F439540

General Info

Members Datasets Scaffolds Average Seq Length
419 199 838 185

Family's Representative Sequence

Representative Sequence 3300025945|Ga0207679_10616158|Ga0207679_106161582
Length 210
Sequence VRVVPTAIPEVLILEPDVHKDGRGFFLETYHADRYREHGIVGPFVQDNHSRSIAGTLRGLHLQLRRPQGKLIRVIEGEILDVAVDVRRGSPTFGRWVSVALTAENFRQVYVPAGFAHGFCVVSPVAQVEYKCTDVYDPSSELGVAWNDPALANVCLNTPVPGAMLPEFRINVAPGFVVLSLEHASATRVRITSVAAANTFHPLTVMFPPA

Samples

Sample ID Description Type Environment
1 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
61 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
62 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
133 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
137 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
138 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
139 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
140 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
141 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
142 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
143 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
144 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
145 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
146 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
147 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
148 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
149 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
150 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
151 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
152 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
153 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
154 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
155 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
156 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
157 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
158 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
159 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
160 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
161 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
162 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
163 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
164 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
165 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
166 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
167 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
168 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
169 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
170 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
171 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
172 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
173 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
174 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
175 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
176 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
177 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
178 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
179 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
180 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
181 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
182 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
183 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
184 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
185 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
186 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
187 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
188 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
189 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
190 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
191 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
192 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
193 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
194 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
195 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
196 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
197 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
198 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
199 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.24
Nodule 0
Rhizoplane 4.06
Rhizosphere 95.47
Stem 0
Stem Tuber 0
Unclassified 3.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207679_10616158 3300025945 Bacteria 979
2 Ga0065714_10106200 3300005288 Bacteria 1553
3 Ga0065712_10075799 3300005290 Bacteria 3786
4 Ga0065707_10397644 3300005295 Bacteria 857
5 Ga0070676_10013663 3300005328 Bacteria 4450
6 Ga0070676_10468505 3300005328 Bacteria 889
7 Ga0070676_10639538 3300005328 Bacteria 771
8 Ga0070683_100338804 3300005329 Bacteria 1432
9 Ga0070690_100012029 3300005330 Bacteria 5079
10 Ga0070690_100376725 3300005330 Bacteria 1036
11 Ga0070670_100268002 3300005331 Unclassified 1490
12 Ga0068869_100081439 3300005334 Bacteria 2417
13 Ga0070666_10002893 3300005335 Bacteria 10364
14 Ga0070666_10155280 3300005335 Bacteria 1598
15 Ga0070666_10172907 3300005335 Bacteria 1513
16 Ga0070666_10294030 3300005335 Bacteria 1156
17 Ga0068868_100117831 3300005338 Bacteria 2163
18 Ga0068868_100706256 3300005338 Bacteria 902
19 Ga0070689_100247282 3300005340 Bacteria 1471
20 Ga0070689_101376889 3300005340 Bacteria 637
21 Ga0070687_100074006 3300005343 Bacteria 1838
22 Ga0070687_100868734 3300005343 Bacteria 644
23 Ga0070692_10178906 3300005345 Bacteria 1228
24 Ga0070668_100013518 3300005347 Bacteria 6093
25 Ga0070669_100009638 3300005353 Bacteria 6878
26 Ga0070669_100010327 3300005353 Bacteria 6631
27 Ga0070669_100026179 3300005353 Bacteria 4196
28 Ga0070675_100140085 3300005354 Bacteria 2067
29 Ga0070671_100138651 3300005355 Bacteria 2051
30 Ga0070671_100333959 3300005355 Bacteria 1292
31 Ga0070674_100172595 3300005356 Bacteria 1650
32 Ga0070674_100233542 3300005356 Bacteria 1436
33 Ga0070674_100636446 3300005356 Bacteria 905
34 Ga0070673_100211081 3300005364 Bacteria 1677
35 Ga0070673_100991241 3300005364 Bacteria 782
36 Ga0070688_100036047 3300005365 Bacteria 3007
37 Ga0070688_100437752 3300005365 Bacteria 975
38 Ga0070659_100194747 3300005366 Bacteria 1667
39 Ga0070667_100016593 3300005367 Bacteria 6094
40 Ga0070667_101090760 3300005367 Bacteria 746
41 Ga0070710_10014366 3300005437 Bacteria 3986
42 Ga0070701_10005974 3300005438 Bacteria 5085
43 Ga0070701_10283804 3300005438 Bacteria 1012
44 Ga0070700_100402385 3300005441 Bacteria 1030
45 Ga0070700_100432808 3300005441 Bacteria 997
