F439573

General Info

Members Datasets Scaffolds Average Seq Length
419 161 419 67

Family's Representative Sequence

Representative Sequence 3300044694|Ga0466963_0215780|Ga0466963_0215780_367_600
Length 77
Sequence VARENVRMIPMKTSSVFKSRWMALLWAAGIIWFAYDFAGSQPQPANSTDNAEQATDASGAPVTADDEKKFAAELNSF

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
67 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
112 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
113 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
114 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
115 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
116 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
117 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
118 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
119 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
120 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
121 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
122 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
123 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
124 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
125 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
126 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
127 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
128 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
129 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
130 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
131 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
132 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
133 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
134 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
135 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
136 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
137 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
138 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
139 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
140 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
141 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
142 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
143 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
144 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
145 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
146 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
147 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
148 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
149 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
150 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
151 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
152 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
153 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
154 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
156 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
157 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
158 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
159 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
160 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
161 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.24
Nodule 0
Rhizoplane 3.34
Rhizosphere 96.18
Stem 0
Stem Tuber 0
Unclassified 0.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10030245 3300001979 Unclassified 1766
2 JGI24740J21852_10086993 3300001979 Bacteria 811
3 JGI24739J22299_10010582 3300001989 Bacteria 3423
4 JGI24737J22298_10000548 3300001990 Bacteria 13144
5 JGI24735J21928_10134339 3300002067 Unclassified 713
6 JGI24738J21930_10004476 3300002075 Bacteria 3419
7 Ga0070658_10000220 3300005327 Bacteria 50700
8 Ga0070658_10040951 3300005327 Bacteria 3737
9 Ga0070658_10465735 3300005327 Bacteria 1090
10 Ga0070676_10514731 3300005328 Bacteria 851
11 Ga0070683_100009023 3300005329 Bacteria 8507
12 Ga0070683_100172698 3300005329 Bacteria 2052
13 Ga0070683_100278811 3300005329 Bacteria 1590
14 Ga0070670_100021908 3300005331 Bacteria 5498
15 Ga0070677_10229384 3300005333 Bacteria 911
16 Ga0068869_102138768 3300005334 Unclassified 503
17 Ga0070666_10001568 3300005335 Bacteria 13884
18 Ga0070666_10441579 3300005335 Unclassified 939
19 Ga0070666_10550638 3300005335 Unclassified 839
20 Ga0070666_10862053 3300005335 Unclassified 669
21 Ga0070680_100000406 3300005336 Bacteria 29408
22 Ga0070680_100002258 3300005336 Bacteria 14240
23 Ga0070682_100092205 3300005337 Bacteria 1984
24 Ga0068868_100331012 3300005338 Unclassified 1300
25 Ga0068868_100959346 3300005338 Bacteria 780
26 Ga0070660_100000218 3300005339 Bacteria 37921
27 Ga0070660_100051835 3300005339 Bacteria 3162
28 Ga0070660_100350536 3300005339 Bacteria 1215
29 Ga0070660_100547812 3300005339 Bacteria 965
30 Ga0070660_100682283 3300005339 Bacteria 861
31 Ga0070691_10458632 3300005341 Bacteria 729
32 Ga0070661_100000181 3300005344 Bacteria 52052
33 Ga0070661_100236547 3300005344 Bacteria 1405
34 Ga0070661_100954508 3300005344 Bacteria 710
35 Ga0070692_10076875 3300005345 Bacteria 1790
36 Ga0070692_10190763 3300005345 Bacteria 1194
37 Ga0070668_100185471 3300005347 Bacteria 1701
38 Ga0070669_100484627 3300005353 Bacteria 1024
39 Ga0070671_100010875 3300005355 Bacteria 7306
40 Ga0070671_100024791 3300005355 Bacteria 4914
41 Ga0070671_100025393 3300005355 Bacteria 4861
42 Ga0070674_100191136 3300005356 Bacteria 1575
43 Ga0070673_100846563 3300005364 Bacteria 846
44 Ga0070659_100000310 3300005366 Bacteria 37921
45 Ga0070659_100095807 3300005366 Bacteria 2384
46 Ga0070659_100976473 3300005366 Bacteria 743
47 Ga0070659_101208652 3300005366 Bacteria 669
48 Ga0070659_101611192 3300005366 Unclassified 580
49 Ga0070667_100022597 3300005367 Bacteria 5214
50 Ga0070667_100061356 3300005367 Bacteria 3183
51 Ga0070667_100086450 3300005367 Bacteria 2690
52 Ga0070667_100276642 3300005367 Bacteria 1506
53 Ga0070667_100324848 3300005367 Bacteria 1389
54 Ga0070667_101564913 3300005367 Unclassified 619
55 Ga0070709_10901279 3300005434 Unclassified 699
56 Ga0070714_100402898 3300005435 Bacteria 1293
