F439619

General Info

Members Datasets Scaffolds Average Seq Length
419 227 838 226

Family's Representative Sequence

Representative Sequence 3300049585|Ga0501069_0012725|Ga0501069_0012725_811_1725
Length 266
Sequence VIRWAQDGYVVAFTTRVGGVSEGPYASLNLGRLTRDPPEHVDENRRRACAELDAAVDDLAFNRQVHSTVVHRATAGARGREGDGLWTDEPHVPLLAFAADCVPIAVARTGGERALAVLHAGWRGLADGIVAAGVRALGGPAIXXCCYEVGPEVAERFDADLTRDGRLDLWAAAERQLRAAGVATVERVDLCTACHPELFFSHRRDRGVTGRQGVIGYVAWRCASGTCASASWSARASPSSPRPSTCPWRTWPSSWRARCSRTRRRS

Samples

Sample ID Description Type Environment
1 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
45 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
46 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
70 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
122 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
123 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
124 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
125 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
126 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
127 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
128 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
129 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
130 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
131 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
132 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
133 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
134 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
135 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
136 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
137 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
138 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
139 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
140 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
141 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
142 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
143 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
144 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
145 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
146 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
147 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
148 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
149 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
150 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
151 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
152 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
153 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
154 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
155 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
156 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
157 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
158 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
159 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
160 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
161 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
162 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
163 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
164 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
165 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
166 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
167 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
168 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
169 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
170 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
171 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
172 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
173 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
174 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
175 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
176 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
177 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
178 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
179 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
180 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
181 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
182 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
183 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
184 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
185 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
186 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
187 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
188 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
189 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
190 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
191 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
