977_0000209 3300044666 Bacteria 15652
188 Ga0466980_0376830 3300044668 Bacteria 812
189 Ga0466982_0654966 3300044672 Bacteria 508
190 Ga0453683_0043317 3300044673 Bacteria 2824
191 Ga0466965_0000444 3300044683 Bacteria 14483
192 Ga0466965_0001636 3300044683 Bacteria 9170
193 Ga0466966_0000442 3300044684 Bacteria 26621
194 Ga0466966_0003107 3300044684 Bacteria 10930
195 Ga0466966_0017258 3300044684 Bacteria 4771
196 Ga0466966_0017829 3300044684 Bacteria 4688
197 Ga0466961_0000936 3300044693 Bacteria 18087
198 Ga0466961_0170023 3300044693 Bacteria 1356
199 Ga0466961_0379573 3300044693 Bacteria 858
200 Ga0466961_0476067 3300044693 Bacteria 755
201 Ga0466963_0000429 3300044694 Bacteria 19369
202 Ga0466963_0025077 3300044694 Bacteria 3800
203 Ga0466963_0115266 3300044694 Bacteria 1846
204 Ga0466964_0000529 3300044706 Bacteria 11961
205 Ga0466971_0065953 3300044719 Bacteria 1639
206 Ga0466971_0091606 3300044719 Bacteria 1392
207 Ga0466968_0020302 3300044735 Bacteria 2681
208 Ga0466970_0002091 3300044765 Bacteria 9650
209 Ga0466970_0012657 3300044765 Bacteria 4316
210 Ga0466970_0045423 3300044765 Bacteria 2339
211 Ga0466957_0001502 3300044842 Bacteria 12244
212 Ga0466957_0004954 3300044842 Bacteria 7452
213 Ga0466957_0016889 3300044842 Bacteria 4270
214 Ga0466959_0003441 3300045049 Bacteria 10356
215 Ga0466959_0010052 3300045049 Bacteria 6744
216 Ga0466959_0010986 3300045049 Bacteria 6498
217 Ga0451576_0002586 3300045051 Bacteria 26626
218 Ga0451576_0081743 3300045051 Bacteria 3360
219 Ga0451576_0310980 3300045051 Bacteria 1648
220 Ga0466958_0000768 3300045836 Bacteria 14105
221 Ga0466958_0012422 3300045836 Bacteria 4825
222 Ga0466958_0029761 3300045836 Bacteria 3240
223 Ga0466958_0075996 3300045836 Bacteria 2061
224 Ga0466967_0525581 3300045976 Bacteria 1163
225 Ga0466967_0917793 3300045976 Bacteria 871
226 Ga0495592_0063576 3300046454 Bacteria 2706
227 Ga0495603_0017797 3300046455 Bacteria 4301
228 Ga0495590_0055450 3300046457 Bacteria 1385
229 Ga0495590_0416301 3300046457 Bacteria 517
230 Ga0495591_054586 3300046458 Bacteria 1080
231 Ga0495591_146498 3300046458 Bacteria 568
232 Ga0495629_0109446 3300046459 Bacteria 1927
233 Ga0495629_0117879 3300046459 Bacteria 1850
234 Ga0495638_0005247 3300046460 Bacteria 9676
235 Ga0495641_0009923 3300046461 Bacteria 5599
236 Ga0495651_0087335 3300046462 Bacteria 2345
237 Ga0495653_0012794 3300046463 Bacteria 6850
238 Ga0495650_0058562 3300046471 Bacteria 1554
239 Ga0495650_0083945 3300046471 Bacteria 1223
240 Ga0495580_0027968 3300046472 Bacteria 4101
241 Ga0495580_0040063 3300046472 Bacteria 3349
242 Ga0495582_0033349 3300046473 Bacteria 2830
243 Ga0495605_0000422 3300046474 Bacteria 38537
244 Ga0495605_0005590 3300046474 Bacteria 7306
245 Ga0495605_0482690 3300046474 Bacteria 508
246 Ga0495639_0007851 3300046475 Bacteria 4586
247 Ga0495662_0321494 3300046476 Bacteria 761
248 Ga0495664_0023255 3300046477 Bacteria 3596
249 Ga0495664_0134451 3300046477 Bacteria 1498
250 Ga0495664_0182004 3300046477 Bacteria 1274
251 Ga0495664_0196414 3300046477 Bacteria 1223
252 Ga0495664_0394010 3300046477 Bacteria 832
253 Ga0495585_0110965 3300046492 Bacteria 1458
254 Ga0495596_0001679 3300046500 Bacteria 12542
255 Ga0495596_0104612 3300046500 Bacteria 1099
256 Ga0495607_0003440 3300046501 Bacteria 12119
257 Ga0495583_0386679 3300046506 Bacteria 550
258 Ga0495606_0080793 3300046507 Bacteria 2022
259 Ga0495606_0167329 3300046507 Bacteria 1278
260 Ga0495610_0001001 3300046512 Bacteria 26052
261 Ga0495616_0003844 3300046513 Bacteria 9572
262 Ga0495616_0183349 3300046513 Bacteria 929
263 Ga0495618_0022162 3300046514 Bacteria 3921
264 Ga0495618_0080204 3300046514 Bacteria 2082
265 Ga0495620_0245320 3300046515 Bacteria 683
266 Ga0495628_0003566 3300046516 Bacteria 13932
267 Ga0495628_0019735 3300046516 Bacteria 5569
268 Ga0495628_0031809 3300046516 Bacteria 4265
269 Ga0495630_0026867 3300046517 Bacteria 4264
270 Ga0495630_0067509 3300046517 Bacteria 2688
271 Ga0495630_0738378 3300046517 Bacteria 753
272 Ga0495631_0023982 3300046518 Bacteria 2822
273 Ga0495632_0194669 3300046519 Bacteria 925
274 Ga0495643_0197890 3300046522 Bacteria 966
275 Ga0495644_0022344 3300046523 Bacteria 2411
276 Ga0495648_0016915 3300046524 Bacteria 5240
277 Ga0495648_0330068 3300046524 Bacteria 704
278 Ga0495666_0013043 3300046526 Bacteria 4141
279 Ga0495666_0112453 3300046526 Bacteria 1278
280 Ga0495642_0310638 3300046528 Bacteria 691
281 Ga0495665_0014995 3300046531 Bacteria 4176
282 Ga0495640_0519460 3300046533 Unclassified 723
283 Ga0495586_0091456 3300046535 Bacteria 1681
284 Ga0495586_0179167 3300046535 Bacteria 1198
285 Ga0495587_0038751 3300046536 Bacteria 2855
286 Ga0495587_0065076 3300046536 Bacteria 2129
287 Ga0495609_0000524 3300046538 Bacteria 30733