46 Ga0070694_100004743 3300005444 Bacteria 8187
47 Ga0070678_100132646 3300005456 Bacteria 1982
48 Ga0070678_100622229 3300005456 Bacteria 966
49 Ga0070662_100166248 3300005457 Bacteria 1729
50 Ga0068867_100052368 3300005459 Bacteria 3012
51 Ga0068867_100074751 3300005459 Bacteria 2541
52 Ga0068867_100116390 3300005459 Bacteria 2060
53 Ga0068867_100322314 3300005459 Bacteria 1281
54 Ga0068867_100435224 3300005459 Bacteria 1114
55 Ga0068867_100846726 3300005459 Bacteria 819
56 Ga0070706_100373678 3300005467 Bacteria 1328
57 Ga0070707_100019122 3300005468 Bacteria 6450
58 Ga0070698_100026614 3300005471 Bacteria 6020
59 Ga0070698_100044115 3300005471 Bacteria 4568
60 Ga0070698_100185064 3300005471 Bacteria 2021
61 Ga0070698_100554443 3300005471 Bacteria 1089
62 Ga0070698_101367210 3300005471 Bacteria 659
63 Ga0070699_100016959 3300005518 Bacteria 6253
64 Ga0070699_100329419 3300005518 Bacteria 1373
65 Ga0070699_100838477 3300005518 Bacteria 841
66 Ga0070699_101281226 3300005518 Bacteria 672
67 Ga0070684_100248496 3300005535 Bacteria 1625
68 Ga0070684_100479674 3300005535 Bacteria 1151
69 Ga0070697_100045788 3300005536 Bacteria 3545
70 Ga0070697_100097601 3300005536 Bacteria 2438
71 Ga0070672_100005912 3300005543 Bacteria 8161
72 Ga0070672_100084504 3300005543 Unclassified 2549
73 Ga0070672_100571976 3300005543 Bacteria 983
74 Ga0070686_100002142 3300005544 Bacteria 10882
75 Ga0070686_100198203 3300005544 Bacteria 1437
76 Ga0070686_100369367 3300005544 Bacteria 1083
77 Ga0070686_100471906 3300005544 Bacteria 969
78 Ga0070695_100039715 3300005545 Bacteria 2976
79 Ga0070695_100387642 3300005545 Bacteria 1056
80 Ga0070696_100064508 3300005546 Bacteria 2566
81 Ga0070696_100170698 3300005546 Bacteria 1608
82 Ga0070696_100234820 3300005546 Bacteria 1381
83 Ga0070693_100125236 3300005547 Bacteria 1599
84 Ga0070665_100004070 3300005548 Bacteria 15379
85 Ga0070665_100213505 3300005548 Bacteria 1930
86 Ga0070665_100549963 3300005548 Bacteria 1166
87 Ga0070665_101032491 3300005548 Bacteria 834
88 Ga0070704_100051628 3300005549 Bacteria 2897
89 Ga0070704_101123093 3300005549 Bacteria 715
90 Ga0068855_100390492 3300005563 Bacteria 1527
91 Ga0070664_100111469 3300005564 Bacteria 2388
92 Ga0068854_100174146 3300005578 Bacteria 1676
93 Ga0068854_100187664 3300005578 Bacteria 1618
94 Ga0070702_100003994 3300005615 Bacteria 6691
95 Ga0068852_100311251 3300005616 Bacteria 1527
96 Ga0068859_100802399 3300005617 Bacteria 1029
97 Ga0068864_100074438 3300005618 Bacteria 2963
98 Ga0068864_100222925 3300005618 Bacteria 1740
99 Ga0068866_10082944 3300005718 Bacteria 1726
100 Ga0068861_100000951 3300005719 Bacteria 17604
101 Ga0068861_100128477 3300005719 Bacteria 2054
102 Ga0068861_100348863 3300005719 Bacteria 1298
103 Ga0068861_100895246 3300005719 Unclassified 840
104 Ga0068851_10103840 3300005834 Bacteria 1510
105 Ga0068863_100005998 3300005841 Bacteria 11913
106 Ga0068863_100144167 3300005841 Bacteria 2277
107 Ga0068863_100336176 3300005841 Bacteria 1469
108 Ga0068863_100590615 3300005841 Bacteria 1098
109 Ga0068863_100593868 3300005841 Bacteria 1095
110 Ga0068858_100041771 3300005842 Bacteria 4252
111 Ga0068858_100092151 3300005842 Bacteria 2820
112 Ga0068858_100167329 3300005842 Bacteria 2072
113 Ga0068858_100706014 3300005842 Unclassified 981
114 Ga0068860_100180551 3300005843 Bacteria 2040