192 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
193 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
194 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
195 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
196 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
197 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
198 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
199 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
200 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
201 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
202 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
203 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
204 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
205 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
206 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
207 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
208 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
209 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
210 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
211 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
215 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
216 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
217 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
218 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
219 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
220 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
221 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
222 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
223 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
224 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
225 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
226 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
227 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.81
Metatranscriptomes 1.19
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 13.37
Rhizosphere 86.4
Stem 0
Stem Tuber 0
Unclassified 8.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501069_0012725 3300049585 Bacteria 4479
2 Ga0070658_10929179 3300005327 Bacteria 756
3 Ga0070676_10096346 3300005328 Bacteria 1821
4 Ga0070683_100033750 3300005329 Bacteria 4668
5 Ga0070683_100046782 3300005329 Bacteria 3998
6 Ga0070683_100101570 3300005329 Bacteria 2708
7 Ga0070683_100237369 3300005329 Bacteria 1734
8 Ga0070683_100846331 3300005329 Bacteria 877
9 Ga0070666_10181881 3300005335 Bacteria 1475
10 Ga0070680_100034051 3300005336 Bacteria 4107
11 Ga0070680_100045002 3300005336 Bacteria 3587
12 Ga0070682_100003925 3300005337 Bacteria 8252
13 Ga0070682_100026553 3300005337 Bacteria 3467
14 Ga0070682_100213579 3300005337 Bacteria 1369
15 Ga0070682_100457674 3300005337 Bacteria 979
16 Ga0070660_100153731 3300005339 Unclassified 1851
17 Ga0070660_100231034 3300005339 Bacteria 1505
18 Ga0070660_100492173 3300005339 Bacteria 1020
19 Ga0070689_100252457 3300005340 Bacteria 1455
20 Ga0070661_100020146 3300005344 Bacteria 4755
21 Ga0070661_100021426 3300005344 Bacteria 4615
22 Ga0070661_100051038 3300005344 Bacteria 3027
23 Ga0070668_100030366 3300005347 Bacteria 4108
24 Ga0070669_100627139 3300005353 Bacteria 903
25 Ga0070671_100394758 3300005355 Bacteria 1183
26 Ga0070674_100029669 3300005356 Bacteria 3607
27 Ga0070688_100081944 3300005365 Bacteria 2090
28 Ga0070659_100032737 3300005366 Bacteria 4034
29 Ga0070659_100199928 3300005366 Bacteria 1645
30 Ga0070659_100653300 3300005366 Bacteria 907
31 Ga0070667_100003011 3300005367 Bacteria 14476
32 Ga0070667_100113633 3300005367 Bacteria 2350
33 Ga0070709_10004518 3300005434 Bacteria 7506
34 Ga0070714_100007151 3300005435 Bacteria 8659
35 Ga0070714_100068287 3300005435 Bacteria 3066
36 Ga0070714_100293763 3300005435 Unclassified 1513
37 Ga0070713_100015415 3300005436 Bacteria 5713
38 Ga0070710_10000589 3300005437 Bacteria 17269
39 Ga0070710_10045324 3300005437 Bacteria 2444
40 Ga0070710_10203210 3300005437 Bacteria 1252
41 Ga0070711_100028555 3300005439 Bacteria 3672
42 Ga0070711_100658235 3300005439 Bacteria 879
43 Ga0070678_100015166 3300005456 Bacteria 4890
44 Ga0070678_100796075 3300005456 Bacteria 858
45 Ga0070662_100610381 3300005457 Bacteria 918
46 Ga0070681_10001213 3300005458 Bacteria 22417
47 Ga0070681_10028524 3300005458 Bacteria 5612
48 Ga0070681_10111937 3300005458 Bacteria 2669
49 Ga0070681_10273482 3300005458 Unclassified 1600
50 Ga0070706_100722489 3300005467 Bacteria 923
51 Ga0070707_100126302 3300005468 Bacteria 2485
52 Ga0070707_100349495 3300005468 Bacteria 1436
53 Ga0070679_100020574 3300005530 Bacteria 6435
54 Ga0070679_100058769 3300005530 Bacteria 3832
55 Ga0070679_100257485 3300005530 Bacteria 1700
56 Ga0070679_100503757 3300005530 Bacteria 1155
57 Ga0070679_100651352 3300005530 Unclassified 996
58 Ga0070684_100153970 3300005535 Bacteria 2084