288 Ga0495597_0196429 3300046542 Bacteria 809
289 Ga0495645_0119399 3300046543 Bacteria 1858
290 Ga0495622_0044715 3300046557 Bacteria 2058
291 Ga0495667_0042082 3300046559 Bacteria 3028
292 Ga0495667_0079519 3300046559 Bacteria 2131
293 Ga0495667_0610454 3300046559 Bacteria 679
294 Ga0495634_0021471 3300046642 Bacteria 4562
295 Ga0495611_0444915 3300046648 Bacteria 591
296 Ga0495625_0163464 3300046660 Bacteria 1490
297 Ga0495635_0121622 3300046663 Bacteria 1780
298 Ga0495661_0019306 3300046665 Bacteria 4469
299 Ga0495588_0346687 3300046674 Bacteria 781
300 Ga0495657_0027402 3300046675 Bacteria 4021
301 Ga0495599_0010345 3300046678 Bacteria 5704
302 Ga0495658_0026558 3300046683 Bacteria 3104
303 Ga0495669_0040943 3300046684 Bacteria 2056
304 Ga0495613_0099524 3300046689 Bacteria 2100
305 Ga0495624_0091868 3300046690 Bacteria 1872
306 Ga0495670_0233298 3300046691 Bacteria 979
307 Ga0495671_0001453 3300046692 Bacteria 15919
308 Ga0495671_0072176 3300046692 Bacteria 1695
309 Ga0495649_0008824 3300046694 Bacteria 6040
310 Ga0495649_0220626 3300046694 Bacteria 981
311 Ga0495589_0004090 3300046794 Bacteria 7810
312 Ga0495589_0189900 3300046794 Bacteria 972
313 Ga0495600_0045435 3300046809 Bacteria 2865
314 Ga0495600_0214552 3300046809 Bacteria 1232
315 Ga0495660_0461833 3300046810 Bacteria 547
316 Ga0495604_0026527 3300047317 Bacteria 4611
317 Ga0495604_0032566 3300047317 Bacteria 4130
318 Ga0495604_0061193 3300047317 Bacteria 2880
319 Ga0495636_0034382 3300047318 Bacteria 2086
320 Ga0495674_0020602 3300047319 Bacteria 6104
321 Ga0495674_1308057 3300047319 Bacteria 544
322 Ga0495672_0014552 3300047320 Bacteria 5381
323 Ga0495672_0015652 3300047320 Bacteria 5141
324 Ga0495680_0083263 3300047322 Bacteria 2412
325 Ga0495680_0090862 3300047322 Bacteria 2289
326 Ga0495683_0249650 3300047323 Bacteria 779
327 Ga0495687_028381 3300047443 Bacteria 2604
328 Ga0495675_0009018 3300047444 Bacteria 6202
329 Ga0495675_0526721 3300047444 Bacteria 676
330 Ga0495685_019436 3300047447 Bacteria 2334
331 Ga0495685_154333 3300047447 Bacteria 745
332 Ga0495673_0125219 3300047469 Bacteria 1014
333 Ga0495673_0129394 3300047469 Bacteria 993
334 Ga0495681_0168673 3300047470 Bacteria 907
335 Ga0495681_0183963 3300047470 Bacteria 857
336 Ga0495684_0064571 3300047471 Bacteria 2782
337 Ga0495684_0108306 3300047471 Bacteria 2098
338 Ga0495686_0000014 3300047472 Bacteria 474014
339 Ga0495686_0366286 3300047472 Bacteria 780
340 Ga0495626_0181021 3300048091 Bacteria 873
341 Ga0496100_0059425 3300048903 Bacteria 2512
342 Ga0496100_0336556 3300048903 Bacteria 1137
343 Ga0496101_0039917 3300048904 Bacteria 3341
344 Ga0496102_0015471 3300048905 Bacteria 6645
345 Ga0496102_0045523 3300048905 Bacteria 3984
346 Ga0496102_0139052 3300048905 Bacteria 2276
347 Ga0496102_0263779 3300048905 Bacteria 1624
348 Ga0496102_1404496 3300048905 Bacteria 617
349 Ga0496103_0160675 3300048906 Bacteria 1441
350 Ga0496103_0227871 3300048906 Bacteria 1198
351 Ga0496104_0283603 3300048907 Bacteria 1569
352 Ga0496104_0477215 3300048907 Bacteria 1158
353 Ga0496105_0136791 3300048908 Bacteria 2018
354 Ga0496106_0314591 3300048909 Bacteria 1256
355 Ga0496107_0152457 3300048910 Bacteria 1710
356 Ga0496110_0312153 3300048913 Bacteria 1432
357 Ga0496111_1144762 3300048914 Bacteria 553
358 Ga0496115_0052691 3300048918 Bacteria 3265
359 Ga0496116_0009751 3300048919 Bacteria 8149
360 Ga0496116_0024793 3300048919 Bacteria 4424
361 Ga0496117_0001040 3300048920 Bacteria 42312
362 Ga0496117_0002732 3300048920 Bacteria 21662
363 Ga0496118_0004247 3300048921 Bacteria 17157
364 Ga0496118_0018848 3300048921 Bacteria 6194
365 Ga0496118_0303073 3300048921 Bacteria 876
366 Ga0496121_0040766 3300048924 Bacteria 4068
367 Ga0496122_0007114 3300048925 Bacteria 12563
368 Ga0496123_0001999 3300048926 Bacteria 26345
369 Ga0496125_0132265 3300048928 Bacteria 1754
370 Ga0496126_0000061 3300048929 Bacteria 261515
371 Ga0495678_220413 3300049459 Bacteria 576
372 Ga0501033_1207403 3300049570 Bacteria 501
373 Ga0501034_0000911 3300049571 Bacteria 43146
374 Ga0501043_0664276 3300049579 Bacteria 764
375 nmdc:mga03n38_164416_c1 3300050490 Bacteria 1126
376 nmdc:mga00v17_3442_c1 3300050491 Bacteria 8183
377 nmdc:mga00v17_372316_c2 3300050491 Bacteria 566
378 nmdc:mga00v17_442919_c1 3300050491 Bacteria 844
379 nmdc:mga0yw44_23247_c1 3300050492 Bacteria 3489
380 nmdc:mga0yw44_26411_c1 3300050492 Bacteria 3317
381 nmdc:mga0k408_349643_c1 3300050493 Bacteria 881
382 nmdc:mga0k408_70965_c1 3300050493 Bacteria 2033
383 nmdc:mga06z11_352543_c1 3300050494 Bacteria 881
384 nmdc:mga06z11_618147_c1 3300050494 Unclassified 659
385 nmdc:mga04h51_84129_c1 3300050495 Bacteria 1134
386 nmdc:mga07m45_261495_c1 3300050496 Bacteria 1007
387 nmdc:mga07m45_479414_c1 3300050496 Unclassified 721