115 Ga0068860_100198275 3300005843 Bacteria 1945
116 Ga0068860_100244756 3300005843 Bacteria 1745
117 Ga0068860_101125622 3300005843 Bacteria 805
118 Ga0068862_100012559 3300005844 Bacteria 7012
119 Ga0068862_100261680 3300005844 Bacteria 1579
120 Ga0068862_100523327 3300005844 Bacteria 1129
121 Ga0068862_100835357 3300005844 Bacteria 902
122 Ga0068862_101140811 3300005844 Bacteria 776
123 Ga0081455_10029710 3300005937 Bacteria 4980
124 Ga0081539_10058070 3300005985 Bacteria 2137
125 Ga0075363_100269169 3300006048 Bacteria 984
126 Ga0075432_10016350 3300006058 Bacteria 2532
127 Ga0070715_10065082 3300006163 Bacteria 1612
128 Ga0097621_100002360 3300006237 Bacteria 12939
129 Ga0097621_100025403 3300006237 Bacteria 4635
130 Ga0097621_100070002 3300006237 Bacteria 2897
131 Ga0097621_100152214 3300006237 Bacteria 1984
132 Ga0097621_100293065 3300006237 Bacteria 1435
133 Ga0097621_100906462 3300006237 Bacteria 821
134 Ga0068871_100003005 3300006358 Bacteria 11574
135 Ga0068871_100053576 3300006358 Bacteria 3270
136 Ga0068871_100056167 3300006358 Bacteria 3199
137 Ga0068871_100067821 3300006358 Bacteria 2928
138 Ga0075428_100280569 3300006844 Bacteria 1792
139 Ga0075433_10075918 3300006852 Bacteria 2958
140 Ga0075433_10178505 3300006852 Bacteria 1889
141 Ga0075433_10241527 3300006852 Bacteria 1603
142 Ga0075433_10737135 3300006852 Bacteria 862
143 Ga0075434_100041926 3300006871 Bacteria 4536
144 Ga0075429_100553019 3300006880 Bacteria 1008
145 Ga0068865_100023541 3300006881 Bacteria 4033
146 Ga0068865_100125469 3300006881 Bacteria 1915
147 Ga0068865_100154836 3300006881 Bacteria 1742
148 Ga0068865_100401596 3300006881 Bacteria 1123
149 Ga0075436_100242290 3300006914 Bacteria 1283
150 Ga0075436_100271592 3300006914 Bacteria 1211
151 Ga0097620_100802420 3300006931 Bacteria 1029
152 Ga0075435_100000538 3300007076 Bacteria 23197
153 Ga0075435_100025892 3300007076 Bacteria 4571
154 Ga0075435_100026269 3300007076 Bacteria 4540
155 Ga0075435_100092891 3300007076 Bacteria 2492
156 Ga0075435_100211460 3300007076 Bacteria 1646
157 Ga0075435_100423512 3300007076 Bacteria 1147
158 Ga0105251_10074605 3300009011 Bacteria 1575
159 Ga0105240_11149079 3300009093 Bacteria 824
160 Ga0111539_10221005 3300009094 Bacteria 2206
161 Ga0111539_10614312 3300009094 Bacteria 1266
162 Ga0111539_10957490 3300009094 Bacteria 995
163 Ga0105245_10008794 3300009098 Bacteria 8807
164 Ga0105245_10057665 3300009098 Unclassified 3493
165 Ga0105245_11157094 3300009098 Bacteria 821
166 Ga0105247_10043175 3300009101 Bacteria 2762
167 Ga0114129_10004391 3300009147 Bacteria 19889
168 Ga0114129_10010902 3300009147 Bacteria 12948
169 Ga0114129_10022043 3300009147 Bacteria 9040
170 Ga0114129_10032946 3300009147 Bacteria 7322
171 Ga0114129_10201606 3300009147 Bacteria 2694
172 Ga0114129_11008250 3300009147 Bacteria 1048
173 Ga0105243_10002902 3300009148 Bacteria 14191
174 Ga0105243_11327935 3300009148 Bacteria 737
175 Ga0105241_10289660 3300009174 Bacteria 1401
176 Ga0105242_10010564 3300009176 Bacteria 7090
177 Ga0105242_10078916 3300009176 Bacteria 2748
178 Ga0105242_10255850 3300009176 Bacteria 1580
179 Ga0105242_10674948 3300009176 Bacteria 1008
180 Ga0105248_10028141 3300009177 Bacteria 6260
181 Ga0105248_10039682 3300009177 Bacteria 5277
182 Ga0105248_10136386 3300009177 Bacteria 2768