59 Ga0070684_100378178 3300005535 Unclassified 1304
60 Ga0068853_100092663 3300005539 Bacteria 2658
61 Ga0070686_100165073 3300005544 Bacteria 1562
62 Ga0070696_100006574 3300005546 Bacteria 7761
63 Ga0070696_100343831 3300005546 Bacteria 1154
64 Ga0070704_100184745 3300005549 Bacteria 1670
65 Ga0068855_100022769 3300005563 Bacteria 7508
66 Ga0068855_100063071 3300005563 Bacteria 4326
67 Ga0068855_100229107 3300005563 Bacteria 2081
68 Ga0068855_100294702 3300005563 Bacteria 1798
69 Ga0068855_100340464 3300005563 Bacteria 1654
70 Ga0068855_100480871 3300005563 Unclassified 1352
71 Ga0068855_100783668 3300005563 Bacteria 1014
72 Ga0070664_100301050 3300005564 Bacteria 1449
73 Ga0068857_100020406 3300005577 Bacteria 5827
74 Ga0070702_100007090 3300005615 Bacteria 5347
75 Ga0068852_100027110 3300005616 Bacteria 4665
76 Ga0068859_100351648 3300005617 Bacteria 1568
77 Ga0068861_100012086 3300005719 Bacteria 6017
78 Ga0068861_100159231 3300005719 Bacteria 1861
79 Ga0068861_100172981 3300005719 Bacteria 1791
80 Ga0068860_100187173 3300005843 Bacteria 2002
81 Ga0068862_100201535 3300005844 Bacteria 1795
82 Ga0081455_10112841 3300005937 Bacteria 2157
83 Ga0070717_10007774 3300006028 Bacteria 7980
84 Ga0070717_10569067 3300006028 Unclassified 1027
85 Ga0070715_10001156 3300006163 Bacteria 7557
86 Ga0070716_100001585 3300006173 Bacteria 10228
87 Ga0070716_100184106 3300006173 Bacteria 1374
88 Ga0070712_100014439 3300006175 Bacteria 5069
89 Ga0070712_100021761 3300006175 Bacteria 4216
90 Ga0068865_100027554 3300006881 Bacteria 3754
91 Ga0068865_100294766 3300006881 Bacteria 1296
92 Ga0097620_100351639 3300006931 Bacteria 1568
93 Ga0105245_10062183 3300009098 Bacteria 3368
94 Ga0105245_10096920 3300009098 Bacteria 2723
95 Ga0105245_10175091 3300009098 Bacteria 2046
96 Ga0105243_10025180 3300009148 Bacteria 4544
97 Ga0105243_10066138 3300009148 Bacteria 2907
98 Ga0105241_10234777 3300009174 Unclassified 1547
99 Ga0105241_10795463 3300009174 Bacteria 871
100 Ga0105248_10516357 3300009177 Bacteria 1347
101 Ga0105237_10026541 3300009545 Bacteria 5920
102 Ga0105237_10039262 3300009545 Bacteria 4779
103 Ga0105237_10383353 3300009545 Bacteria 1411
104 Ga0105238_10051504 3300009551 Bacteria 4141
105 Ga0105238_10101835 3300009551 Bacteria 2854
106 Ga0105238_10411086 3300009551 Bacteria 1347
107 Ga0105249_10128814 3300009553 Bacteria 2413
108 Ga0105239_10086570 3300010375 Bacteria 3453
109 Ga0105239_10114810 3300010375 Bacteria 2987
110 Ga0105239_10122381 3300010375 Bacteria 2890
111 Ga0105239_10324741 3300010375 Bacteria 1736
112 Ga0105246_10231227 3300011119 Bacteria 1456
113 Ga0157373_10626562 3300013100 Bacteria 784
114 Ga0157370_10078188 3300013104 Bacteria 3115
115 Ga0157369_10002394 3300013105 Bacteria 22528
116 Ga0157369_10031545 3300013105 Bacteria 5834
117 Ga0157369_10069558 3300013105 Bacteria 3781
118 Ga0157374_10159587 3300013296 Bacteria 2196
119 Ga0157374_10259395 3300013296 Bacteria 1712
120 Ga0157378_10483780 3300013297 Bacteria 1234
121 Ga0163162_10286627 3300013306 Bacteria 1779
122 Ga0157372_10112520 3300013307 Bacteria 3119
123 Ga0157372_10350715 3300013307 Bacteria 1719
124 Ga0157372_10381517 3300013307 Bacteria 1642
125 Ga0157372_10459820 3300013307 Bacteria 1483
126 Ga0157375_10265623 3300013308 Bacteria 1878
127 Ga0163163_10245907 3300014325 Bacteria 1839
128 Ga0157380_10159507 3300014326 Bacteria 1959
129 Ga0182008_10294618 3300014497 Bacteria 847
130 Ga0157377_10026651 3300014745 Bacteria 3096
131 Ga0157377_10297420 3300014745 Bacteria 1064
132 Ga0157379_10384099 3300014968 Bacteria 1289
133 Ga0157376_10265835 3300014969 Bacteria 1609
134 Ga0197907_10515275 3300020069 Bacteria 1518
135 Ga0206354_11597686 3300020081 Bacteria 1067
136 Ga0206353_10248095 3300020082 Bacteria 1515
137 Ga0206353_10712429 3300020082 Bacteria 4178
138 Ga0206353_10854838 3300020082 Unclassified 1893
139 Ga0207692_10023818 3300025898 Bacteria 2837
140 Ga0207692_10039592 3300025898 Bacteria 2320
141 Ga0207688_10029378 3300025901 Bacteria 3026
142 Ga0207688_10075685 3300025901 Bacteria 1916
143 Ga0207680_10058068 3300025903 Bacteria 2344
144 Ga0207699_10001650 3300025906 Bacteria 10571
145 Ga0207699_10218279 3300025906 Bacteria 1300
146 Ga0207705_10030001 3300025909 Bacteria 3879
147 Ga0207705_10214391 3300025909 Bacteria 1461
148 Ga0207654_10017166 3300025911 Bacteria 3781
149 Ga0207707_10002380 3300025912 Bacteria 16951
150 Ga0207707_10004067 3300025912 Bacteria 12951
151 Ga0207671_10142125 3300025914 Bacteria 1850
152 Ga0207693_10000662 3300025915 Bacteria 30935
153 Ga0207693_10001862 3300025915 Bacteria 18464
154 Ga0207693_10003040 3300025915 Bacteria 14500
155 Ga0207693_10051274 3300025915 Bacteria 3239
156 Ga0207663_10000565 3300025916 Bacteria 16340
157 Ga0207660_10005698 3300025917 Bacteria 8083
158 Ga0207660_10680470 3300025917 Bacteria 839
159 Ga0207657_10000941 3300025919 Bacteria 30830