57 Ga0070714_100694449 3300005435 Bacteria 981
58 Ga0070714_100842566 3300005435 Bacteria 889
59 Ga0070714_100939988 3300005435 Unclassified 840
60 Ga0070713_100730959 3300005436 Unclassified 946
61 Ga0070711_102050315 3300005439 Unclassified 503
62 Ga0070663_100087618 3300005455 Bacteria 2301
63 Ga0070663_100583600 3300005455 Bacteria 938
64 Ga0070678_100026734 3300005456 Bacteria 3908
65 Ga0070678_101413197 3300005456 Bacteria 650
66 Ga0070662_100000080 3300005457 Bacteria 53280
67 Ga0070662_100004660 3300005457 Bacteria 8696
68 Ga0070662_101651819 3300005457 Unclassified 553
69 Ga0070681_10928528 3300005458 Bacteria 789
70 Ga0068867_100069921 3300005459 Bacteria 2623
71 Ga0070679_100070012 3300005530 Bacteria 3499
72 Ga0070679_100110295 3300005530 Bacteria 2738
73 Ga0070679_100198682 3300005530 Bacteria 1972
74 Ga0070679_100499092 3300005530 Unclassified 1161
75 Ga0070679_101084002 3300005530 Unclassified 746
76 Ga0070684_100674478 3300005535 Unclassified 963
77 Ga0070684_100702526 3300005535 Bacteria 943
78 Ga0070684_101239582 3300005535 Unclassified 702
79 Ga0068853_100000134 3300005539 Bacteria 50184
80 Ga0068853_100107295 3300005539 Bacteria 2476
81 Ga0070672_100290152 3300005543 Bacteria 1385
82 Ga0070686_100716743 3300005544 Bacteria 799
83 Ga0070686_101234730 3300005544 Unclassified 622
84 Ga0070693_100000536 3300005547 Bacteria 17016
85 Ga0070665_100045739 3300005548 Bacteria 4396
86 Ga0070665_100987857 3300005548 Archaea 854
87 Ga0068855_100043926 3300005563 Bacteria 5291
88 Ga0068855_100064651 3300005563 Bacteria 4267
89 Ga0068855_100070838 3300005563 Bacteria 4055
90 Ga0068855_100209046 3300005563 Bacteria 2194
91 Ga0068855_100215621 3300005563 Bacteria 2155
92 Ga0068855_100509767 3300005563 Bacteria 1306
93 Ga0070664_100000047 3300005564 Bacteria 73560
94 Ga0068857_100305520 3300005577 Unclassified 1467
95 Ga0068854_100012702 3300005578 Bacteria 5515
96 Ga0068854_100083626 3300005578 Bacteria 2360
97 Ga0068854_100108885 3300005578 Bacteria 2087
98 Ga0068854_101964826 3300005578 Bacteria 539
99 Ga0068856_100001328 3300005614 Bacteria 26042
100 Ga0068856_100056308 3300005614 Bacteria 3879
101 Ga0068856_100466005 3300005614 Unclassified 1284
102 Ga0068856_100568954 3300005614 Bacteria 1154
103 Ga0068856_101434384 3300005614 Bacteria 704
104 Ga0068856_101468637 3300005614 Bacteria 696
105 Ga0068852_100002050 3300005616 Bacteria 13737
106 Ga0068852_100002251 3300005616 Bacteria 13240
107 Ga0068852_100014063 3300005616 Bacteria 6143
108 Ga0068852_100015243 3300005616 Bacteria 5952
109 Ga0068852_100200323 3300005616 Bacteria 1889
110 Ga0068852_100321415 3300005616 Unclassified 1503
111 Ga0068852_100450182 3300005616 Bacteria 1274
112 Ga0068852_100870838 3300005616 Bacteria 917
113 Ga0068864_100052557 3300005618 Bacteria 3512
114 Ga0068863_100544868 3300005841 Unclassified 1145
115 Ga0068858_100023710 3300005842 Bacteria 5717
116 Ga0068860_100060777 3300005843 Bacteria 3591
117 Ga0068860_100207376 3300005843 Bacteria 1901
118 Ga0068860_101971064 3300005843 Unclassified 605
119 Ga0068862_100005042 3300005844 Bacteria 11111
120 Ga0068862_100743201 3300005844 Bacteria 954
121 Ga0070716_100772781 3300006173 Bacteria 741
122 Ga0070712_102028139 3300006175 Bacteria 504
123 Ga0068865_100098745 3300006881 Bacteria 2134
124 Ga0105240_10013759 3300009093 Bacteria 11088
125 Ga0105240_10214866 3300009093 Bacteria 2244
126 Ga0105245_12991289 3300009098 Unclassified 524
127 Ga0105241_10077754 3300009174 Bacteria 2591
128 Ga0105241_10168154 3300009174 Unclassified 1809
129 Ga0105248_10000276 3300009177 Bacteria 60451
130 Ga0105248_10040529 3300009177 Bacteria 5221
131 Ga0105248_10048181 3300009177 Bacteria 4780
132 Ga0105237_11459487 3300009545 Unclassified 691
133 Ga0105238_10034298 3300009551 Bacteria 5164
134 Ga0105238_10148872 3300009551 Bacteria 2317
135 Ga0105238_11317270 3300009551 Bacteria 748
136 Ga0105238_12095054 3300009551 Unclassified 600
137 Ga0105238_12377822 3300009551 Unclassified 565
138 Ga0105249_10476786 3300009553 Bacteria 1290
139 Ga0105239_10559959 3300010375 Unclassified 1302
140 Ga0105239_11352700 3300010375 Unclassified 822
141 Ga0105246_10392161 3300011119 Bacteria 1150
142 Ga0105246_11168098 3300011119 Unclassified 707
143 Ga0157373_10007891 3300013100 Bacteria 7920
144 Ga0157373_10274165 3300013100 Bacteria 1195
145 Ga0157373_10428772 3300013100 Unclassified 950
146 Ga0157373_10475017 3300013100 Unclassified 902
147 Ga0157373_10705518 3300013100 Unclassified 739
148 Ga0157371_10006963 3300013102 Bacteria 9209
149 Ga0157371_10034220 3300013102 Bacteria 3645
150 Ga0157371_10058976 3300013102 Unclassified 2722
151 Ga0157371_10154085 3300013102 Bacteria 1639
152 Ga0157371_10944386 3300013102 Bacteria 656
153 Ga0157371_11321199 3300013102 Bacteria 558
154 Ga0157371_11554784 3300013102 Bacteria 517
155 Ga0157370_10020725 3300013104 Bacteria 6560
156 Ga0157370_10192665 3300013104 Bacteria 1892
157 Ga0157370_10214303 3300013104 Bacteria 1784
158 Ga0157370_10369034 3300013104 Bacteria 1322
159 Ga0157370_10815791 3300013104 Unclassified 849
160 Ga0157370_11508725 3300013104 Unclassified 604
161 Ga0157370_11625409 3300013104 Unclassified 580
162 Ga0157369_10077904 3300013105 Bacteria 3552
163 Ga0157369_10236532 3300013105 Bacteria 1908
164 Ga0157369_10320237 3300013105 Bacteria 1612
165 Ga0157369_10346853 3300013105 Bacteria 1542
166 Ga0157369_10842473 3300013105 Bacteria 941
167 Ga0157369_11304533 3300013105 Unclassified 740
168 Ga0157369_11429158 3300013105 Unclassified 704
169 Ga0157374_10007006 3300013296 Bacteria 9595
170 Ga0157378_11324827 3300013297 Unclassified 762
171 Ga0157378_11807379 3300013297 Bacteria 659
172 Ga0157378_11835396 3300013297 Unclassified 655
173 Ga0163162_10031161 3300013306 Bacteria 5288
174 Ga0163162_10966387 3300013306 Archaea 962
175 Ga0157372_10100747 3300013307 Bacteria 3296
176 Ga0157372_10217309 3300013307 Bacteria 2215
177 Ga0157372_10347830 3300013307 Bacteria 1727
178 Ga0157372_10431082 3300013307 Bacteria 1537
179 Ga0157372_10593328 3300013307 Unclassified 1291
180 Ga0157372_10959213 3300013307 Bacteria 991