388 nmdc:mga0qj67_654531_c1 3300050509 Bacteria 838
389 Ga0495601_0001984 3300053077 Bacteria 11454
390 Ga0495612_0329930 3300053078 Bacteria 687
391 Ga0495595_0114256 3300053084 Bacteria 1311
392 Ga0495619_0019392 3300053085 Bacteria 4322
393 Ga0495619_0065013 3300053085 Bacteria 2433
394 Ga0500646_0006962 3300053090 Bacteria 2882
395 Ga0500583_0031196 3300053092 Bacteria 2340
396 Ga0500555_041105 3300053103 Bacteria 1287
397 Ga0500655_019887 3300053133 Bacteria 1252
398 Ga0500577_0287551 3300053142 Bacteria 717
399 Ga0500604_0007226 3300053151 Bacteria 2942
400 Ga0500636_0179015 3300053177 Bacteria 1140
401 Ga0500637_0088194 3300053178 Bacteria 1795
402 Ga0466962_0003409 3300061719 Bacteria 7569
403 Ga0466962_0004598 3300061719 Bacteria 6619
404 Ga0466962_0389898 3300061719 Bacteria 696

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2884811622 2884812362 86
2 3300003187 JGI25151J46595_10004726 JGI25151J46595_100047265 93
3 3300025294 Ga0209025_1004115 Ga0209025_10041157 93
4 3300025297 Ga0209758_1019063 Ga0209758_10190633 93
5 3300047320 Ga0495672_0014552 Ga0495672_0014552_5059_5346 95
6 3300025909 Ga0207705_10001073 Ga0207705_1000107318 96
7 3300006051 Ga0075364_10000832 Ga0075364_1000083214 101
8 3300050491 nmdc:mga00v17_3442_c1 nmdc:mga00v17_3442_c1_761_1087 101
9 3300042876 Ga0451577_0319856 Ga0451577_0319856_566_883 103
10 iso_pu_bacteria 2513237150 2513954070 103
11 iso_pu_bacteria 2513237165 2514040197 103
12 iso_pu_bacteria 2513237166 2514047467 103
13 iso_pu_bacteria 2515154123 2515689566 103
14 iso_pu_bacteria 2791355137 2792839527 103
15 iso_pu_bacteria 2834641062 2834645389 103
16 iso_pu_bacteria 2901300506 2901305022 103
17 iso_pu_bacteria 2904615490 2904620541 103
18 iso_pu_bacteria 2921643360 2921646307 103
19 iso_pu_bacteria 642555112 642592222 103
20 iso_pu_bacteria 644736347 644746859 103
21 iso_pu_bacteria 8003400568 8003400599 103
22 3300009551 Ga0105238_10386023 Ga0105238_103860231 104
23 3300013104 Ga0157370_10936573 Ga0157370_109365732 104
24 3300035086 Ga0373934_0051845 Ga0373934_0051845_55_369 104
25 3300035111 Ga0373923_0002682 Ga0373923_0002682_3173_3487 104
26 3300035113 Ga0373936_0059745 Ga0373936_0059745_446_760 104
27 3300035117 Ga0373953_0101584 Ga0373953_0101584_156_470 104
28 3300035117 Ga0373953_0486829 Ga0373953_0486829_44_358 104
29 3300035118 Ga0373954_0008978 Ga0373954_0008978_655_969 104
30 3300035118 Ga0373954_0047844 Ga0373954_0047844_356_670 104
31 3300035119 Ga0373956_0008632 Ga0373956_0008632_936_1250 104
32 3300035119 Ga0373956_0071684 Ga0373956_0071684_469_783 104
33 3300035120 Ga0373957_0036366 Ga0373957_0036366_562_876 104
34 3300035170 Ga0373943_0352386 Ga0373943_0352386_500_814 104
35 3300035171 Ga0373946_0042931 Ga0373946_0042931_1526_1840 104
36 3300035172 Ga0373955_0005786 Ga0373955_0005786_565_879 104
37 3300035410 Ga0373924_0035048 Ga0373924_0035048_675_989 104
38 3300035695 Ga0373927_0352462 Ga0373927_0352462_269_583 104
39 3300035724 Ga0373933_0024054 Ga0373933_0024054_120_434 104
40 3300035724 Ga0373933_0029163 Ga0373933_0029163_2055_2369 104
41 3300035725 Ga0373947_0211549 Ga0373947_0211549_24_338 104
42 3300036401 Ga0373937_0070882 Ga0373937_0070882_845_1159 104
43 3300037068 Ga0373925_0050845 Ga0373925_0050845_2160_2474 104
44 3300037312 Ga0395899_0000054 Ga0395899_0000054_201590_201904 104
45 3300037418 Ga0395900_0000649 Ga0395900_0000649_19048_19362 104
46 3300037466 Ga0395898_0000543 Ga0395898_0000543_68907_69221 104
47 3300038443 Ga0395901_0000002 Ga0395901_0000002_309787_310101 104
48 3300046454 Ga0495592_0063576 Ga0495592_0063576_2369_2683 104
49 3300046459 Ga0495629_0117879 Ga0495629_0117879_1354_1668 104
50 3300046461 Ga0495641_0009923 Ga0495641_0009923_2588_2902 104
51 3300046462 Ga0495651_0087335 Ga0495651_0087335_1620_1934 104
52 3300046463 Ga0495653_0012794 Ga0495653_0012794_5531_5845 104
53 3300046472 Ga0495580_0040063 Ga0495580_0040063_2511_2825 104
54 3300046473 Ga0495582_0033349 Ga0495582_0033349_296_610 104
55 3300046475 Ga0495639_0007851 Ga0495639_0007851_3853_4167 104
56 3300046476 Ga0495662_0321494 Ga0495662_0321494_258_572 104
57 3300046477 Ga0495664_0023255 Ga0495664_0023255_1111_1425 104
58 3300046477 Ga0495664_0134451 Ga0495664_0134451_92_406 104
59 3300046477 Ga0495664_0394010 Ga0495664_0394010_431_745 104
60 3300046514 Ga0495618_0022162 Ga0495618_0022162_1550_1864 104
61 3300046514 Ga0495618_0080204 Ga0495618_0080204_676_990 104
62 3300046516 Ga0495628_0003566 Ga0495628_0003566_6251_6565 104
63 3300046516 Ga0495628_0019735 Ga0495628_0019735_3985_4299 104
64 3300046517 Ga0495630_0026867 Ga0495630_0026867_1021_1335 104
65 3300046517 Ga0495630_0067509 Ga0495630_0067509_2037_2351 104
66 3300046526 Ga0495666_0112453 Ga0495666_0112453_942_1256 104
67 3300046531 Ga0495665_0014995 Ga0495665_0014995_3431_3745 104