183 Ga0105248_10140883 3300009177 Bacteria 2720
184 Ga0105248_10167242 3300009177 Bacteria 2478
185 Ga0105248_10220090 3300009177 Bacteria 2137
186 Ga0105248_10236069 3300009177 Bacteria 2058
187 Ga0105248_10246938 3300009177 Bacteria 2009
188 Ga0105248_10298791 3300009177 Bacteria 1813
189 Ga0105248_10659662 3300009177 Bacteria 1180
190 Ga0105248_10844962 3300009177 Bacteria 1033
191 Ga0105248_10920452 3300009177 Bacteria 987
192 Ga0105248_11044088 3300009177 Bacteria 923
193 Ga0105238_10350371 3300009551 Bacteria 1465
194 Ga0105238_10439121 3300009551 Bacteria 1301
195 Ga0105249_10016379 3300009553 Bacteria 6576
196 Ga0105249_10545850 3300009553 Bacteria 1209
197 Ga0105246_10313557 3300011119 Bacteria 1271
198 Ga0157378_10255211 3300013297 Bacteria 1680
199 Ga0157378_10870924 3300013297 Bacteria 930
200 Ga0163162_10055826 3300013306 Bacteria 3977
201 Ga0163162_10681907 3300013306 Bacteria 1150
202 Ga0163162_10758952 3300013306 Bacteria 1089
203 Ga0157375_10080339 3300013308 Bacteria 3299
204 Ga0157375_10195555 3300013308 Bacteria 2177
205 Ga0157375_10310335 3300013308 Bacteria 1741
206 Ga0157375_10355037 3300013308 Bacteria 1632
207 Ga0163163_10026926 3300014325 Bacteria 5501
208 Ga0163163_10056436 3300014325 Bacteria 3882
209 Ga0163163_10258742 3300014325 Bacteria 1791
210 Ga0163163_10707406 3300014325 Bacteria 1071
211 Ga0163163_11609302 3300014325 Bacteria 710
212 Ga0157380_10252131 3300014326 Bacteria 1598
213 Ga0157377_10157533 3300014745 Bacteria 1409
214 Ga0157379_10025903 3300014968 Bacteria 5215
215 Ga0157379_10279676 3300014968 Bacteria 1518
216 Ga0157379_10290396 3300014968 Bacteria 1489
217 Ga0157376_10047422 3300014969 Bacteria 3546
218 Ga0157376_10074945 3300014969 Bacteria 2886
219 Ga0157376_10289537 3300014969 Bacteria 1546
220 Ga0157376_10396679 3300014969 Bacteria 1333
221 Ga0207713_1097689 3300025735 Bacteria 1019
222 Ga0207642_10050985 3300025899 Bacteria 1870
223 Ga0207642_10158696 3300025899 Bacteria 1212
224 Ga0207688_10146529 3300025901 Bacteria 1392
225 Ga0207680_10001250 3300025903 Bacteria 12016
226 Ga0207680_10289521 3300025903 Bacteria 1140
227 Ga0207685_10096040 3300025905 Bacteria 1258
228 Ga0207645_10001594 3300025907 Bacteria 18518
229 Ga0207645_10516888 3300025907 Bacteria 809
230 Ga0207643_10091865 3300025908 Bacteria 1771
231 Ga0207654_10026678 3300025911 Bacteria 3131
232 Ga0207662_10078603 3300025918 Bacteria 2008
233 Ga0207652_10227551 3300025921 Bacteria 1681
234 Ga0207646_10031961 3300025922 Bacteria 4764
235 Ga0207646_10904279 3300025922 Unclassified 783
236 Ga0207681_10050623 3300025923 Bacteria 2811
237 Ga0207681_10107364 3300025923 Bacteria 2024
238 Ga0207681_10125431 3300025923 Bacteria 1890
239 Ga0207681_10284805 3300025923 Bacteria 1302
240 Ga0207694_10243891 3300025924 Bacteria 1469
241 Ga0207687_10031519 3300025927 Unclassified 3583
242 Ga0207644_10010081 3300025931 Bacteria 6223
243 Ga0207686_10046371 3300025934 Bacteria 2680
244 Ga0207686_10412549 3300025934 Bacteria 1031
245 Ga0207686_10524559 3300025934 Bacteria 922
246 Ga0207709_10222709 3300025935 Bacteria 1362
247 Ga0207670_10215591 3300025936 Bacteria 1466
248 Ga0207670_10409273 3300025936 Bacteria 1086
249 Ga0207669_10060970 3300025937 Bacteria 2315
250 Ga0207669_10135218 3300025937 Bacteria 1701
251 Ga0207704_10038493 3300025938 Bacteria 2774