160 Ga0207657_10001075 3300025919 Bacteria 28931
161 Ga0207657_10132604 3300025919 Bacteria 2041
162 Ga0207657_10527427 3300025919 Bacteria 924
163 Ga0207649_10011602 3300025920 Bacteria 4864
164 Ga0207652_10089158 3300025921 Bacteria 2708
165 Ga0207652_10109900 3300025921 Bacteria 2444
166 Ga0207652_10155906 3300025921 Bacteria 2046
167 Ga0207652_10308552 3300025921 Unclassified 1428
168 Ga0207652_10541038 3300025921 Bacteria 1047
169 Ga0207646_10101662 3300025922 Bacteria 2577
170 Ga0207646_10248648 3300025922 Unclassified 1606
171 Ga0207646_10398159 3300025922 Bacteria 1244
172 Ga0207694_10100251 3300025924 Bacteria 2294
173 Ga0207659_10153560 3300025926 Bacteria 1800
174 Ga0207687_10051800 3300025927 Bacteria 2862
175 Ga0207687_10202875 3300025927 Bacteria 1551
176 Ga0207700_10010728 3300025928 Bacteria 5802
177 Ga0207700_10206732 3300025928 Unclassified 1657
178 Ga0207664_10005373 3300025929 Bacteria 8754
179 Ga0207664_10104816 3300025929 Bacteria 2342
180 Ga0207664_10107925 3300025929 Unclassified 2310
181 Ga0207664_10243237 3300025929 Unclassified 1568
182 Ga0207644_10389878 3300025931 Bacteria 1137
183 Ga0207644_10669261 3300025931 Bacteria 865
184 Ga0207690_10047800 3300025932 Bacteria 2841
185 Ga0207706_10077263 3300025933 Bacteria 2928
186 Ga0207709_10011716 3300025935 Bacteria 4835
187 Ga0207670_10085364 3300025936 Bacteria 2218
188 Ga0207665_10000344 3300025939 Bacteria 32292
189 Ga0207665_10004251 3300025939 Bacteria 9518
190 Ga0207665_10211709 3300025939 Bacteria 1416
191 Ga0207689_10014796 3300025942 Bacteria 6623
192 Ga0207661_10069828 3300025944 Bacteria 2866
193 Ga0207661_10211176 3300025944 Bacteria 1711
194 Ga0207679_10218082 3300025945 Bacteria 1604
195 Ga0207667_10056138 3300025949 Bacteria 4138
196 Ga0207667_10293510 3300025949 Bacteria 1661
197 Ga0207667_10296959 3300025949 Bacteria 1650
198 Ga0207651_10201157 3300025960 Bacteria 1597
199 Ga0207712_10034738 3300025961 Bacteria 3419
200 Ga0207677_10129360 3300026023 Bacteria 1914
201 Ga0207639_10133809 3300026041 Bacteria 2056
202 Ga0207678_10184297 3300026067 Bacteria 1783
203 Ga0207708_10174723 3300026075 Unclassified 1703
204 Ga0207702_10032479 3300026078 Unclassified 4356
205 Ga0207641_10586822 3300026088 Bacteria 1090
206 Ga0207648_10069483 3300026089 Bacteria 3069
207 Ga0207674_10011122 3300026116 Bacteria 10120
208 Ga0207674_10027334 3300026116 Bacteria 6037
209 Ga0207675_100029731 3300026118 Bacteria 5088
210 Ga0207675_100119038 3300026118 Bacteria 2498
211 Ga0207675_100196328 3300026118 Bacteria 1937
212 Ga0207683_10001247 3300026121 Bacteria 23079
213 Ga0207683_10011872 3300026121 Bacteria 7433
214 Ga0207683_10463312 3300026121 Unclassified 1169
215 Ga0207683_10697262 3300026121 Bacteria 941
216 Ga0207698_10095007 3300026142 Bacteria 2453
217 Ga0207698_10199518 3300026142 Bacteria 1790
218 Ga0268266_10322646 3300028379 Bacteria 1446
219 Ga0268266_10377866 3300028379 Bacteria 1336
220 Ga0268264_10116041 3300028381 Bacteria 2353
221 Ga0265334_10013764 3300028573 Bacteria 3382
222 Ga0265318_10072417 3300028577 Bacteria 1277
223 Ga0265322_10006559 3300028654 Bacteria 3425
224 Ga0265322_10037701 3300028654 Unclassified 1377
225 Ga0265338_10102682 3300028800 Bacteria 2325
226 Ga0265338_10108443 3300028800 Unclassified 2242
227 Ga0265325_10051941 3300031241 Archaea 2106
228 Ga0265339_10028816 3300031249 Bacteria 3155
229 Ga0265331_10163745 3300031250 Unclassified 1008
230 Ga0265327_10057402 3300031251 Bacteria 2002
231 Ga0265327_10108660 3300031251 Bacteria 1328
232 Ga0265316_10114147 3300031344 Bacteria 2043
233 Ga0265316_10216921 3300031344 Unclassified 1413
234 Ga0265313_10030460 3300031595 Bacteria 2778
235 Ga0265314_10078607 3300031711 Bacteria 2183
236 Ga0265314_10109095 3300031711 Bacteria 1762
237 Ga0307409_100538777 3300031995 Bacteria 1144
238 Ga0316583_10043880 3300032133 Bacteria 1580
239 Ga0373930_0004466 3300034816 Bacteria 2279
240 Ga0373948_0009152 3300034817 Bacteria 1703
241 Ga0373926_0012244 3300035083 Bacteria 2899
242 Ga0373944_0032446 3300035089 Bacteria 1577
243 Ga0373932_0032628 3300035112 Bacteria 1458
244 Ga0373945_0058512 3300035116 Bacteria 1433
245 Ga0373943_0000101 3300035170 Bacteria 31609
246 Ga0373931_0036118 3300035691 Bacteria 2574
247 Ga0373931_0106897 3300035691 Bacteria 1582
248 Ga0373935_0003186 3300035692 Bacteria 9463
249 Ga0373927_0150169 3300035695 Bacteria 1526
250 Ga0373947_0004085 3300035725 Bacteria 8591
251 Ga0373925_0001828 3300037068 Bacteria 17755
252 Ga0395900_0084052 3300037418 Bacteria 3270
253 Ga0395900_0184041 3300037418 Bacteria 2121
254 Ga0395900_0365278 3300037418 Bacteria 1414
255 Ga0395898_0510289 3300037466 Unclassified 1143
256 Ga0395898_0534711 3300037466 Bacteria 1114
257 Ga0395905_0077807 3300037471 Bacteria 3108
258 Ga0395901_0166844 3300038443 Bacteria 2311
259 Ga0395901_0475554 3300038443 Bacteria 1275