68 3300046533 Ga0495640_0519460 Ga0495640_0519460_120_434 104
69 3300046535 Ga0495586_0091456 Ga0495586_0091456_979_1293 104
70 3300046535 Ga0495586_0179167 Ga0495586_0179167_437_751 104
71 3300046536 Ga0495587_0038751 Ga0495587_0038751_581_895 104
72 3300046536 Ga0495587_0065076 Ga0495587_0065076_558_872 104
73 3300046543 Ga0495645_0119399 Ga0495645_0119399_372_686 104
74 3300046557 Ga0495622_0044715 Ga0495622_0044715_154_468 104
75 3300046559 Ga0495667_0042082 Ga0495667_0042082_1320_1634 104
76 3300046642 Ga0495634_0021471 Ga0495634_0021471_436_750 104
77 3300046663 Ga0495635_0121622 Ga0495635_0121622_478_792 104
78 3300046675 Ga0495657_0027402 Ga0495657_0027402_3316_3630 104
79 3300046678 Ga0495599_0010345 Ga0495599_0010345_4002_4316 104
80 3300046683 Ga0495658_0026558 Ga0495658_0026558_165_479 104
81 3300046689 Ga0495613_0099524 Ga0495613_0099524_435_749 104
82 3300046690 Ga0495624_0091868 Ga0495624_0091868_1241_1555 104
83 3300046809 Ga0495600_0045435 Ga0495600_0045435_1578_1892 104
84 3300047317 Ga0495604_0026527 Ga0495604_0026527_3509_3823 104
85 3300047317 Ga0495604_0061193 Ga0495604_0061193_561_875 104
86 3300047322 Ga0495680_0083263 Ga0495680_0083263_764_1078 104
87 3300047322 Ga0495680_0090862 Ga0495680_0090862_729_1043 104
88 3300047444 Ga0495675_0009018 Ga0495675_0009018_5550_5864 104
89 3300047444 Ga0495675_0526721 Ga0495675_0526721_311_625 104
90 3300047471 Ga0495684_0064571 Ga0495684_0064571_619_933 104
91 3300047471 Ga0495684_0108306 Ga0495684_0108306_845_1159 104
92 3300053077 Ga0495601_0001984 Ga0495601_0001984_4839_5153 104
93 3300053078 Ga0495612_0329930 Ga0495612_0329930_99_413 104
94 3300053084 Ga0495595_0114256 Ga0495595_0114256_564_878 104
95 3300053085 Ga0495619_0019392 Ga0495619_0019392_1006_1320 104
96 3300053085 Ga0495619_0065013 Ga0495619_0065013_92_406 104
97 iso_pu_bacteria 2808606384 2808968134 104
98 iso_pu_bacteria 2808606390 2809002965 104
99 iso_pu_bacteria 2808606391 2809010242 104
100 3300006846 Ga0075430_100227157 Ga0075430_1002271572 105
101 3300006846 Ga0075430_100565157 Ga0075430_1005651572 105
102 3300035171 Ga0373946_0050470 Ga0373946_0050470_745_1071 105
103 3300042876 Ga0451577_0017016 Ga0451577_0017016_835_1158 105
104 3300042876 Ga0451577_0110548 Ga0451577_0110548_1665_1991 105
105 3300042876 Ga0451577_1770473 Ga0451577_1770473_130_471 105
106 3300044673 Ga0453683_0043317 Ga0453683_0043317_1553_1876 105
107 3300045051 Ga0451576_0002586 Ga0451576_0002586_15593_15934 105
108 3300045051 Ga0451576_0081743 Ga0451576_0081743_1521_1847 105
109 3300045051 Ga0451576_0310980 Ga0451576_0310980_495_836 105
110 3300050509 nmdc:mga0qj67_654531_c1 nmdc:mga0qj67_654531_c1_204_530 105
111 3300001979 JGI24740J21852_10034611 JGI24740J21852_100346111 107
112 3300002067 JGI24735J21928_10007927 JGI24735J21928_100079272 107
113 3300003187 JGI25151J46595_10003613 JGI25151J46595_100036135 107
114 3300003187 JGI25151J46595_10073052 JGI25151J46595_100730522 107
115 3300003316 rootH1_10024297 rootH1_100242971 107
116 3300003322 rootL2_10025745 rootL2_100257452 107
117 3300003354 JGI25160J50197_1000112 JGI25160J50197_100011241 107
118 3300003771 Ga0055526_1003944 Ga0055526_10039448 107
119 3300003771 Ga0055526_1007181 Ga0055526_10071812 107
120 3300003771 Ga0055526_1012310 Ga0055526_10123104 107
121 3300003773 Ga0055537_1028775 Ga0055537_10287752 107
122 3300003775 Ga0055524_1000389 Ga0055524_10003893 107
123 3300003775 Ga0055524_1001221 Ga0055524_100122113 107
124 3300003781 Ga0055536_1000364 Ga0055536_100036427 107
125 3300003784 Ga0055534_1000181 Ga0055534_100018141 107
126 3300003784 Ga0055534_1001123 Ga0055534_10011235 107
127 3300003784 Ga0055534_1001595 Ga0055534_10015955 107
128 3300003792 Ga0055540_1068341 Ga0055540_10683411 107
129 3300005262 Ga0065165_1000340 Ga0065165_100034041 107
130 3300005327 Ga0070658_10006150 Ga0070658_1000615012 107
131 3300005331 Ga0070670_101619495 Ga0070670_1016194952 107
132 3300005335 Ga0070666_10038950 Ga0070666_100389503 107
133 3300005337 Ga0070682_100541377 Ga0070682_1005413772 107
134 3300005339 Ga0070660_100010801 Ga0070660_1000108012 107
135 3300005354 Ga0070675_100245013 Ga0070675_1002450133 107
136 3300005366 Ga0070659_100191022 Ga0070659_1001910222 107
137 3300005367 Ga0070667_100023275 Ga0070667_1000232751 107
138 3300005455 Ga0070663_100031835 Ga0070663_1000318353 107
139 3300005456 Ga0070678_100252596 Ga0070678_1002525961 107
140 3300005459 Ga0068867_102045025 Ga0068867_1020450251 107
141 3300005543 Ga0070672_100838089 Ga0070672_1008380892 107
142 3300005548 Ga0070665_100131205 Ga0070665_1001312052 107
143 3300005563 Ga0068855_100002626 Ga0068855_1000026266 107
144 3300005577 Ga0068857_100227177 Ga0068857_1002271772 107
145 3300005578 Ga0068854_101213502 Ga0068854_1012135022 107