181 Ga0157372_12026667 3300013307 Bacteria 661
182 Ga0163163_10001248 3300014325 Bacteria 21440
183 Ga0157379_10078482 3300014968 Bacteria 2957
184 Ga0157376_11234513 3300014969 Unclassified 776
185 Ga0163161_10086896 3300017792 Bacteria 2309
186 Ga0163161_10297508 3300017792 Bacteria 1270
187 Ga0207642_10161261 3300025899 Bacteria 1204
188 Ga0207680_10028950 3300025903 Bacteria 3106
189 Ga0207680_10592208 3300025903 Unclassified 793
190 Ga0207705_10123198 3300025909 Bacteria 1925
191 Ga0207705_10185647 3300025909 Bacteria 1571
192 Ga0207705_10235937 3300025909 Bacteria 1392
193 Ga0207705_10486011 3300025909 Unclassified 958
194 Ga0207705_10660276 3300025909 Bacteria 813
195 Ga0207695_10119754 3300025913 Bacteria 2602
196 Ga0207695_10146117 3300025913 Bacteria 2309
197 Ga0207660_10000515 3300025917 Bacteria 25797
198 Ga0207660_10001062 3300025917 Bacteria 18218
199 Ga0207660_10004418 3300025917 Bacteria 9165
200 Ga0207660_10453676 3300025917 Bacteria 1037
201 Ga0207657_10046172 3300025919 Bacteria 3816
202 Ga0207657_10135254 3300025919 Bacteria 2017
203 Ga0207657_10194833 3300025919 Unclassified 1633
204 Ga0207657_11342522 3300025919 Bacteria 539
205 Ga0207649_10121141 3300025920 Bacteria 1764
206 Ga0207649_10293616 3300025920 Bacteria 1186
207 Ga0207649_10361115 3300025920 Unclassified 1078
208 Ga0207652_10076931 3300025921 Bacteria 2911
209 Ga0207652_10268064 3300025921 Unclassified 1540
210 Ga0207681_10756015 3300025923 Bacteria 810
211 Ga0207694_10383349 3300025924 Unclassified 1167
212 Ga0207694_10954473 3300025924 Unclassified 725
213 Ga0207694_11726290 3300025924 Bacteria 527
214 Ga0207664_10013360 3300025929 Bacteria 5890
215 Ga0207664_10163475 3300025929 Bacteria 1900
216 Ga0207664_10319311 3300025929 Bacteria 1370
217 Ga0207644_10124308 3300025931 Bacteria 1967
218 Ga0207690_10065934 3300025932 Bacteria 2478
219 Ga0207690_10084601 3300025932 Bacteria 2224
220 Ga0207690_10565500 3300025932 Unclassified 925
221 Ga0207706_10004820 3300025933 Bacteria 12639
222 Ga0207669_10152890 3300025937 Bacteria 1619
223 Ga0207704_10043056 3300025938 Bacteria 2662
224 Ga0207691_10520686 3300025940 Bacteria 1009
225 Ga0207711_10135155 3300025941 Bacteria 2214
226 Ga0207711_10360660 3300025941 Bacteria 1346
227 Ga0207661_10123031 3300025944 Bacteria 2212
228 Ga0207661_10215114 3300025944 Unclassified 1696
229 Ga0207661_10258944 3300025944 Bacteria 1549
230 Ga0207667_10141230 3300025949 Bacteria 2479
231 Ga0207667_10173335 3300025949 Unclassified 2217
232 Ga0207667_10182114 3300025949 Bacteria 2157
233 Ga0207667_10434749 3300025949 Bacteria 1334
234 Ga0207651_10900522 3300025960 Unclassified 788
235 Ga0207651_11311910 3300025960 Bacteria 651
236 Ga0207668_10098976 3300025972 Bacteria 2162
237 Ga0207668_11244953 3300025972 Bacteria 669
238 Ga0207640_10286204 3300025981 Unclassified 1297
239 Ga0207640_10906708 3300025981 Unclassified 770
240 Ga0207640_11643104 3300025981 Unclassified 579
241 Ga0207658_10055350 3300025986 Bacteria 2939
242 Ga0207658_10236558 3300025986 Bacteria 1544
243 Ga0207658_10331927 3300025986 Archaea 1319
244 Ga0207658_11397846 3300025986 Unclassified 640
245 Ga0207677_10352166 3300026023 Unclassified 1234
246 Ga0207639_10327669 3300026041 Bacteria 1361
247 Ga0207639_11046861 3300026041 Unclassified 765
248 Ga0207702_10156815 3300026078 Bacteria 2076
249 Ga0207702_10197621 3300026078 Bacteria 1862
250 Ga0207702_10348001 3300026078 Bacteria 1417
251 Ga0207648_10551459 3300026089 Bacteria 1059
252 Ga0207683_10093274 3300026121 Bacteria 2683
253 Ga0207683_11435266 3300026121 Bacteria 638
254 Ga0207698_10000986 3300026142 Bacteria 16510
255 Ga0207698_10001169 3300026142 Bacteria 15304
256 Ga0207698_10007388 3300026142 Bacteria 6884
257 Ga0207698_10130564 3300026142 Bacteria 2146
258 Ga0207698_10175750 3300026142 Bacteria 1891
259 Ga0207698_10483748 3300026142 Bacteria 1201
260 Ga0207698_10939002 3300026142 Bacteria 874
261 Ga0207698_12026231 3300026142 Bacteria 590
262 Ga0268266_10019318 3300028379 Bacteria 5805
263 Ga0268266_11026080 3300028379 Archaea 798
264 Ga0268265_10004462 3300028380 Bacteria 9704
265 Ga0268265_10447833 3300028380 Bacteria 1205
266 Ga0268264_10017800 3300028381 Bacteria 5817
267 Ga0268264_10553639 3300028381 Bacteria 1128
268 Ga0307515_10269935 3300028794 Unclassified 1424
269 Ga0373953_0167211 3300035117 Unclassified 946
270 Ga0373954_0225952 3300035118 Unclassified 921
271 Ga0373957_0098322 3300035120 Unclassified 1169
272 Ga0373955_0002452 3300035172 Bacteria 8098
273 Ga0373935_0213541 3300035692 Unclassified 1338
274 Ga0373933_0720137 3300035724 Unclassified 656
275 Ga0373937_0001514 3300036401 Bacteria 19522
276 Ga0395899_0016732 3300037312 Bacteria 5590
277 Ga0395899_0028045 3300037312 Bacteria 4240
278 Ga0395899_0078045 3300037312 Bacteria 2414
279 Ga0395899_0082403 3300037312 Bacteria 2340
280 Ga0395899_0136735 3300037312 Bacteria 1746
281 Ga0395899_0192314 3300037312 Bacteria 1427
282 Ga0395899_0240863 3300037312 Unclassified 1245
283 Ga0395899_0356812 3300037312 Bacteria 976
284 Ga0395899_0395566 3300037312 Bacteria 915
285 Ga0395899_0580238 3300037312 Bacteria 717
286 Ga0395899_0830668 3300037312 Unclassified 568
287 Ga0395900_0027658 3300037418 Bacteria 5809
288 Ga0395900_0063046 3300037418 Bacteria 3810
289 Ga0395900_0119134 3300037418 Bacteria 2709
290 Ga0395900_0165384 3300037418 Bacteria 2254
291 Ga0395900_0180359 3300037418 Bacteria 2146
292 Ga0395900_0207813 3300037418 Bacteria 1978
293 Ga0395900_0251987 3300037418 Bacteria 1766
294 Ga0395900_0286711 3300037418 Bacteria 1637
295 Ga0395900_0541645 3300037418 Unclassified 1109
296 Ga0395900_0599309 3300037418 Unclassified 1042
297 Ga0395900_0631166 3300037418 Unclassified 1009
298 Ga0395900_0861181 3300037418 Bacteria 831
299 Ga0395900_0949203 3300037418 Unclassified 781
300 Ga0395900_1014451 3300037418 Unclassified 749
301 Ga0395900_1104939 3300037418 Bacteria 710
302 Ga0395900_1173944 3300037418 Bacteria 683
303 Ga0395900_1503222 3300037418 Bacteria 585
304 Ga0395900_1566701 3300037418 Unclassified 570
305 Ga0395900_1598785 3300037418 Bacteria 563
306 Ga0395898_0063085 3300037466 Bacteria 3596