260 Ga0395901_0525869 3300038443 Bacteria 1201
261 Ga0436363_0595820 3300039450 Bacteria 1105
262 Ga0436362_0686300 3300039453 Unclassified 2217
263 Ga0466965_0069704 3300044683 Unclassified 1767
264 Ga0466964_0000569 3300044706 Bacteria 11600
265 Ga0466964_0002988 3300044706 Bacteria 6122
266 Ga0466968_0011453 3300044735 Bacteria 3455
267 Ga0466960_0048495 3300044901 Bacteria 2041
268 Ga0466959_0083028 3300045049 Bacteria 2308
269 Ga0466967_0010340 3300045976 Bacteria 6994
270 Ga0466967_0015053 3300045976 Bacteria 6052
271 Ga0466967_0057653 3300045976 Bacteria 3429
272 Ga0466967_0110335 3300045976 Bacteria 2527
273 Ga0466967_0361864 3300045976 Bacteria 1406
274 Ga0466967_0380127 3300045976 Bacteria 1371
275 Ga0466967_0430944 3300045976 Bacteria 1286
276 Ga0495592_0125339 3300046454 Bacteria 1803
277 Ga0495603_0021818 3300046455 Bacteria 3877
278 Ga0495603_0037788 3300046455 Bacteria 2896
279 Ga0495629_0036163 3300046459 Bacteria 3487
280 Ga0495629_0176740 3300046459 Bacteria 1480
281 Ga0495629_0251511 3300046459 Bacteria 1216
282 Ga0495641_0000374 3300046461 Bacteria 37120
283 Ga0495651_0018440 3300046462 Bacteria 5405
284 Ga0495582_0000124 3300046473 Bacteria 41197
285 Ga0495582_0330882 3300046473 Bacteria 877
286 Ga0495639_0000786 3300046475 Bacteria 14467
287 Ga0495662_0000898 3300046476 Bacteria 14537
288 Ga0495664_0088813 3300046477 Bacteria 1858
289 Ga0495594_0044286 3300046499 Bacteria 2441
290 Ga0495594_0339854 3300046499 Bacteria 855
291 Ga0495608_0029476 3300046511 Bacteria 3721
292 Ga0495608_0299618 3300046511 Bacteria 995
293 Ga0495618_0164854 3300046514 Bacteria 1411
294 Ga0495628_0133083 3300046516 Bacteria 1901
295 Ga0495630_0604690 3300046517 Bacteria 840
296 Ga0495652_0126226 3300046529 Bacteria 2032
297 Ga0495652_0317038 3300046529 Unclassified 1128
298 Ga0495665_0000249 3300046531 Bacteria 27073
299 Ga0495665_0268077 3300046531 Bacteria 877
300 Ga0495640_0070726 3300046533 Bacteria 2343
301 Ga0495640_0138151 3300046533 Bacteria 1572
302 Ga0495586_0222333 3300046535 Bacteria 1073
303 Ga0495587_0090060 3300046536 Bacteria 1772
304 Ga0495645_0124999 3300046543 Unclassified 1808
305 Ga0495645_0133557 3300046543 Bacteria 1737
306 Ga0495667_0002397 3300046559 Bacteria 12532
307 Ga0495634_0008524 3300046642 Bacteria 7622
308 Ga0495634_0085229 3300046642 Bacteria 2059
309 Ga0495634_0174077 3300046642 Bacteria 1351
310 Ga0495634_0340736 3300046642 Bacteria 899
311 Ga0495635_0045626 3300046663 Bacteria 3024
312 Ga0495635_0127213 3300046663 Bacteria 1737
313 Ga0495599_0079989 3300046678 Bacteria 2041
314 Ga0495599_0185004 3300046678 Bacteria 1283
315 Ga0495646_0064397 3300046680 Bacteria 2173
316 Ga0495647_0004080 3300046681 Bacteria 4720
317 Ga0495647_0079636 3300046681 Bacteria 1326
318 Ga0495658_0000247 3300046683 Bacteria 30977
319 Ga0495658_0018275 3300046683 Bacteria 3642
320 Ga0495613_0013675 3300046689 Bacteria 6021
321 Ga0495624_0010741 3300046690 Bacteria 6310
322 Ga0495600_0017559 3300046809 Bacteria 4553
323 Ga0495600_0053490 3300046809 Bacteria 2637
324 Ga0495581_0313414 3300047315 Bacteria 917
325 Ga0495604_0118748 3300047317 Bacteria 1916
326 Ga0495674_0003941 3300047319 Bacteria 14400
327 Ga0495674_0108766 3300047319 Bacteria 2352
328 Ga0495674_0135729 3300047319 Bacteria 2070
329 Ga0495676_0001077 3300047321 Bacteria 23118
330 Ga0495676_0103503 3300047321 Bacteria 2102
331 Ga0495680_0011046 3300047322 Bacteria 8022
332 Ga0495680_0043068 3300047322 Bacteria 3577
333 Ga0495684_0001855 3300047471 Bacteria 16919
334 Ga0495684_0026636 3300047471 Bacteria 4443
335 Ga0495593_0012759 3300047673 Bacteria 4798
336 Ga0496100_0006457 3300048903 Bacteria 6393
337 Ga0496100_0089440 3300048903 Bacteria 2098
338 Ga0496100_0595008 3300048903 Bacteria 858
339 Ga0496101_0009578 3300048904 Bacteria 6371
340 Ga0496101_0070354 3300048904 Bacteria 2562
341 Ga0496101_0176726 3300048904 Unclassified 1642
342 Ga0496101_0345786 3300048904 Bacteria 1168
343 Ga0496102_0025463 3300048905 Bacteria 5267
344 Ga0496102_0184006 3300048905 Bacteria 1968
345 Ga0496103_0043753 3300048906 Bacteria 2758
346 Ga0496103_0067695 3300048906 Bacteria 2230
347 Ga0496104_0083771 3300048907 Bacteria 3041
348 Ga0496104_0085255 3300048907 Bacteria 3015
349 Ga0496104_0103461 3300048907 Bacteria 2728
350 Ga0496104_0239294 3300048907 Bacteria 1727
351 Ga0496105_0008293 3300048908 Bacteria 8075
352 Ga0496105_0044984 3300048908 Bacteria 3642
353 Ga0496105_0260453 3300048908 Bacteria 1402
354 Ga0496106_0008985 3300048909 Bacteria 7382
355 Ga0496106_0018010 3300048909 Bacteria 5222
356 Ga0496107_0003633 3300048910 Bacteria 10359
357 Ga0496108_0023497 3300048911 Bacteria 5073
358 Ga0496108_0054227 3300048911 Bacteria 3364
359 Ga0496108_0072278 3300048911 Bacteria 2911
360 Ga0496108_0114038 3300048911 Bacteria 2313
361 Ga0496109_0000626 3300048912 Bacteria 29449
362 Ga0496109_0014816 3300048912 Bacteria 6785