146 3300005614 Ga0068856_100253225 Ga0068856_1002532252 107
147 3300006038 Ga0075365_10019253 Ga0075365_100192535 107
148 3300006038 Ga0075365_10747810 Ga0075365_107478102 107
149 3300006051 Ga0075364_10495335 Ga0075364_104953352 107
150 3300006177 Ga0075362_10022330 Ga0075362_100223303 107
151 3300006178 Ga0075367_10202867 Ga0075367_102028672 107
152 3300006178 Ga0075367_10397481 Ga0075367_103974811 107
153 3300006178 Ga0075367_10461236 Ga0075367_104612362 107
154 3300006186 Ga0075369_10123434 Ga0075369_101234342 107
155 3300006195 Ga0075366_10138753 Ga0075366_101387532 107
156 3300006195 Ga0075366_10418340 Ga0075366_104183402 107
157 3300006195 Ga0075366_10682028 Ga0075366_106820282 107
158 3300006353 Ga0075370_10224519 Ga0075370_102245192 107
159 3300006914 Ga0075436_100228090 Ga0075436_1002280902 107
160 3300006948 Ga0099826_10000014 Ga0099826_1000001468 107
161 3300009011 Ga0105251_10016758 Ga0105251_100167584 107
162 3300009036 Ga0105244_10088618 Ga0105244_100886182 107
163 3300009093 Ga0105240_10009465 Ga0105240_100094658 107
164 3300009093 Ga0105240_10458977 Ga0105240_104589772 107
165 3300009098 Ga0105245_10589769 Ga0105245_105897692 107
166 3300009545 Ga0105237_10017773 Ga0105237_100177739 107
167 3300009545 Ga0105237_10273960 Ga0105237_102739602 107
168 3300009551 Ga0105238_10469070 Ga0105238_104690702 107
169 3300013100 Ga0157373_10007517 Ga0157373_100075175 107
170 3300013104 Ga0157370_10002724 Ga0157370_1000272410 107
171 3300013104 Ga0157370_10008825 Ga0157370_1000882510 107
172 3300013105 Ga0157369_10000082 Ga0157369_1000008279 107
173 3300013105 Ga0157369_10002846 Ga0157369_1000284613 107
174 3300013296 Ga0157374_10000172 Ga0157374_1000017238 107
175 3300013306 Ga0163162_10049144 Ga0163162_100491442 107
176 3300013306 Ga0163162_10065770 Ga0163162_100657705 107
177 3300013306 Ga0163162_10901754 Ga0163162_109017541 107
178 3300013307 Ga0157372_10026846 Ga0157372_100268462 107
179 3300013307 Ga0157372_10109568 Ga0157372_101095684 107
180 3300013307 Ga0157372_10700622 Ga0157372_107006222 107
181 3300013308 Ga0157375_10181728 Ga0157375_101817282 107
182 3300015262 Ga0182007_10152067 Ga0182007_101520672 107
183 3300020070 Ga0206356_11508442 Ga0206356_115084422 107
184 3300020081 Ga0206354_11054812 Ga0206354_110548122 107
185 3300020082 Ga0206353_11146855 Ga0206353_111468553 107
186 3300022467 Ga0224712_10001964 Ga0224712_100019642 107
187 3300025228 Ga0209672_105374 Ga0209672_1053743 107
188 3300025256 Ga0209759_1005991 Ga0209759_10059912 107
189 3300025263 Ga0209565_1000045 Ga0209565_1000045177 107
190 3300025263 Ga0209565_1002216 Ga0209565_10022165 107
191 3300025284 Ga0209130_1007745 Ga0209130_10077453 107
192 3300025291 Ga0209675_1000173 Ga0209675_100017331 107
193 3300025291 Ga0209675_1000636 Ga0209675_100063613 107
194 3300025291 Ga0209675_1009241 Ga0209675_10092414 107
195 3300025292 Ga0209676_1000064 Ga0209676_1000064123 107
196 3300025294 Ga0209025_1001692 Ga0209025_100169218 107
197 3300025294 Ga0209025_1004326 Ga0209025_10043265 107
198 3300025294 Ga0209025_1024040 Ga0209025_10240402 107
199 3300025295 Ga0209564_1000107 Ga0209564_1000107167 107
200 3300025295 Ga0209564_1000371 Ga0209564_100037129 107
201 3300025295 Ga0209564_1000741 Ga0209564_10007412 107
202 3300025295 Ga0209564_1004049 Ga0209564_10040494 107
203 3300025299 Ga0209256_1000105 Ga0209256_1000105146 107
204 3300025302 Ga0207426_1000007 Ga0207426_1000007123 107
205 3300025303 Ga0209051_1007895 Ga0209051_10078953 107
206 3300025303 Ga0209051_1021412 Ga0209051_10214123 107
207 3300025904 Ga0207647_10002297 Ga0207647_1000229713 107
208 3300025913 Ga0207695_10022290 Ga0207695_100222902 107
209 3300025913 Ga0207695_10104659 Ga0207695_101046592 107
210 3300025914 Ga0207671_10069651 Ga0207671_100696512 107
211 3300025914 Ga0207671_11084397 Ga0207671_110843971 107
212 3300025919 Ga0207657_10038281 Ga0207657_100382815 107
213 3300025924 Ga0207694_10194474 Ga0207694_101944741 107
214 3300025924 Ga0207694_10303232 Ga0207694_103032321 107
215 3300025940 Ga0207691_10862292 Ga0207691_108622921 107
216 3300025949 Ga0207667_10003865 Ga0207667_1000386514 107
217 3300025949 Ga0207667_10007418 Ga0207667_100074182 107
218 3300025981 Ga0207640_10230712 Ga0207640_102307122 107
219 3300025981 Ga0207640_10594761 Ga0207640_105947612 107
220 3300025986 Ga0207658_10053787 Ga0207658_100537871 107
221 3300026067 Ga0207678_10081680 Ga0207678_100816802 107
222 3300026067 Ga0207678_10264628 Ga0207678_102646282 107
223 3300026116 Ga0207674_10285958 Ga0207674_102859582 107
224 3300026121 Ga0207683_10312175 Ga0207683_103121752 107
225 3300027666 Ga0209282_1000046 Ga0209282_100004643 107
226 3300027866 Ga0209813_10110058 Ga0209813_101100582 107
227 3300028379 Ga0268266_11305045 Ga0268266_113050452 107