307 Ga0395898_0170353 3300037466 Bacteria 2081
308 Ga0395898_0178947 3300037466 Bacteria 2026
309 Ga0395898_0188201 3300037466 Bacteria 1972
310 Ga0395898_0236532 3300037466 Unclassified 1742
311 Ga0395898_0240295 3300037466 Bacteria 1727
312 Ga0395898_0269600 3300037466 Bacteria 1623
313 Ga0395898_0321372 3300037466 Bacteria 1476
314 Ga0395898_0343487 3300037466 Bacteria 1423
315 Ga0395898_0412613 3300037466 Bacteria 1287
316 Ga0395898_0495150 3300037466 Unclassified 1162
317 Ga0395898_0527086 3300037466 Unclassified 1123
318 Ga0395898_0751250 3300037466 Bacteria 916
319 Ga0395905_0020258 3300037471 Bacteria 6301
320 Ga0395905_0054494 3300037471 Bacteria 3742
321 Ga0395905_0079747 3300037471 Bacteria 3068
322 Ga0395905_0125108 3300037471 Bacteria 2417
323 Ga0395905_0250587 3300037471 Bacteria 1654
324 Ga0395905_0259802 3300037471 Bacteria 1621
325 Ga0395905_0389872 3300037471 Bacteria 1287
326 Ga0395905_0457495 3300037471 Unclassified 1174
327 Ga0395905_0504892 3300037471 Unclassified 1109
328 Ga0395905_0697405 3300037471 Unclassified 917
329 Ga0395905_0902560 3300037471 Bacteria 786
330 Ga0395905_1078217 3300037471 Unclassified 706
331 Ga0395905_1208345 3300037471 Unclassified 659
332 Ga0395905_1506481 3300037471 Unclassified 577
333 Ga0395901_0018576 3300038443 Bacteria 7100
334 Ga0395901_0020133 3300038443 Bacteria 6827
335 Ga0395901_0102698 3300038443 Bacteria 3000
336 Ga0395901_0134585 3300038443 Bacteria 2597
337 Ga0395901_0153979 3300038443 Bacteria 2414
338 Ga0395901_0158559 3300038443 Bacteria 2376
339 Ga0395901_0199840 3300038443 Bacteria 2095
340 Ga0395901_0300121 3300038443 Bacteria 1665
341 Ga0395901_0359936 3300038443 Bacteria 1500
342 Ga0395901_0539549 3300038443 Bacteria 1183
343 Ga0395901_0698198 3300038443 Bacteria 1012
344 Ga0395901_0713291 3300038443 Bacteria 999
345 Ga0395901_1009644 3300038443 Unclassified 807
346 Ga0395901_1236403 3300038443 Bacteria 711
347 Ga0395901_1335085 3300038443 Bacteria 678
348 Ga0395901_1565049 3300038443 Unclassified 613
349 Ga0451807_0571521 3300041486 Bacteria 597
350 Ga0466969_0035747 3300044656 Bacteria 2512
351 Ga0466969_0041854 3300044656 Bacteria 2290
352 Ga0466965_0422507 3300044683 Bacteria 739
353 Ga0466966_0016847 3300044684 Bacteria 4829
354 Ga0466966_0051018 3300044684 Bacteria 2630
355 Ga0466961_0196745 3300044693 Bacteria 1248
356 Ga0466961_0392714 3300044693 Unclassified 842
357 Ga0466963_0003212 3300044694 Bacteria 9298
358 Ga0466963_0042133 3300044694 Bacteria 2997
359 Ga0466963_0060917 3300044694 Bacteria 2521
360 Ga0466963_0208446 3300044694 Bacteria 1367
361 Ga0466963_0215780 3300044694 Bacteria 1343
362 Ga0466963_0258132 3300044694 Unclassified 1223
363 Ga0466963_0333151 3300044694 Bacteria 1068
364 Ga0466963_1075953 3300044694 Unclassified 566
365 Ga0466971_0136071 3300044719 Bacteria 1143
366 Ga0466971_0139918 3300044719 Bacteria 1127
367 Ga0466968_0004855 3300044735 Bacteria 5032
368 Ga0466970_0015259 3300044765 Bacteria 3950
369 Ga0466957_0129410 3300044842 Bacteria 1616
370 Ga0466957_0621748 3300044842 Bacteria 757
371 Ga0466957_0626450 3300044842 Unclassified 755
372 Ga0466960_0257972 3300044901 Unclassified 970
373 Ga0466960_0570094 3300044901 Unclassified 669
374 Ga0466959_0456934 3300045049 Unclassified 865
375 Ga0466958_0020162 3300045836 Bacteria 3886
376 Ga0466958_0214172 3300045836 Bacteria 1228
377 Ga0466958_0340520 3300045836 Bacteria 965
378 Ga0466958_0513306 3300045836 Bacteria 778
379 Ga0466967_0025320 3300045976 Bacteria 4891
380 Ga0466967_0085879 3300045976 Bacteria 2850
381 Ga0466967_0086675 3300045976 Bacteria 2837
382 Ga0466967_0128577 3300045976 Bacteria 2349
383 Ga0466967_1069502 3300045976 Unclassified 804
384 Ga0466967_1099937 3300045976 Bacteria 792
385 Ga0495582_0282761 3300046473 Bacteria 953
386 Ga0495642_0260845 3300046528 Bacteria 758
387 Ga0495642_0358846 3300046528 Bacteria 641
388 Ga0495621_0140959 3300046539 Bacteria 943
389 Ga0495668_0785623 3300046616 Bacteria 527
390 Ga0495669_0020214 3300046684 Bacteria 2880
391 Ga0495669_0039061 3300046684 Bacteria 2101
392 Ga0495669_0076719 3300046684 Bacteria 1530
393 Ga0495669_0165080 3300046684 Unclassified 1052
394 Ga0495677_0173769 3300047445 Bacteria 834
395 Ga0495602_0041409 3300048088 Bacteria 4208
396 Ga0496100_1033112 3300048903 Bacteria 647
397 Ga0496100_1229888 3300048903 Unclassified 591
398 Ga0496101_1114926 3300048904 Unclassified 619
399 Ga0496106_0375402 3300048909 Unclassified 1143
400 Ga0496107_0024175 3300048910 Bacteria 4298
401 Ga0496107_0199602 3300048910 Bacteria 1487
402 Ga0496108_0262097 3300048911 Unclassified 1504
403 Ga0496109_0039480 3300048912 Bacteria 4273
404 Ga0496110_0460040 3300048913 Bacteria 1159
405 Ga0496112_0019602 3300048915 Bacteria 6387
406 Ga0496112_0870510 3300048915 Bacteria 824
407 Ga0496113_0261240 3300048916 Unclassified 1383
408 Ga0496113_1259645 3300048916 Unclassified 576
409 Ga0501047_0372054 3300049581 Unclassified 1264
410 Ga0501070_0138285 3300049586 Bacteria 2011
411 Ga0501071_0203135 3300049587 Bacteria 1489
412 Ga0501073_0296868 3300049589 Bacteria 1115
413 Ga0501074_0038808 3300049590 Bacteria 3450
414 Ga0501074_0665837 3300049590 Bacteria 735
415 Ga0501080_0135940 3300049742 Bacteria 2275
416 Ga0501080_0674181 3300049742 Bacteria 913
417 nmdc:mga07m45_230532_c1 3300050496 Bacteria 1077
418 Ga0466962_0075659 3300061719 Bacteria 1609
419 Ga0466962_0537449 3300061719 Unclassified 593

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037418 Ga0395900_0027658 Ga0395900_0027658_258_482 53
2 3300037466 Ga0395898_0343487 Ga0395898_0343487_252_476 53
3 3300037471 Ga0395905_0054494 Ga0395905_0054494_1172_1396 53
4 3300038443 Ga0395901_0020133 Ga0395901_0020133_5591_5815 53
5 3300005563 Ga0068855_100209046 Ga0068855_1002090464 54
6 3300025929 Ga0207664_10163475 Ga0207664_101634753 54
7 3300037312 Ga0395899_0028045 Ga0395899_0028045_2639_2806 54
8 3300037312 Ga0395899_0356812 Ga0395899_0356812_385_552 54
9 3300037418 Ga0395900_0119134 Ga0395900_0119134_1991_2158 54
10 3300037466 Ga0395898_0178947 Ga0395898_0178947_425_592 54
11 3300037466 Ga0395898_0188201 Ga0395898_0188201_1768_1935 54