363 Ga0496109_0369151 3300048912 Bacteria 1356
364 Ga0496109_0384122 3300048912 Bacteria 1326
365 Ga0496109_0421167 3300048912 Bacteria 1261
366 Ga0496109_0528630 3300048912 Bacteria 1113
367 Ga0496110_0000261 3300048913 Bacteria 34222
368 Ga0496110_0020550 3300048913 Bacteria 5576
369 Ga0496110_0171642 3300048913 Bacteria 1968
370 Ga0496110_0378169 3300048913 Bacteria 1290
371 Ga0496110_0439853 3300048913 Bacteria 1188
372 Ga0496111_0000086 3300048914 Bacteria 39141
373 Ga0496111_0025959 3300048914 Bacteria 4134
374 Ga0496111_0085870 3300048914 Bacteria 2301
375 Ga0496111_0136282 3300048914 Bacteria 1818
376 Ga0496111_0458424 3300048914 Bacteria 940
377 Ga0496112_0020985 3300048915 Bacteria 6203
378 Ga0496112_0093840 3300048915 Bacteria 2971
379 Ga0496112_0173621 3300048915 Unclassified 2121
380 Ga0496112_0257088 3300048915 Bacteria 1696
381 Ga0496113_0070540 3300048916 Bacteria 2656
382 Ga0496113_0227347 3300048916 Bacteria 1487
383 Ga0496114_0001144 3300048917 Bacteria 20053
384 Ga0496114_0037136 3300048917 Bacteria 4029
385 Ga0496114_0080610 3300048917 Bacteria 2749
386 Ga0496114_0157784 3300048917 Bacteria 1971
387 Ga0496114_0176864 3300048917 Bacteria 1862
388 Ga0496114_0226908 3300048917 Bacteria 1640
389 Ga0496115_0014466 3300048918 Bacteria 5973
390 Ga0496115_0016034 3300048918 Bacteria 5698
391 Ga0496115_0420932 3300048918 Unclassified 1082
392 Ga0501040_0048507 3300049576 Bacteria 2902
393 Ga0501046_0123557 3300049580 Bacteria 1968
394 Ga0501047_0009800 3300049581 Bacteria 9053
395 Ga0501067_0000684 3300049583 Bacteria 18236
396 Ga0501067_0041378 3300049583 Unclassified 2559
397 Ga0501067_0104866 3300049583 Bacteria 1571
398 Ga0501069_0053306 3300049585 Bacteria 2252
399 Ga0501069_0175995 3300049585 Unclassified 1236
400 Ga0501070_0000187 3300049586 Bacteria 58257
401 Ga0501070_0089652 3300049586 Bacteria 2545
402 Ga0501070_0204416 3300049586 Bacteria 1622
403 Ga0501073_0536339 3300049589 Bacteria 809
404 Ga0501077_0061461 3300049593 Bacteria 2384
405 Ga0501080_0658255 3300049742 Bacteria 926
406 Ga0501080_0714644 3300049742 Bacteria 883
407 Ga0501044_0476755 3300049823 Unclassified 1151
408 nmdc:mga08y16_142800_c1 3300050511 Bacteria 2489
409 nmdc:mga0n895_817464_c1 3300050512 Bacteria 921
410 nmdc:mga0rr50_284766_c1 3300050513 Unclassified 1380
411 nmdc:mga0a205_263621_c1 3300050515 Bacteria 1600
412 Ga0495601_0063104 3300053077 Bacteria 2354
413 Ga0495601_0141683 3300053077 Bacteria 1568
414 Ga0495595_0014748 3300053084 Bacteria 3321
415 Ga0495595_0154561 3300053084 Bacteria 1130
416 Ga0495619_0002878 3300053085 Bacteria 11188
417 Ga0495619_0032007 3300053085 Bacteria 3410
418 Ga0530510_0038486 3300061734 Bacteria 3453
419 Ga0530510_0491308 3300061734 Unclassified 930
420 Ga0501069_0012725
421 Ga0070658_10929179
422 Ga0070676_10096346
423 Ga0070683_100033750
424 Ga0070683_100046782
425 Ga0070683_100101570
426 Ga0070683_100237369
427 Ga0070683_100846331
428 Ga0070666_10181881
429 Ga0070680_100034051
430 Ga0070680_100045002
431 Ga0070682_100003925
432 Ga0070682_100026553
433 Ga0070682_100213579
434 Ga0070682_100457674
435 Ga0070660_100153731
436 Ga0070660_100231034
437 Ga0070660_100492173
438 Ga0070689_100252457
439 Ga0070661_100020146
440 Ga0070661_100021426
441 Ga0070661_100051038
442 Ga0070668_100030366
443 Ga0070669_100627139
444 Ga0070671_100394758
445 Ga0070674_100029669
446 Ga0070688_100081944
447 Ga0070659_100032737
448 Ga0070659_100199928
449 Ga0070659_100653300
450 Ga0070667_100003011
451 Ga0070667_100113633
452 Ga0070709_10004518
453 Ga0070714_100007151
454 Ga0070714_100068287
455 Ga0070714_100293763
456 Ga0070713_100015415
457 Ga0070710_10000589
458 Ga0070710_10045324
459 Ga0070710_10203210
460 Ga0070711_100028555
461 Ga0070711_100658235
462 Ga0070678_100015166
463 Ga0070678_100796075
464 Ga0070662_100610381
465 Ga0070681_10001213
466 Ga0070681_10028524
467 Ga0070681_10111937
468 Ga0070681_10273482
469 Ga0070706_100722489
470 Ga0070707_100126302
471 Ga0070707_100349495
472 Ga0070679_100020574
473 Ga0070679_100058769
474 Ga0070679_100257485
475 Ga0070679_100503757
476 Ga0070679_100651352
477 Ga0070684_100153970
478 Ga0070684_100378178
479 Ga0068853_100092663
480 Ga0070686_100165073
481 Ga0070696_100006574
482 Ga0070696_100343831
483 Ga0070704_100184745
484 Ga0068855_100022769
485 Ga0068855_100063071
486 Ga0068855_100229107
487 Ga0068855_100294702
488 Ga0068855_100340464
489 Ga0068855_100480871
490 Ga0068855_100783668
491 Ga0070664_100301050
492 Ga0068857_100020406
493 Ga0070702_100007090
494 Ga0068852_100027110
495 Ga0068859_100351648
496 Ga0068861_100012086
497 Ga0068861_100159231
498 Ga0068861_100172981
499 Ga0068860_100187173
500 Ga0068862_100201535
501 Ga0081455_10112841
502 Ga0070717_10007774
503 Ga0070717_10569067
504 Ga0070715_10001156
505 Ga0070716_100001585
506 Ga0070716_100184106
507 Ga0070712_100014439