228 3300028800 Ga0265338_10001025 Ga0265338_1000102518 107
229 3300030521 Ga0307511_10000164 Ga0307511_100001649 107
230 3300031251 Ga0265327_10040151 Ga0265327_100401512 107
231 3300033179 Ga0307507_10042982 Ga0307507_100429824 107
232 3300033179 Ga0307507_10450255 Ga0307507_104502552 107
233 3300037312 Ga0395899_0002578 Ga0395899_0002578_7131_7454 107
234 3300037312 Ga0395899_0006220 Ga0395899_0006220_7673_7996 107
235 3300037312 Ga0395899_0062199 Ga0395899_0062199_1207_1530 107
236 3300037418 Ga0395900_0000385 Ga0395900_0000385_50419_50742 107
237 3300037418 Ga0395900_0015192 Ga0395900_0015192_1345_1668 107
238 3300037418 Ga0395900_0125798 Ga0395900_0125798_1985_2308 107
239 3300037418 Ga0395900_0236029 Ga0395900_0236029_1472_1795 107
240 3300037418 Ga0395900_0269969 Ga0395900_0269969_141_464 107
241 3300037466 Ga0395898_0017854 Ga0395898_0017854_4224_4547 107
242 3300037466 Ga0395898_0042811 Ga0395898_0042811_810_1133 107
243 3300037466 Ga0395898_0063621 Ga0395898_0063621_1057_1380 107
244 3300037466 Ga0395898_0229766 Ga0395898_0229766_328_651 107
245 3300037471 Ga0395905_0000014 Ga0395905_0000014_22408_22731 107
246 3300037471 Ga0395905_0000137 Ga0395905_0000137_71611_71934 107
247 3300038443 Ga0395901_0002292 Ga0395901_0002292_9213_9536 107
248 3300038443 Ga0395901_0017195 Ga0395901_0017195_3163_3486 107
249 3300038443 Ga0395901_0020360 Ga0395901_0020360_4696_5019 107
250 3300038443 Ga0395901_0619146 Ga0395901_0619146_702_1025 107
251 3300038443 Ga0395901_1567210 Ga0395901_1567210_36_359 107
252 3300042005 Ga0439448_0012557 Ga0439448_0012557_1671_1994 107
253 3300042010 Ga0439452_010847 Ga0439452_010847_1237_1560 107
254 3300044656 Ga0466969_0000237 Ga0466969_0000237_24409_24732 107
255 3300044656 Ga0466969_0001232 Ga0466969_0001232_10754_11077 107
256 3300044656 Ga0466969_0077038 Ga0466969_0077038_771_1094 107
257 3300044658 Ga0466972_0019589 Ga0466972_0019589_176_499 107
258 3300044658 Ga0466972_0198268 Ga0466972_0198268_280_603 107
259 3300044666 Ga0466977_0000209 Ga0466977_0000209_13433_13756 107
260 3300044668 Ga0466980_0376830 Ga0466980_0376830_330_653 107
261 3300044672 Ga0466982_0654966 Ga0466982_0654966_16_339 107
262 3300044683 Ga0466965_0000444 Ga0466965_0000444_1341_1664 107
263 3300044683 Ga0466965_0001636 Ga0466965_0001636_1826_2149 107
264 3300044684 Ga0466966_0000442 Ga0466966_0000442_15401_15724 107
265 3300044684 Ga0466966_0003107 Ga0466966_0003107_5549_5872 107
266 3300044684 Ga0466966_0017258 Ga0466966_0017258_1773_2096 107
267 3300044684 Ga0466966_0017829 Ga0466966_0017829_888_1211 107
268 3300044693 Ga0466961_0000936 Ga0466961_0000936_10783_11106 107
269 3300044693 Ga0466961_0170023 Ga0466961_0170023_608_931 107
270 3300044693 Ga0466961_0379573 Ga0466961_0379573_373_696 107
271 3300044693 Ga0466961_0476067 Ga0466961_0476067_299_622 107
272 3300044694 Ga0466963_0000429 Ga0466963_0000429_4433_4756 107
273 3300044694 Ga0466963_0025077 Ga0466963_0025077_2516_2839 107
274 3300044694 Ga0466963_0115266 Ga0466963_0115266_385_708 107
275 3300044706 Ga0466964_0000529 Ga0466964_0000529_1255_1578 107
276 3300044719 Ga0466971_0065953 Ga0466971_0065953_339_662 107
277 3300044719 Ga0466971_0091606 Ga0466971_0091606_581_904 107
278 3300044735 Ga0466968_0020302 Ga0466968_0020302_826_1149 107
279 3300044765 Ga0466970_0002091 Ga0466970_0002091_5639_5962 107
280 3300044765 Ga0466970_0012657 Ga0466970_0012657_266_589 107
281 3300044765 Ga0466970_0045423 Ga0466970_0045423_1116_1439 107
282 3300044842 Ga0466957_0001502 Ga0466957_0001502_7304_7627 107
283 3300044842 Ga0466957_0004954 Ga0466957_0004954_6843_7166 107
284 3300044842 Ga0466957_0016889 Ga0466957_0016889_974_1297 107
285 3300045049 Ga0466959_0003441 Ga0466959_0003441_7747_8070 107
286 3300045049 Ga0466959_0010052 Ga0466959_0010052_6107_6430 107
287 3300045049 Ga0466959_0010986 Ga0466959_0010986_1772_2095 107
288 3300045836 Ga0466958_0000768 Ga0466958_0000768_13521_13844 107
289 3300045836 Ga0466958_0012422 Ga0466958_0012422_1572_1895 107
290 3300045836 Ga0466958_0029761 Ga0466958_0029761_985_1308 107
291 3300045836 Ga0466958_0075996 Ga0466958_0075996_309_632 107
292 3300045976 Ga0466967_0525581 Ga0466967_0525581_339_662 107
293 3300045976 Ga0466967_0917793 Ga0466967_0917793_165_491 107
294 3300046455 Ga0495603_0017797 Ga0495603_0017797_2693_3016 107
295 3300046457 Ga0495590_0055450 Ga0495590_0055450_197_520 107
296 3300046457 Ga0495590_0416301 Ga0495590_0416301_69_392 107
297 3300046458 Ga0495591_054586 Ga0495591_054586_732_1055 107
298 3300046458 Ga0495591_146498 Ga0495591_146498_110_433 107
299 3300046459 Ga0495629_0109446 Ga0495629_0109446_1457_1780 107
300 3300046460 Ga0495638_0005247 Ga0495638_0005247_4866_5189 107
301 3300046471 Ga0495650_0058562 Ga0495650_0058562_574_897 107