12 3300037466 Ga0395898_0412613 Ga0395898_0412613_975_1142 54
13 3300037471 Ga0395905_0259802 Ga0395905_0259802_1044_1211 54
14 3300038443 Ga0395901_0359936 Ga0395901_0359936_1025_1192 54
15 3300038443 Ga0395901_1335085 Ga0395901_1335085_218_385 54
16 3300044656 Ga0466969_0041854 Ga0466969_0041854_372_539 54
17 3300044684 Ga0466966_0051018 Ga0466966_0051018_1776_1943 54
18 3300044693 Ga0466961_0196745 Ga0466961_0196745_49_216 54
19 3300044693 Ga0466961_0392714 Ga0466961_0392714_311_478 54
20 3300044694 Ga0466963_0208446 Ga0466963_0208446_94_261 54
21 3300044694 Ga0466963_0258132 Ga0466963_0258132_47_214 54
22 3300044694 Ga0466963_0333151 Ga0466963_0333151_28_195 54
23 3300044719 Ga0466971_0136071 Ga0466971_0136071_436_603 54
24 3300044735 Ga0466968_0004855 Ga0466968_0004855_584_751 54
25 3300044765 Ga0466970_0015259 Ga0466970_0015259_133_300 54
26 3300044842 Ga0466957_0129410 Ga0466957_0129410_47_214 54
27 3300045049 Ga0466959_0456934 Ga0466959_0456934_168_335 54
28 3300045836 Ga0466958_0020162 Ga0466958_0020162_1028_1195 54
29 3300045836 Ga0466958_0214172 Ga0466958_0214172_168_335 54
30 3300045836 Ga0466958_0513306 Ga0466958_0513306_203_370 54
31 3300045976 Ga0466967_0085879 Ga0466967_0085879_654_821 54
32 3300045976 Ga0466967_1069502 Ga0466967_1069502_86_253 54
33 3300061719 Ga0466962_0537449 Ga0466962_0537449_150_317 54
34 3300038443 Ga0395901_0713291 Ga0395901_0713291_82_291 55
35 3300037418 Ga0395900_0861181 Ga0395900_0861181_219_416 56
36 3300005333 Ga0070677_10229384 Ga0070677_102293842 57
37 3300005344 Ga0070661_100236547 Ga0070661_1002365474 57
38 3300005347 Ga0070668_100185471 Ga0070668_1001854714 57
39 3300005355 Ga0070671_100024791 Ga0070671_1000247912 57
40 3300005356 Ga0070674_100191136 Ga0070674_1001911362 57
41 3300005435 Ga0070714_100402898 Ga0070714_1004028981 57
42 3300005439 Ga0070711_102050315 Ga0070711_1020503152 57
43 3300005456 Ga0070678_100026734 Ga0070678_1000267347 57
44 3300005457 Ga0070662_100004660 Ga0070662_1000046607 57
45 3300005459 Ga0068867_100069921 Ga0068867_1000699212 57
46 3300005535 Ga0070684_100702526 Ga0070684_1007025262 57
47 3300005543 Ga0070672_100290152 Ga0070672_1002901523 57
48 3300005544 Ga0070686_100716743 Ga0070686_1007167432 57
49 3300005578 Ga0068854_100108885 Ga0068854_1001088853 57
50 3300005616 Ga0068852_100200323 Ga0068852_1002003234 57
51 3300005616 Ga0068852_100450182 Ga0068852_1004501822 57
52 3300005843 Ga0068860_100207376 Ga0068860_1002073763 57
53 3300005844 Ga0068862_100005042 Ga0068862_10000504213 57
54 3300006881 Ga0068865_100098745 Ga0068865_1000987452 57
55 3300009093 Ga0105240_10214866 Ga0105240_102148663 57
56 3300009545 Ga0105237_11459487 Ga0105237_114594872 57
57 3300009551 Ga0105238_11317270 Ga0105238_113172701 57
58 3300010375 Ga0105239_10559959 Ga0105239_105599591 57
59 3300013100 Ga0157373_10428772 Ga0157373_104287722 57
60 3300013104 Ga0157370_10214303 Ga0157370_102143032 57
61 3300013104 Ga0157370_10815791 Ga0157370_108157911 57
62 3300013105 Ga0157369_10842473 Ga0157369_108424733 57
63 3300013105 Ga0157369_11429158 Ga0157369_114291582 57
64 3300013307 Ga0157372_10347830 Ga0157372_103478303 57
65 3300017792 Ga0163161_10086896 Ga0163161_100868961 57
66 3300025899 Ga0207642_10161261 Ga0207642_101612613 57
67 3300025913 Ga0207695_10146117 Ga0207695_101461174 57
68 3300025920 Ga0207649_10293616 Ga0207649_102936162 57
69 3300025924 Ga0207694_10954473 Ga0207694_109544733 57
70 3300025933 Ga0207706_10004820 Ga0207706_100048209 57
71 3300025937 Ga0207669_10152890 Ga0207669_101528902 57
72 3300025938 Ga0207704_10043056 Ga0207704_100430565 57
73 3300025940 Ga0207691_10520686 Ga0207691_105206861 57
74 3300025949 Ga0207667_10141230 Ga0207667_101412303 57
75 3300025960 Ga0207651_11311910 Ga0207651_113119101 57
76 3300025972 Ga0207668_11244953 Ga0207668_112449531 57
77 3300025981 Ga0207640_10906708 Ga0207640_109067082 57
78 3300026078 Ga0207702_10197621 Ga0207702_101976213 57
79 3300026089 Ga0207648_10551459 Ga0207648_105514592 57
80 3300026121 Ga0207683_10093274 Ga0207683_100932742 57
81 3300026142 Ga0207698_10175750 Ga0207698_101757504 57
82 3300026142 Ga0207698_10483748 Ga0207698_104837483 57
83 3300028380 Ga0268265_10004462 Ga0268265_1000446211 57
84 3300028381 Ga0268264_10553639 Ga0268264_105536393 57
85 3300037312 Ga0395899_0016732 Ga0395899_0016732_127_321 57
86 3300037312 Ga0395899_0082403 Ga0395899_0082403_399_599 57
87 3300037312 Ga0395899_0136735 Ga0395899_0136735_600_800 57
88 3300037312 Ga0395899_0192314 Ga0395899_0192314_626_826 57
89 3300037312 Ga0395899_0240863 Ga0395899_0240863_773_973 57
90 3300037312 Ga0395899_0830668 Ga0395899_0830668_33_233 57
91 3300037418 Ga0395900_0180359 Ga0395900_0180359_954_1154 57
92 3300037418 Ga0395900_0207813 Ga0395900_0207813_1199_1399 57
93 3300037418 Ga0395900_0541645 Ga0395900_0541645_877_1077 57
94 3300037418 Ga0395900_0631166 Ga0395900_0631166_622_816 57
95 3300037418 Ga0395900_0949203 Ga0395900_0949203_181_381 57
96 3300037418 Ga0395900_1014451 Ga0395900_1014451_33_233 57
97 3300037418 Ga0395900_1173944 Ga0395900_1173944_194_388 57
98 3300037466 Ga0395898_0170353 Ga0395898_0170353_478_678 57
99 3300037466 Ga0395898_0240295 Ga0395898_0240295_912_1106 57
100 3300037466 Ga0395898_0321372 Ga0395898_0321372_662_862 57
101 3300037466 Ga0395898_0495150 Ga0395898_0495150_930_1130 57
102 3300037471 Ga0395905_0020258 Ga0395905_0020258_30_224 57
103 3300037471 Ga0395905_0250587 Ga0395905_0250587_626_826 57
104 3300037471 Ga0395905_0389872 Ga0395905_0389872_1049_1249 57
105 3300037471 Ga0395905_0504892 Ga0395905_0504892_877_1077 57
106 3300037471 Ga0395905_1208345 Ga0395905_1208345_257_457 57
107 3300038443 Ga0395901_0018576 Ga0395901_0018576_1651_1845 57
108 3300038443 Ga0395901_0102698 Ga0395901_0102698_1531_1731 57
109 3300038443 Ga0395901_0134585 Ga0395901_0134585_1468_1668 57
110 3300038443 Ga0395901_0199840 Ga0395901_0199840_1461_1661 57
111 3300038443 Ga0395901_0698198 Ga0395901_0698198_709_909 57
112 3300044656 Ga0466969_0035747 Ga0466969_0035747_1352_1552 57
113 3300044684 Ga0466966_0016847 Ga0466966_0016847_1187_1387 57