252 Ga0207704_10079295 3300025938 Bacteria 2115
253 Ga0207704_10251563 3300025938 Bacteria 1327
254 Ga0207704_10350462 3300025938 Bacteria 1149
255 Ga0207704_10376124 3300025938 Bacteria 1114
256 Ga0207691_10060205 3300025940 Bacteria 3451
257 Ga0207691_10173230 3300025940 Bacteria 1889
258 Ga0207691_10250045 3300025940 Bacteria 1531
259 Ga0207711_10008831 3300025941 Bacteria 8424
260 Ga0207711_10037751 3300025941 Bacteria 4105
261 Ga0207711_10060240 3300025941 Bacteria 3271
262 Ga0207711_10096338 3300025941 Bacteria 2611
263 Ga0207711_10209751 3300025941 Bacteria 1779
264 Ga0207711_10225800 3300025941 Bacteria 1714
265 Ga0207711_10305592 3300025941 Bacteria 1468
266 Ga0207711_10830170 3300025941 Bacteria 860
267 Ga0207689_10126737 3300025942 Bacteria 2100
268 Ga0207667_10595644 3300025949 Bacteria 1115
269 Ga0207651_10562155 3300025960 Bacteria 993
270 Ga0207712_10098887 3300025961 Bacteria 2165
271 Ga0207712_10416741 3300025961 Bacteria 1132
272 Ga0207668_10032464 3300025972 Bacteria 3450
273 Ga0207668_10201563 3300025972 Bacteria 1585
274 Ga0207668_10249339 3300025972 Bacteria 1441
275 Ga0207640_10047625 3300025981 Bacteria 2766
276 Ga0207640_10060639 3300025981 Bacteria 2502
277 Ga0207677_10042816 3300026023 Bacteria 3005
278 Ga0207677_10095991 3300026023 Bacteria 2168
279 Ga0207677_10222884 3300026023 Bacteria 1513
280 Ga0207703_10078150 3300026035 Bacteria 2748
281 Ga0207703_10154481 3300026035 Bacteria 2004
282 Ga0207703_10389905 3300026035 Bacteria 1290
283 Ga0207703_10595727 3300026035 Bacteria 1045
284 Ga0207708_10155195 3300026075 Bacteria 1805
285 Ga0207708_10722783 3300026075 Bacteria 853
286 Ga0207641_10007745 3300026088 Bacteria 8926
287 Ga0207641_10293515 3300026088 Bacteria 1533
288 Ga0207641_10537891 3300026088 Bacteria 1138
289 Ga0207641_10644578 3300026088 Bacteria 1040
290 Ga0207648_10012866 3300026089 Bacteria 7814
291 Ga0207648_10171146 3300026089 Bacteria 1920
292 Ga0207648_10509972 3300026089 Bacteria 1101
293 Ga0207648_10541459 3300026089 Bacteria 1068
294 Ga0207648_10782925 3300026089 Bacteria 887
295 Ga0207676_10088553 3300026095 Bacteria 2534
296 Ga0207676_10196794 3300026095 Bacteria 1778
297 Ga0207674_10799451 3300026116 Bacteria 910
298 Ga0207675_100001907 3300026118 Bacteria 20799
299 Ga0207675_100135075 3300026118 Bacteria 2340
300 Ga0207675_100363802 3300026118 Bacteria 1420
301 Ga0207675_100773237 3300026118 Unclassified 972
302 Ga0207675_100774860 3300026118 Bacteria 971
303 Ga0207683_10030413 3300026121 Bacteria 4679
304 Ga0207683_10159711 3300026121 Bacteria 2037
305 Ga0207683_10229936 3300026121 Bacteria 1691
306 Ga0207698_10318690 3300026142 Bacteria 1455
307 Ga0207428_10081997 3300027907 Bacteria 2518
308 Ga0207428_10113017 3300027907 Bacteria 2088
309 Ga0268266_10094646 3300028379 Bacteria 2622
310 Ga0268266_10292583 3300028379 Bacteria 1517
311 Ga0268266_11076274 3300028379 Bacteria 778
312 Ga0268265_10186693 3300028380 Bacteria 1786
313 Ga0268265_10308181 3300028380 Bacteria 1429
314 Ga0268265_11319449 3300028380 Bacteria 722
315 Ga0268264_10086153 3300028381 Bacteria 2698
316 Ga0268264_10171038 3300028381 Bacteria 1965
317 Ga0268264_10558582 3300028381 Bacteria 1123
318 Ga0268264_10843411 3300028381 Unclassified 917
319 Ga0268264_10869453 3300028381 Bacteria 904
320 Ga0307408_100869306 3300031548 Bacteria 823