302 3300046471 Ga0495650_0083945 Ga0495650_0083945_172_495 107
303 3300046472 Ga0495580_0027968 Ga0495580_0027968_1981_2304 107
304 3300046474 Ga0495605_0000422 Ga0495605_0000422_12643_12966 107
305 3300046474 Ga0495605_0005590 Ga0495605_0005590_1605_1928 107
306 3300046474 Ga0495605_0482690 Ga0495605_0482690_102_425 107
307 3300046477 Ga0495664_0182004 Ga0495664_0182004_163_486 107
308 3300046477 Ga0495664_0196414 Ga0495664_0196414_759_1082 107
309 3300046492 Ga0495585_0110965 Ga0495585_0110965_797_1120 107
310 3300046500 Ga0495596_0001679 Ga0495596_0001679_7654_7977 107
311 3300046500 Ga0495596_0104612 Ga0495596_0104612_134_457 107
312 3300046501 Ga0495607_0003440 Ga0495607_0003440_7415_7738 107
313 3300046506 Ga0495583_0386679 Ga0495583_0386679_74_397 107
314 3300046507 Ga0495606_0080793 Ga0495606_0080793_1506_1829 107
315 3300046507 Ga0495606_0167329 Ga0495606_0167329_584_907 107
316 3300046512 Ga0495610_0001001 Ga0495610_0001001_5026_5349 107
317 3300046513 Ga0495616_0003844 Ga0495616_0003844_7484_7807 107
318 3300046513 Ga0495616_0183349 Ga0495616_0183349_118_441 107
319 3300046515 Ga0495620_0245320 Ga0495620_0245320_262_585 107
320 3300046516 Ga0495628_0031809 Ga0495628_0031809_3667_3990 107
321 3300046517 Ga0495630_0738378 Ga0495630_0738378_228_551 107
322 3300046518 Ga0495631_0023982 Ga0495631_0023982_2232_2555 107
323 3300046519 Ga0495632_0194669 Ga0495632_0194669_152_475 107
324 3300046522 Ga0495643_0197890 Ga0495643_0197890_144_467 107
325 3300046523 Ga0495644_0022344 Ga0495644_0022344_482_805 107
326 3300046524 Ga0495648_0016915 Ga0495648_0016915_1086_1409 107
327 3300046524 Ga0495648_0330068 Ga0495648_0330068_274_597 107
328 3300046526 Ga0495666_0013043 Ga0495666_0013043_1895_2218 107
329 3300046528 Ga0495642_0310638 Ga0495642_0310638_150_473 107
330 3300046538 Ga0495609_0000524 Ga0495609_0000524_17766_18089 107
331 3300046542 Ga0495597_0196429 Ga0495597_0196429_360_683 107
332 3300046559 Ga0495667_0079519 Ga0495667_0079519_1779_2105 107
333 3300046559 Ga0495667_0610454 Ga0495667_0610454_231_554 107
334 3300046648 Ga0495611_0444915 Ga0495611_0444915_20_343 107
335 3300046660 Ga0495625_0163464 Ga0495625_0163464_191_514 107
336 3300046665 Ga0495661_0019306 Ga0495661_0019306_3145_3468 107
337 3300046674 Ga0495588_0346687 Ga0495588_0346687_289_612 107
338 3300046684 Ga0495669_0040943 Ga0495669_0040943_985_1308 107
339 3300046691 Ga0495670_0233298 Ga0495670_0233298_252_575 107
340 3300046692 Ga0495671_0001453 Ga0495671_0001453_4663_4986 107
341 3300046692 Ga0495671_0072176 Ga0495671_0072176_184_507 107
342 3300046694 Ga0495649_0008824 Ga0495649_0008824_4348_4671 107
343 3300046694 Ga0495649_0220626 Ga0495649_0220626_516_839 107
344 3300046794 Ga0495589_0004090 Ga0495589_0004090_5021_5344 107
345 3300046794 Ga0495589_0189900 Ga0495589_0189900_570_893 107
346 3300046809 Ga0495600_0214552 Ga0495600_0214552_179_502 107
347 3300046810 Ga0495660_0461833 Ga0495660_0461833_204_527 107
348 3300047317 Ga0495604_0032566 Ga0495604_0032566_1876_2199 107
349 3300047318 Ga0495636_0034382 Ga0495636_0034382_1473_1799 107
350 3300047319 Ga0495674_0020602 Ga0495674_0020602_3691_4014 107
351 3300047319 Ga0495674_1308057 Ga0495674_1308057_124_447 107
352 3300047320 Ga0495672_0015652 Ga0495672_0015652_700_1023 107
353 3300047323 Ga0495683_0249650 Ga0495683_0249650_56_379 107
354 3300047443 Ga0495687_028381 Ga0495687_028381_1867_2190 107
355 3300047447 Ga0495685_019436 Ga0495685_019436_1790_2113 107
356 3300047447 Ga0495685_154333 Ga0495685_154333_47_373 107
357 3300047469 Ga0495673_0125219 Ga0495673_0125219_23_346 107
358 3300047469 Ga0495673_0129394 Ga0495673_0129394_85_408 107
359 3300047470 Ga0495681_0168673 Ga0495681_0168673_98_421 107
360 3300047470 Ga0495681_0183963 Ga0495681_0183963_430_753 107
361 3300047472 Ga0495686_0000014 Ga0495686_0000014_469518_469841 107
362 3300047472 Ga0495686_0366286 Ga0495686_0366286_69_392 107
363 3300048091 Ga0495626_0181021 Ga0495626_0181021_162_485 107
364 3300048903 Ga0496100_0059425 Ga0496100_0059425_636_959 107
365 3300048903 Ga0496100_0336556 Ga0496100_0336556_283_606 107
366 3300048904 Ga0496101_0039917 Ga0496101_0039917_1108_1431 107
367 3300048905 Ga0496102_0015471 Ga0496102_0015471_5841_6164 107
368 3300048905 Ga0496102_0045523 Ga0496102_0045523_1176_1499 107
369 3300048905 Ga0496102_0139052 Ga0496102_0139052_1776_2099 107
370 3300048905 Ga0496102_0263779 Ga0496102_0263779_1240_1563 107
371 3300048905 Ga0496102_1404496 Ga0496102_1404496_31_354 107
372 3300048906 Ga0496103_0160675 Ga0496103_0160675_919_1242 107
373 3300048906 Ga0496103_0227871 Ga0496103_0227871_86_409 107
374 3300048907 Ga0496104_0283603 Ga0496104_0283603_772_1095 107
375 3300048907 Ga0496104_0477215 Ga0496104_0477215_37_360 107
376 3300048908 Ga0496105_0136791 Ga0496105_0136791_145_468 107