114 3300044694 Ga0466963_1075953 Ga0466963_1075953_247_447 57
115 3300045976 Ga0466967_1099937 Ga0466967_1099937_88_300 57
116 3300046528 Ga0495642_0260845 Ga0495642_0260845_442_642 57
117 3300046539 Ga0495621_0140959 Ga0495621_0140959_641_841 57
118 3300005353 Ga0070669_100484627 Ga0070669_1004846272 58
119 3300005434 Ga0070709_10901279 Ga0070709_109012792 58
120 3300005435 Ga0070714_100694449 Ga0070714_1006944492 58
121 3300005548 Ga0070665_100045739 Ga0070665_1000457394 58
122 3300014969 Ga0157376_11234513 Ga0157376_112345132 58
123 3300025929 Ga0207664_10013360 Ga0207664_100133606 58
124 3300028379 Ga0268266_10019318 Ga0268266_100193184 58
125 3300041486 Ga0451807_0571521 Ga0451807_0571521_145_348 58
126 3300050496 nmdc:mga07m45_230532_c1 nmdc:mga07m45_230532_c1_361_564 58
127 3300005367 Ga0070667_100276642 Ga0070667_1002766422 59
128 3300005456 Ga0070678_101413197 Ga0070678_1014131972 59
129 3300005843 Ga0068860_101971064 Ga0068860_1019710641 59
130 3300011119 Ga0105246_10392161 Ga0105246_103921612 59
131 3300013105 Ga0157369_11304533 Ga0157369_113045332 59
132 3300025986 Ga0207658_10236558 Ga0207658_102365583 59
133 3300026121 Ga0207683_11435266 Ga0207683_114352662 59
134 3300028794 Ga0307515_10269935 Ga0307515_102699354 59
135 3300037418 Ga0395900_1503222 Ga0395900_1503222_59_265 59
136 3300037466 Ga0395898_0236532 Ga0395898_0236532_1049_1255 59
137 3300037471 Ga0395905_0902560 Ga0395905_0902560_485_691 59
138 3300038443 Ga0395901_1565049 Ga0395901_1565049_31_237 59
139 3300046684 Ga0495669_0076719 Ga0495669_0076719_216_422 59
140 3300005339 Ga0070660_100547812 Ga0070660_1005478121 60
141 3300005366 Ga0070659_101611192 Ga0070659_1016111922 60
142 3300025932 Ga0207690_10565500 Ga0207690_105655002 60
143 3300037312 Ga0395899_0580238 Ga0395899_0580238_424_633 60
144 3300037466 Ga0395898_0527086 Ga0395898_0527086_471_680 60
145 3300037471 Ga0395905_0457495 Ga0395905_0457495_548_757 60
146 3300037471 Ga0395905_1078217 Ga0395905_1078217_97_306 60
147 3300038443 Ga0395901_0539549 Ga0395901_0539549_274_483 60
148 3300046684 Ga0495669_0165080 Ga0495669_0165080_95_304 60
149 3300001979 JGI24740J21852_10030245 JGI24740J21852_100302453 61
150 3300001979 JGI24740J21852_10086993 JGI24740J21852_100869932 61
151 3300001989 JGI24739J22299_10010582 JGI24739J22299_100105823 61
152 3300001990 JGI24737J22298_10000548 JGI24737J22298_1000054818 61
153 3300002067 JGI24735J21928_10134339 JGI24735J21928_101343392 61
154 3300002075 JGI24738J21930_10004476 JGI24738J21930_100044765 61
155 3300005327 Ga0070658_10000220 Ga0070658_1000022031 61
156 3300005327 Ga0070658_10040951 Ga0070658_100409514 61
157 3300005327 Ga0070658_10465735 Ga0070658_104657353 61
158 3300005328 Ga0070676_10514731 Ga0070676_105147312 61
159 3300005329 Ga0070683_100009023 Ga0070683_1000090237 61
160 3300005329 Ga0070683_100172698 Ga0070683_1001726984 61
161 3300005329 Ga0070683_100278811 Ga0070683_1002788114 61
162 3300005331 Ga0070670_100021908 Ga0070670_1000219085 61
163 3300005334 Ga0068869_102138768 Ga0068869_1021387682 61
164 3300005335 Ga0070666_10001568 Ga0070666_1000156812 61
165 3300005335 Ga0070666_10441579 Ga0070666_104415793 61
166 3300005335 Ga0070666_10550638 Ga0070666_105506381 61
167 3300005335 Ga0070666_10862053 Ga0070666_108620532 61
168 3300005336 Ga0070680_100000406 Ga0070680_10000040615 61
169 3300005336 Ga0070680_100002258 Ga0070680_10000225810 61
170 3300005337 Ga0070682_100092205 Ga0070682_1000922054 61
171 3300005338 Ga0068868_100331012 Ga0068868_1003310124 61
172 3300005338 Ga0068868_100959346 Ga0068868_1009593462 61
173 3300005339 Ga0070660_100000218 Ga0070660_10000021832 61
174 3300005339 Ga0070660_100051835 Ga0070660_1000518353 61
175 3300005339 Ga0070660_100350536 Ga0070660_1003505363 61
176 3300005339 Ga0070660_100682283 Ga0070660_1006822832 61
177 3300005341 Ga0070691_10458632 Ga0070691_104586322 61
178 3300005344 Ga0070661_100000181 Ga0070661_10000018131 61
179 3300005344 Ga0070661_100954508 Ga0070661_1009545081 61
180 3300005345 Ga0070692_10076875 Ga0070692_100768754 61
181 3300005345 Ga0070692_10190763 Ga0070692_101907632 61
182 3300005355 Ga0070671_100010875 Ga0070671_10001087511 61
183 3300005355 Ga0070671_100025393 Ga0070671_1000253934 61
184 3300005364 Ga0070673_100846563 Ga0070673_1008465632 61
185 3300005366 Ga0070659_100000310 Ga0070659_10000031032 61
186 3300005366 Ga0070659_100095807 Ga0070659_1000958074 61
187 3300005366 Ga0070659_100976473 Ga0070659_1009764731 61
188 3300005366 Ga0070659_101208652 Ga0070659_1012086521 61
189 3300005367 Ga0070667_100022597 Ga0070667_1000225976 61
190 3300005367 Ga0070667_100061356 Ga0070667_1000613564 61
191 3300005367 Ga0070667_100086450 Ga0070667_1000864502 61
192 3300005367 Ga0070667_100324848 Ga0070667_1003248484 61
193 3300005367 Ga0070667_101564913 Ga0070667_1015649131 61
194 3300005435 Ga0070714_100842566 Ga0070714_1008425661 61
195 3300005435 Ga0070714_100939988 Ga0070714_1009399882 61
196 3300005436 Ga0070713_100730959 Ga0070713_1007309592 61
197 3300005455 Ga0070663_100087618 Ga0070663_1000876184 61
198 3300005455 Ga0070663_100583600 Ga0070663_1005836003 61
199 3300005457 Ga0070662_100000080 Ga0070662_10000008032 61
200 3300005457 Ga0070662_101651819 Ga0070662_1016518191 61
201 3300005458 Ga0070681_10928528 Ga0070681_109285282 61
202 3300005530 Ga0070679_100070012 Ga0070679_1000700124 61
203 3300005530 Ga0070679_100110295 Ga0070679_1001102953 61
204 3300005530 Ga0070679_100198682 Ga0070679_1001986823 61
205 3300005530 Ga0070679_100499092 Ga0070679_1004990922 61
206 3300005530 Ga0070679_101084002 Ga0070679_1010840022 61
207 3300005535 Ga0070684_100674478 Ga0070684_1006744782 61
208 3300005535 Ga0070684_101239582 Ga0070684_1012395822 61
209 3300005539 Ga0068853_100000134 Ga0068853_10000013431 61
210 3300005539 Ga0068853_100107295 Ga0068853_1001072952 61
211 3300005544 Ga0070686_101234730 Ga0070686_1012347302 61
212 3300005547 Ga0070693_100000536 Ga0070693_10000053611 61
213 3300005548 Ga0070665_100987857 Ga0070665_1009878572 61
214 3300005563 Ga0068855_100043926 Ga0068855_1000439263 61
215 3300005563 Ga0068855_100064651 Ga0068855_1000646514 61