508 Ga0070712_100021761
509 Ga0068865_100027554
510 Ga0068865_100294766
511 Ga0097620_100351639
512 Ga0105245_10062183
513 Ga0105245_10096920
514 Ga0105245_10175091
515 Ga0105243_10025180
516 Ga0105243_10066138
517 Ga0105241_10234777
518 Ga0105241_10795463
519 Ga0105248_10516357
520 Ga0105237_10026541
521 Ga0105237_10039262
522 Ga0105237_10383353
523 Ga0105238_10051504
524 Ga0105238_10101835
525 Ga0105238_10411086
526 Ga0105249_10128814
527 Ga0105239_10086570
528 Ga0105239_10114810
529 Ga0105239_10122381
530 Ga0105239_10324741
531 Ga0105246_10231227
532 Ga0157373_10626562
533 Ga0157370_10078188
534 Ga0157369_10002394
535 Ga0157369_10031545
536 Ga0157369_10069558
537 Ga0157374_10159587
538 Ga0157374_10259395
539 Ga0157378_10483780
540 Ga0163162_10286627
541 Ga0157372_10112520
542 Ga0157372_10350715
543 Ga0157372_10381517
544 Ga0157372_10459820
545 Ga0157375_10265623
546 Ga0163163_10245907
547 Ga0157380_10159507
548 Ga0182008_10294618
549 Ga0157377_10026651
550 Ga0157377_10297420
551 Ga0157379_10384099
552 Ga0157376_10265835
553 Ga0197907_10515275
554 Ga0206354_11597686
555 Ga0206353_10248095
556 Ga0206353_10712429
557 Ga0206353_10854838
558 Ga0207692_10023818
559 Ga0207692_10039592
560 Ga0207688_10029378
561 Ga0207688_10075685
562 Ga0207680_10058068
563 Ga0207699_10001650
564 Ga0207699_10218279
565 Ga0207705_10030001
566 Ga0207705_10214391
567 Ga0207654_10017166
568 Ga0207707_10002380
569 Ga0207707_10004067
570 Ga0207671_10142125
571 Ga0207693_10000662
572 Ga0207693_10001862
573 Ga0207693_10003040
574 Ga0207693_10051274
575 Ga0207663_10000565
576 Ga0207660_10005698
577 Ga0207660_10680470
578 Ga0207657_10000941
579 Ga0207657_10001075
580 Ga0207657_10132604
581 Ga0207657_10527427
582 Ga0207649_10011602
583 Ga0207652_10089158
584 Ga0207652_10109900
585 Ga0207652_10155906
586 Ga0207652_10308552
587 Ga0207652_10541038
588 Ga0207646_10101662
589 Ga0207646_10248648
590 Ga0207646_10398159
591 Ga0207694_10100251
592 Ga0207659_10153560
593 Ga0207687_10051800
594 Ga0207687_10202875
595 Ga0207700_10010728
596 Ga0207700_10206732
597 Ga0207664_10005373
598 Ga0207664_10104816
599 Ga0207664_10107925
600 Ga0207664_10243237
601 Ga0207644_10389878
602 Ga0207644_10669261
603 Ga0207690_10047800
604 Ga0207706_10077263
605 Ga0207709_10011716
606 Ga0207670_10085364
607 Ga0207665_10000344
608 Ga0207665_10004251
609 Ga0207665_10211709
610 Ga0207689_10014796
611 Ga0207661_10069828
612 Ga0207661_10211176
613 Ga0207679_10218082
614 Ga0207667_10056138
615 Ga0207667_10293510
616 Ga0207667_10296959
617 Ga0207651_10201157
618 Ga0207712_10034738
619 Ga0207677_10129360
620 Ga0207639_10133809
621 Ga0207678_10184297
622 Ga0207708_10174723
623 Ga0207702_10032479
624 Ga0207641_10586822
625 Ga0207648_10069483
626 Ga0207674_10011122
627 Ga0207674_10027334
628 Ga0207675_100029731
629 Ga0207675_100119038
630 Ga0207675_100196328
631 Ga0207683_10001247
632 Ga0207683_10011872
633 Ga0207683_10463312
634 Ga0207683_10697262
635 Ga0207698_10095007
636 Ga0207698_10199518
637 Ga0268266_10322646
638 Ga0268266_10377866
639 Ga0268264_10116041
640 Ga0265334_10013764
641 Ga0265318_10072417
642 Ga0265322_10006559
643 Ga0265322_10037701
644 Ga0265338_10102682
645 Ga0265338_10108443
646 Ga0265325_10051941
647 Ga0265339_10028816
648 Ga0265331_10163745
649 Ga0265327_10057402
650 Ga0265327_10108660
651 Ga0265316_10114147
652 Ga0265316_10216921
653 Ga0265313_10030460
654 Ga0265314_10078607
655 Ga0265314_10109095
656 Ga0307409_100538777
657 Ga0316583_10043880
658 Ga0373930_0004466
659 Ga0373948_0009152
660 Ga0373926_0012244
661 Ga0373944_0032446
662 Ga0373932_0032628
663 Ga0373945_0058512
664 Ga0373943_0000101
665 Ga0373931_0036118
666 Ga0373931_0106897
667 Ga0373935_0003186
668 Ga0373927_0150169
669 Ga0373947_0004085
670 Ga0373925_0001828
671 Ga0395900_0084052
672 Ga0395900_0184041
673 Ga0395900_0365278
674 Ga0395898_0510289
675 Ga0395898_0534711
676 Ga0395905_0077807
677 Ga0395901_0166844
678 Ga0395901_0475554
679 Ga0395901_0525869
680 Ga0436363_0595820
681 Ga0436362_0686300
682 Ga0466965_0069704
683 Ga0466964_0000569
684 Ga0466964_0002988
685 Ga0466968_0011453
686 Ga0466960_0048495
687 Ga0466959_0083028
688 Ga0466967_0010340
689 Ga0466967_0015053
690 Ga0466967_0057653
691 Ga0466967_0110335
692 Ga0466967_0361864
693 Ga0466967_0380127
694 Ga0466967_0430944
695 Ga0495592_0125339
696 Ga0495603_0021818
697 Ga0495603_0037788
698 Ga0495629_0036163
699 Ga0495629_0176740
700 Ga0495629_0251511
701 Ga0495641_0000374
702 Ga0495651_0018440
703 Ga0495582_0000124
704 Ga0495582_0330882
705 Ga0495639_0000786
706 Ga0495662_0000898
707 Ga0495664_0088813
708 Ga0495594_0044286
709 Ga0495594_0339854
710 Ga0495608_0029476
711 Ga0495608_0299618
712 Ga0495618_0164854
713 Ga0495628_0133083
714 Ga0495630_0604690
715 Ga0495652_0126226
716 Ga0495652_0317038
717 Ga0495665_0000249
718 Ga0495665_0268077
719 Ga0495640_0070726
720 Ga0495640_0138151
721 Ga0495586_0222333