377 3300048909 Ga0496106_0314591 Ga0496106_0314591_496_819 107
378 3300048910 Ga0496107_0152457 Ga0496107_0152457_501_824 107
379 3300048913 Ga0496110_0312153 Ga0496110_0312153_1088_1411 107
380 3300048914 Ga0496111_1144762 Ga0496111_1144762_178_501 107
381 3300048918 Ga0496115_0052691 Ga0496115_0052691_1789_2112 107
382 3300048919 Ga0496116_0009751 Ga0496116_0009751_3021_3344 107
383 3300048919 Ga0496116_0024793 Ga0496116_0024793_3213_3536 107
384 3300048920 Ga0496117_0001040 Ga0496117_0001040_10303_10626 107
385 3300048920 Ga0496117_0002732 Ga0496117_0002732_965_1288 107
386 3300048921 Ga0496118_0004247 Ga0496118_0004247_3554_3877 107
387 3300048921 Ga0496118_0018848 Ga0496118_0018848_5237_5560 107
388 3300048921 Ga0496118_0303073 Ga0496118_0303073_159_482 107
389 3300048924 Ga0496121_0040766 Ga0496121_0040766_3352_3675 107
390 3300048925 Ga0496122_0007114 Ga0496122_0007114_7393_7716 107
391 3300048926 Ga0496123_0001999 Ga0496123_0001999_4735_5058 107
392 3300048928 Ga0496125_0132265 Ga0496125_0132265_1381_1704 107
393 3300048929 Ga0496126_0000061 Ga0496126_0000061_142977_143300 107
394 3300049459 Ga0495678_220413 Ga0495678_220413_116_439 107
395 3300049570 Ga0501033_1207403 Ga0501033_1207403_139_462 107
396 3300049571 Ga0501034_0000911 Ga0501034_0000911_28780_29103 107
397 3300049579 Ga0501043_0664276 Ga0501043_0664276_44_367 107
398 3300050490 nmdc:mga03n38_164416_c1 nmdc:mga03n38_164416_c1_51_395 107
399 3300050491 nmdc:mga00v17_372316_c2 nmdc:mga00v17_372316_c2_86_430 107
400 3300050491 nmdc:mga00v17_442919_c1 nmdc:mga00v17_442919_c1_183_527 107
401 3300050492 nmdc:mga0yw44_23247_c1 nmdc:mga0yw44_23247_c1_1532_1870 107
402 3300050492 nmdc:mga0yw44_26411_c1 nmdc:mga0yw44_26411_c1_147_491 107
403 3300050493 nmdc:mga0k408_349643_c1 nmdc:mga0k408_349643_c1_431_772 107
404 3300050493 nmdc:mga0k408_70965_c1 nmdc:mga0k408_70965_c1_863_1207 107
405 3300050494 nmdc:mga06z11_352543_c1 nmdc:mga06z11_352543_c1_355_693 107
406 3300050494 nmdc:mga06z11_618147_c1 nmdc:mga06z11_618147_c1_166_510 107
407 3300050495 nmdc:mga04h51_84129_c1 nmdc:mga04h51_84129_c1_475_819 107
408 3300050496 nmdc:mga07m45_261495_c1 nmdc:mga07m45_261495_c1_294_638 107
409 3300050496 nmdc:mga07m45_479414_c1 nmdc:mga07m45_479414_c1_317_658 107
410 3300053090 Ga0500646_0006962 Ga0500646_0006962_902_1243 107
411 3300053092 Ga0500583_0031196 Ga0500583_0031196_579_920 107
412 3300053103 Ga0500555_041105 Ga0500555_041105_761_1102 107
413 3300053133 Ga0500655_019887 Ga0500655_019887_383_724 107
414 3300053142 Ga0500577_0287551 Ga0500577_0287551_26_367 107
415 3300053151 Ga0500604_0007226 Ga0500604_0007226_2339_2680 107
416 3300053177 Ga0500636_0179015 Ga0500636_0179015_258_596 107
417 3300053178 Ga0500637_0088194 Ga0500637_0088194_822_1163 107
418 3300061719 Ga0466962_0003409 Ga0466962_0003409_6471_6794 107
419 3300061719 Ga0466962_0004598 Ga0466962_0004598_4783_5106 107
420 3300061719 Ga0466962_0389898 Ga0466962_0389898_91_414 107

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05437

AzlD

Branched-chain amino acid transport protein (AzlD)

15

113

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bub-assembly1.cif.gz_E cryo-em structure of dengue virus serotype 2 complexed with fab sign-3c at ph 6.5 0.4304 30 102
7bub-assembly1.cif.gz_E cryo-em structure of dengue virus serotype 2 complexed with fab sign-3c at ph 6.5 0.35 30 102
8b6l-assembly1.cif.gz_P subtomogram average of the human sec61-trap-osta-translocon 0.2992 22 105
8b6l-assembly1.cif.gz_P subtomogram average of the human sec61-trap-osta-translocon 0.2621 22 105
ID Description Score Start End Superfamily
af_K7MP75_528_679_1.25.40.20 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Ankyrin repeat-containing domain 0.368 17 99 1.25.40.20
af_A0A0P0Y1V1_10_122_1.20.5.4130 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; 0.3142 14 104 1.20.5.4130
af_I1MJ03_3_89_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.3009 20 105 1.10.10.1740
3aegC02 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.2934 12 105 1.20.1300.10
af_K7MP75_528_679_1.25.40.20 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Ankyrin repeat-containing domain 0.2917 17 99 1.25.40.20
ID Description Score Start End GO Terms
AF-A0A0H2MIX9-F1-model_v4 Branched-chain amino acid transport 0.8973 5 107 GO:0016020
AF-A0A0H2MIX9-F1-model_v4 Branched-chain amino acid transport 0.8739 5 107 GO:0016020
AF-A0A7C4YYI4-F1-model_v4 AzlD domain-containing protein 0.865 6 106 GO:0016020
AF-A0A3M1HGD5-F1-model_v4 AzlD domain-containing protein 0.8625 7 106 GO:0016020
AF-A0A1I4Y4Y9-F1-model_v4 Branched-chain amino acid transport protein 0.8589 5 105 GO:0016020

Feature Viewer

pLDDT pTM Quality
87.83 0.6 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map