216 3300005563 Ga0068855_100070838 Ga0068855_1000708389 61
217 3300005563 Ga0068855_100215621 Ga0068855_1002156214 61
218 3300005563 Ga0068855_100509767 Ga0068855_1005097672 61
219 3300005564 Ga0070664_100000047 Ga0070664_10000004773 61
220 3300005577 Ga0068857_100305520 Ga0068857_1003055202 61
221 3300005578 Ga0068854_100012702 Ga0068854_1000127026 61
222 3300005578 Ga0068854_100083626 Ga0068854_1000836263 61
223 3300005578 Ga0068854_101964826 Ga0068854_1019648262 61
224 3300005614 Ga0068856_100001328 Ga0068856_1000013284 61
225 3300005614 Ga0068856_100056308 Ga0068856_1000563084 61
226 3300005614 Ga0068856_100466005 Ga0068856_1004660053 61
227 3300005614 Ga0068856_100568954 Ga0068856_1005689542 61
228 3300005614 Ga0068856_101434384 Ga0068856_1014343842 61
229 3300005614 Ga0068856_101468637 Ga0068856_1014686373 61
230 3300005616 Ga0068852_100002050 Ga0068852_1000020508 61
231 3300005616 Ga0068852_100002251 Ga0068852_1000022512 61
232 3300005616 Ga0068852_100014063 Ga0068852_10001406310 61
233 3300005616 Ga0068852_100015243 Ga0068852_1000152434 61
234 3300005616 Ga0068852_100321415 Ga0068852_1003214152 61
235 3300005616 Ga0068852_100870838 Ga0068852_1008708382 61
236 3300005618 Ga0068864_100052557 Ga0068864_1000525574 61
237 3300005841 Ga0068863_100544868 Ga0068863_1005448682 61
238 3300005842 Ga0068858_100023710 Ga0068858_1000237104 61
239 3300005843 Ga0068860_100060777 Ga0068860_1000607772 61
240 3300005844 Ga0068862_100743201 Ga0068862_1007432012 61
241 3300006173 Ga0070716_100772781 Ga0070716_1007727812 61
242 3300006175 Ga0070712_102028139 Ga0070712_1020281392 61
243 3300009093 Ga0105240_10013759 Ga0105240_1001375910 61
244 3300009098 Ga0105245_12991289 Ga0105245_129912891 61
245 3300009174 Ga0105241_10077754 Ga0105241_100777544 61
246 3300009174 Ga0105241_10168154 Ga0105241_101681542 61
247 3300009177 Ga0105248_10000276 Ga0105248_1000027632 61
248 3300009177 Ga0105248_10040529 Ga0105248_100405299 61
249 3300009177 Ga0105248_10048181 Ga0105248_100481815 61
250 3300009551 Ga0105238_10034298 Ga0105238_100342985 61
251 3300009551 Ga0105238_10148872 Ga0105238_101488723 61
252 3300009551 Ga0105238_12095054 Ga0105238_120950542 61
253 3300009551 Ga0105238_12377822 Ga0105238_123778222 61
254 3300009553 Ga0105249_10476786 Ga0105249_104767863 61
255 3300010375 Ga0105239_11352700 Ga0105239_113527002 61
256 3300011119 Ga0105246_11168098 Ga0105246_111680982 61
257 3300013100 Ga0157373_10007891 Ga0157373_1000789110 61
258 3300013100 Ga0157373_10274165 Ga0157373_102741652 61
259 3300013100 Ga0157373_10475017 Ga0157373_104750172 61
260 3300013100 Ga0157373_10705518 Ga0157373_107055182 61
261 3300013102 Ga0157371_10006963 Ga0157371_100069634 61
262 3300013102 Ga0157371_10034220 Ga0157371_100342204 61
263 3300013102 Ga0157371_10058976 Ga0157371_100589764 61
264 3300013102 Ga0157371_10154085 Ga0157371_101540853 61
265 3300013102 Ga0157371_10944386 Ga0157371_109443861 61
266 3300013102 Ga0157371_11321199 Ga0157371_113211992 61
267 3300013102 Ga0157371_11554784 Ga0157371_115547842 61
268 3300013104 Ga0157370_10020725 Ga0157370_100207254 61
269 3300013104 Ga0157370_10192665 Ga0157370_101926652 61
270 3300013104 Ga0157370_10369034 Ga0157370_103690341 61
271 3300013104 Ga0157370_11508725 Ga0157370_115087252 61
272 3300013104 Ga0157370_11625409 Ga0157370_116254092 61
273 3300013105 Ga0157369_10077904 Ga0157369_100779044 61
274 3300013105 Ga0157369_10236532 Ga0157369_102365322 61
275 3300013105 Ga0157369_10320237 Ga0157369_103202372 61
276 3300013105 Ga0157369_10346853 Ga0157369_103468532 61
277 3300013296 Ga0157374_10007006 Ga0157374_1000700612 61
278 3300013297 Ga0157378_11324827 Ga0157378_113248272 61
279 3300013297 Ga0157378_11807379 Ga0157378_118073792 61
280 3300013297 Ga0157378_11835396 Ga0157378_118353962 61
281 3300013306 Ga0163162_10031161 Ga0163162_100311613 61
282 3300013306 Ga0163162_10966387 Ga0163162_109663873 61
283 3300013307 Ga0157372_10100747 Ga0157372_101007473 61
284 3300013307 Ga0157372_10217309 Ga0157372_102173092 61
285 3300013307 Ga0157372_10431082 Ga0157372_104310822 61
286 3300013307 Ga0157372_10593328 Ga0157372_105933284 61
287 3300013307 Ga0157372_10959213 Ga0157372_109592131 61
288 3300013307 Ga0157372_12026667 Ga0157372_120266672 61
289 3300014325 Ga0163163_10001248 Ga0163163_1000124820 61
290 3300014968 Ga0157379_10078482 Ga0157379_100784824 61
291 3300017792 Ga0163161_10297508 Ga0163161_102975082 61
292 3300025903 Ga0207680_10028950 Ga0207680_100289504 61
293 3300025903 Ga0207680_10592208 Ga0207680_105922081 61
294 3300025909 Ga0207705_10123198 Ga0207705_101231984 61
295 3300025909 Ga0207705_10185647 Ga0207705_101856473 61
296 3300025909 Ga0207705_10235937 Ga0207705_102359372 61
297 3300025909 Ga0207705_10486011 Ga0207705_104860112 61
298 3300025909 Ga0207705_10660276 Ga0207705_106602762 61
299 3300025913 Ga0207695_10119754 Ga0207695_101197544 61
300 3300025917 Ga0207660_10000515 Ga0207660_1000051519 61
301 3300025917 Ga0207660_10001062 Ga0207660_1000106213 61
302 3300025917 Ga0207660_10004418 Ga0207660_100044186 61
303 3300025917 Ga0207660_10453676 Ga0207660_104536762 61
304 3300025919 Ga0207657_10046172 Ga0207657_100461728 61
305 3300025919 Ga0207657_10135254 Ga0207657_101352544 61
306 3300025919 Ga0207657_10194833 Ga0207657_101948332 61
307 3300025919 Ga0207657_11342522 Ga0207657_113425222 61
308 3300025920 Ga0207649_10121141 Ga0207649_101211413 61
309 3300025920 Ga0207649_10361115 Ga0207649_103611152 61
310 3300025921 Ga0207652_10076931 Ga0207652_100769313 61
311 3300025921 Ga0207652_10268064 Ga0207652_102680644 61
312 3300025923 Ga0207681_10756015 Ga0207681_107560152 61
313 3300025924 Ga0207694_10383349 Ga0207694_103833492 61
314 3300025924 Ga0207694_11726290 Ga0207694_117262902 61
315 3300025929 Ga0207664_10319311 Ga0207664_103193112 61
316 3300025931 Ga0207644_10124308 Ga0207644_101243083 61
317 3300025932 Ga0207690_10065934 Ga0207690_100659341 61
318 3300025932 Ga0207690_10084601 Ga0207690_100846014 61
319 3300025941 Ga0207711_10135155 Ga0207711_101351554 61
320 3300025941 Ga0207711_10360660 Ga0207711_103606602 61
321 3300025944 Ga0207661_10123031 Ga0207661_101230313 61