722 Ga0495587_0090060
723 Ga0495645_0124999
724 Ga0495645_0133557
725 Ga0495667_0002397
726 Ga0495634_0008524
727 Ga0495634_0085229
728 Ga0495634_0174077
729 Ga0495634_0340736
730 Ga0495635_0045626
731 Ga0495635_0127213
732 Ga0495599_0079989
733 Ga0495599_0185004
734 Ga0495646_0064397
735 Ga0495647_0004080
736 Ga0495647_0079636
737 Ga0495658_0000247
738 Ga0495658_0018275
739 Ga0495613_0013675
740 Ga0495624_0010741
741 Ga0495600_0017559
742 Ga0495600_0053490
743 Ga0495581_0313414
744 Ga0495604_0118748
745 Ga0495674_0003941
746 Ga0495674_0108766
747 Ga0495674_0135729
748 Ga0495676_0001077
749 Ga0495676_0103503
750 Ga0495680_0011046
751 Ga0495680_0043068
752 Ga0495684_0001855
753 Ga0495684_0026636
754 Ga0495593_0012759
755 Ga0496100_0006457
756 Ga0496100_0089440
757 Ga0496100_0595008
758 Ga0496101_0009578
759 Ga0496101_0070354
760 Ga0496101_0176726
761 Ga0496101_0345786
762 Ga0496102_0025463
763 Ga0496102_0184006
764 Ga0496103_0043753
765 Ga0496103_0067695
766 Ga0496104_0083771
767 Ga0496104_0085255
768 Ga0496104_0103461
769 Ga0496104_0239294
770 Ga0496105_0008293
771 Ga0496105_0044984
772 Ga0496105_0260453
773 Ga0496106_0008985
774 Ga0496106_0018010
775 Ga0496107_0003633
776 Ga0496108_0023497
777 Ga0496108_0054227
778 Ga0496108_0072278
779 Ga0496108_0114038
780 Ga0496109_0000626
781 Ga0496109_0014816
782 Ga0496109_0369151
783 Ga0496109_0384122
784 Ga0496109_0421167
785 Ga0496109_0528630
786 Ga0496110_0000261
787 Ga0496110_0020550
788 Ga0496110_0171642
789 Ga0496110_0378169
790 Ga0496110_0439853
791 Ga0496111_0000086
792 Ga0496111_0025959
793 Ga0496111_0085870
794 Ga0496111_0136282
795 Ga0496111_0458424
796 Ga0496112_0020985
797 Ga0496112_0093840
798 Ga0496112_0173621
799 Ga0496112_0257088
800 Ga0496113_0070540
801 Ga0496113_0227347
802 Ga0496114_0001144
803 Ga0496114_0037136
804 Ga0496114_0080610
805 Ga0496114_0157784
806 Ga0496114_0176864
807 Ga0496114_0226908
808 Ga0496115_0014466
809 Ga0496115_0016034
810 Ga0496115_0420932
811 Ga0501040_0048507
812 Ga0501046_0123557
813 Ga0501047_0009800
814 Ga0501067_0000684
815 Ga0501067_0041378
816 Ga0501067_0104866
817 Ga0501069_0053306
818 Ga0501069_0175995
819 Ga0501070_0000187
820 Ga0501070_0089652
821 Ga0501070_0204416
822 Ga0501073_0536339
823 Ga0501077_0061461
824 Ga0501080_0658255
825 Ga0501080_0714644
826 Ga0501044_0476755
827 nmdc:mga08y16_142800_c1
828 nmdc:mga0n895_817464_c1
829 nmdc:mga0rr50_284766_c1
830 nmdc:mga0a205_263621_c1
831 Ga0495601_0063104
832 Ga0495601_0141683
833 Ga0495595_0014748
834 Ga0495595_0154561
835 Ga0495619_0002878
836 Ga0495619_0032007
837 Ga0530510_0038486
838 Ga0530510_0491308

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02578

Cu-oxidase_4

Multi-copper polyphenol oxidoreductase laccase

14

216

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xfj-assembly1.cif.gz_A crystal structure of protein cc_0490 from caulobacter crescentus, pfam duf152 0.9247 7 224
1xaf-assembly1.cif.gz_B crystal structure of protein of unknown function yfih from shigella flexneri 2a str. 2457t 0.917 4 224
1z9t-assembly1.cif.gz_A crystal structure of a putative laccase (yfih) from escherichia coli at 1.54 a resolution 0.9154 4 224
1rw0-assembly1.cif.gz_B crystal structure of protein yfih from salmonella enterica serovar typhi, pfam duf152 0.9153 4 224
7f3v-assembly2.cif.gz_B crystal structure of yfih with c107a mutation in complex with endogenous udp-murnac 0.9129 4 224
ID Description Score Start End Superfamily
af_Q8IV20_177_430_3.60.140.10 Alpha Beta;4-Layer Sandwich;CNF1/YfiH-like putative cysteine hydrolases;CNF1/YfiH-like putative cysteine hydrolases 0.923 6 223 3.60.140.10
1xfjA00 Alpha Beta;4-Layer Sandwich;CNF1/YfiH-like putative cysteine hydrolases;CNF1/YfiH-like putative cysteine hydrolases 0.9155 7 224 3.60.140.10
1rv9A00 Alpha Beta;4-Layer Sandwich;CNF1/YfiH-like putative cysteine hydrolases;CNF1/YfiH-like putative cysteine hydrolases 0.9107 6 223 3.60.140.10
af_P9WKD5_9_250_3.60.140.10 Alpha Beta;4-Layer Sandwich;CNF1/YfiH-like putative cysteine hydrolases;CNF1/YfiH-like putative cysteine hydrolases 0.91 9 222 3.60.140.10
1xafA00 Alpha Beta;4-Layer Sandwich;CNF1/YfiH-like putative cysteine hydrolases;CNF1/YfiH-like putative cysteine hydrolases 0.8998 2 224 3.60.140.10
ID Description Score Start End GO Terms
AF-A0A7W1LHN2-F1-model_v4 Laccase domain-containing protein 0.9872 1 200 GO:0005507
GO:0016740
GO:0016787
AF-A0A538KMG9-F1-model_v4 Laccase domain-containing protein 0.9856 1 161 GO:0004000
GO:0005507
GO:0017061
GO:0046936
AF-A0A538BSP7-F1-model_v4 Laccase domain-containing protein 0.9831 2 224 GO:0004000
GO:0005507
GO:0017061
GO:0046936
AF-A0A537ZV21-F1-model_v4 Laccase domain-containing protein 0.9822 1 224 GO:0004000
GO:0005507
GO:0017061
GO:0046936
AF-A0A538H037-F1-model_v4 Laccase domain-containing protein 0.9796 2 132 GO:0004000
GO:0005507
GO:0017061
GO:0046936

Map