322 3300025944 Ga0207661_10215114 Ga0207661_102151144 61
323 3300025944 Ga0207661_10258944 Ga0207661_102589442 61
324 3300025949 Ga0207667_10173335 Ga0207667_101733354 61
325 3300025949 Ga0207667_10182114 Ga0207667_101821144 61
326 3300025949 Ga0207667_10434749 Ga0207667_104347493 61
327 3300025960 Ga0207651_10900522 Ga0207651_109005222 61
328 3300025972 Ga0207668_10098976 Ga0207668_100989762 61
329 3300025981 Ga0207640_10286204 Ga0207640_102862042 61
330 3300025981 Ga0207640_11643104 Ga0207640_116431041 61
331 3300025986 Ga0207658_10055350 Ga0207658_100553503 61
332 3300025986 Ga0207658_10331927 Ga0207658_103319272 61
333 3300025986 Ga0207658_11397846 Ga0207658_113978462 61
334 3300026023 Ga0207677_10352166 Ga0207677_103521661 61
335 3300026041 Ga0207639_10327669 Ga0207639_103276693 61
336 3300026041 Ga0207639_11046861 Ga0207639_110468612 61
337 3300026078 Ga0207702_10156815 Ga0207702_101568152 61
338 3300026078 Ga0207702_10348001 Ga0207702_103480013 61
339 3300026142 Ga0207698_10000986 Ga0207698_1000098611 61
340 3300026142 Ga0207698_10001169 Ga0207698_100011699 61
341 3300026142 Ga0207698_10007388 Ga0207698_100073888 61
342 3300026142 Ga0207698_10130564 Ga0207698_101305644 61
343 3300026142 Ga0207698_10939002 Ga0207698_109390022 61
344 3300026142 Ga0207698_12026231 Ga0207698_120262312 61
345 3300028379 Ga0268266_11026080 Ga0268266_110260802 61
346 3300028380 Ga0268265_10447833 Ga0268265_104478333 61
347 3300028381 Ga0268264_10017800 Ga0268264_100178006 61
348 3300035117 Ga0373953_0167211 Ga0373953_0167211_578_808 61
349 3300035118 Ga0373954_0225952 Ga0373954_0225952_352_582 61
350 3300035120 Ga0373957_0098322 Ga0373957_0098322_343_573 61
351 3300035172 Ga0373955_0002452 Ga0373955_0002452_2640_2870 61
352 3300035692 Ga0373935_0213541 Ga0373935_0213541_362_574 61
353 3300035724 Ga0373933_0720137 Ga0373933_0720137_149_379 61
354 3300036401 Ga0373937_0001514 Ga0373937_0001514_13452_13682 61
355 3300037312 Ga0395899_0078045 Ga0395899_0078045_887_1099 61
356 3300037312 Ga0395899_0395566 Ga0395899_0395566_644_856 61
357 3300037418 Ga0395900_0063046 Ga0395900_0063046_1335_1547 61
358 3300037418 Ga0395900_0165384 Ga0395900_0165384_644_856 61
359 3300037418 Ga0395900_0251987 Ga0395900_0251987_348_560 61
360 3300037418 Ga0395900_0286711 Ga0395900_0286711_973_1185 61
361 3300037418 Ga0395900_0599309 Ga0395900_0599309_136_348 61
362 3300037418 Ga0395900_1104939 Ga0395900_1104939_256_471 61
363 3300037418 Ga0395900_1566701 Ga0395900_1566701_308_520 61
364 3300037418 Ga0395900_1598785 Ga0395900_1598785_268_483 61
365 3300037466 Ga0395898_0063085 Ga0395898_0063085_2904_3116 61
366 3300037466 Ga0395898_0269600 Ga0395898_0269600_1101_1313 61
367 3300037466 Ga0395898_0751250 Ga0395898_0751250_60_272 61
368 3300037471 Ga0395905_0079747 Ga0395905_0079747_181_393 61
369 3300037471 Ga0395905_0125108 Ga0395905_0125108_730_942 61
370 3300037471 Ga0395905_0697405 Ga0395905_0697405_322_534 61
371 3300037471 Ga0395905_1506481 Ga0395905_1506481_111_323 61
372 3300038443 Ga0395901_0153979 Ga0395901_0153979_2070_2282 61
373 3300038443 Ga0395901_0158559 Ga0395901_0158559_105_317 61
374 3300038443 Ga0395901_0300121 Ga0395901_0300121_1272_1484 61
375 3300038443 Ga0395901_1009644 Ga0395901_1009644_494_706 61
376 3300038443 Ga0395901_1236403 Ga0395901_1236403_141_353 61
377 3300044683 Ga0466965_0422507 Ga0466965_0422507_252_464 61
378 3300044694 Ga0466963_0003212 Ga0466963_0003212_4258_4470 61
379 3300044694 Ga0466963_0042133 Ga0466963_0042133_2401_2613 61
380 3300044694 Ga0466963_0060917 Ga0466963_0060917_1745_1957 61
381 3300044694 Ga0466963_0215780 Ga0466963_0215780_367_600 61
382 3300044719 Ga0466971_0139918 Ga0466971_0139918_86_319 61
383 3300044842 Ga0466957_0621748 Ga0466957_0621748_94_327 61
384 3300044842 Ga0466957_0626450 Ga0466957_0626450_276_488 61
385 3300044901 Ga0466960_0257972 Ga0466960_0257972_88_300 61
386 3300044901 Ga0466960_0570094 Ga0466960_0570094_85_297 61
387 3300045836 Ga0466958_0340520 Ga0466958_0340520_169_402 61
388 3300045976 Ga0466967_0025320 Ga0466967_0025320_3745_3957 61
389 3300045976 Ga0466967_0086675 Ga0466967_0086675_951_1163 61
390 3300045976 Ga0466967_0128577 Ga0466967_0128577_191_424 61
391 3300046473 Ga0495582_0282761 Ga0495582_0282761_719_931 61
392 3300046528 Ga0495642_0358846 Ga0495642_0358846_100_312 61
393 3300046616 Ga0495668_0785623 Ga0495668_0785623_57_269 61
394 3300046684 Ga0495669_0020214 Ga0495669_0020214_13_225 61
395 3300046684 Ga0495669_0039061 Ga0495669_0039061_1223_1435 61
396 3300047445 Ga0495677_0173769 Ga0495677_0173769_425_637 61
397 3300048088 Ga0495602_0041409 Ga0495602_0041409_3093_3323 61
398 3300048903 Ga0496100_1033112 Ga0496100_1033112_164_388 61
399 3300048903 Ga0496100_1229888 Ga0496100_1229888_194_406 61
400 3300048904 Ga0496101_1114926 Ga0496101_1114926_320_532 61
401 3300048909 Ga0496106_0375402 Ga0496106_0375402_875_1087 61
402 3300048910 Ga0496107_0024175 Ga0496107_0024175_44_259 61
403 3300048910 Ga0496107_0199602 Ga0496107_0199602_114_329 61
404 3300048911 Ga0496108_0262097 Ga0496108_0262097_572_784 61
405 3300048912 Ga0496109_0039480 Ga0496109_0039480_3724_3936 61
406 3300048913 Ga0496110_0460040 Ga0496110_0460040_904_1116 61
407 3300048915 Ga0496112_0019602 Ga0496112_0019602_1915_2127 61
408 3300048915 Ga0496112_0870510 Ga0496112_0870510_272_496 61
409 3300048916 Ga0496113_0261240 Ga0496113_0261240_330_542 61
410 3300048916 Ga0496113_1259645 Ga0496113_1259645_77_289 61
411 3300049581 Ga0501047_0372054 Ga0501047_0372054_205_417 61
412 3300049586 Ga0501070_0138285 Ga0501070_0138285_112_324 61
413 3300049587 Ga0501071_0203135 Ga0501071_0203135_878_1090 61
414 3300049589 Ga0501073_0296868 Ga0501073_0296868_176_388 61
415 3300049590 Ga0501074_0038808 Ga0501074_0038808_1122_1334 61
416 3300049590 Ga0501074_0665837 Ga0501074_0665837_118_330 61
417 3300049742 Ga0501080_0135940 Ga0501080_0135940_499_711 61
418 3300049742 Ga0501080_0674181 Ga0501080_0674181_555_767 61
419 3300061719 Ga0466962_0075659 Ga0466962_0075659_1283_1516 61

Feature Viewer

pLDDT pTM Quality
65.92 0.3 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map