321 Ga0373958_0000289 3300034819 Bacteria 6007
322 Ga0373959_0001751 3300034820 Bacteria 3468
323 Ga0373938_0001056 3300034957 Bacteria 4437
324 Ga0373928_0002669 3300035084 Bacteria 3452
325 Ga0373929_0001845 3300035085 Bacteria 3970
326 Ga0373940_0004879 3300035088 Bacteria 2864
327 Ga0373944_0050726 3300035089 Bacteria 1307
328 Ga0373949_0001175 3300035090 Bacteria 7777
329 Ga0373951_0001923 3300035091 Bacteria 5340
330 Ga0373952_0000424 3300035092 Bacteria 7296
331 Ga0373932_0001098 3300035112 Bacteria 7808
332 Ga0373932_0238439 3300035112 Bacteria 660
333 Ga0373939_0000373 3300035114 Bacteria 11301
334 Ga0373941_0000326 3300035115 Bacteria 9297
335 Ga0373941_0019762 3300035115 Bacteria 1880
336 Ga0373941_0077472 3300035115 Bacteria 1116
337 Ga0373960_0000339 3300035121 Bacteria 8979
338 Ga0373942_0001357 3300035207 Bacteria 6337
339 Ga0373961_0001420 3300035241 Bacteria 7122
340 Ga0373962_0000969 3300035242 Bacteria 6631
341 Ga0373962_0077780 3300035242 Bacteria 1002
342 Ga0373962_0111948 3300035242 Bacteria 862
343 Ga0316574_0172467 3300035398 Bacteria 1392
344 Ga0373931_0232885 3300035691 Bacteria 1113
345 Ga0373927_0504154 3300035695 Bacteria 800
346 Ga0373947_0043973 3300035725 Bacteria 2669
347 Ga0373937_0325044 3300036401 Bacteria 1455
348 Ga0373925_0218920 3300037068 Bacteria 1519
349 Ga0400484_14671 3300038725 Bacteria 1367
350 Ga0466963_0027044 3300044694 Bacteria 3671
351 Ga0451576_0006488 3300045051 Bacteria 14329
352 Ga0466967_0166757 3300045976 Bacteria 2070
353 Ga0495629_0042764 3300046459 Bacteria 3183
354 Ga0495628_0593695 3300046516 Bacteria 791
355 Ga0495640_0468077 3300046533 Unclassified 769
356 Ga0495586_0513993 3300046535 Bacteria 691
357 Ga0495587_0151866 3300046536 Bacteria 1320
358 Ga0495645_0002316 3300046543 Bacteria 12923
359 Ga0495667_0504705 3300046559 Bacteria 758
360 Ga0495635_0505461 3300046663 Bacteria 795
361 Ga0495658_0037269 3300046683 Bacteria 2687
362 Ga0495636_0231586 3300047318 Bacteria 850
363 Ga0495676_0377970 3300047321 Bacteria 943
364 Ga0495680_0449793 3300047322 Bacteria 882
365 Ga0495684_0075227 3300047471 Bacteria 2566
366 Ga0496102_0086766 3300048905 Bacteria 2891
367 Ga0496102_1378154 3300048905 Bacteria 624
368 Ga0496104_0060696 3300048907 Bacteria 3582
369 Ga0496104_0613305 3300048907 Bacteria 998
370 Ga0496105_0337412 3300048908 Bacteria 1206
371 Ga0496106_0145275 3300048909 Bacteria 1868
372 Ga0496108_0006559 3300048911 Bacteria 9442
373 Ga0496108_0811616 3300048911 Bacteria 807
374 Ga0496109_0116493 3300048912 Bacteria 2487
375 Ga0496109_0510841 3300048912 Bacteria 1134
376 Ga0496109_0773086 3300048912 Bacteria 898
377 Ga0496110_0216009 3300048913 Bacteria 1744
378 Ga0496112_0001090 3300048915 Bacteria 20076
379 Ga0496112_0269851 3300048915 Bacteria 1650
380 Ga0496112_0750450 3300048915 Bacteria 902
381 Ga0496113_0053085 3300048916 Bacteria 3030
382 Ga0496114_0041721 3300048917 Bacteria 3803
383 Ga0501080_0334264 3300049742 Bacteria 1369
384 Ga0501083_0162983 3300049744 Bacteria 1458
385 nmdc:mga05p37_12103_c1 3300050507 Bacteria 10299
386 nmdc:mga05p37_166060_c1 3300050507 Bacteria 2694
387 nmdc:mga05p37_47878_c1 3300050507 Bacteria 5257
388 nmdc:mga05p37_5644_c1 3300050507 Bacteria 14711
389 nmdc:mga05p37_647952_c1 3300050507 Bacteria 1183
390 nmdc:mga05p37_953_c2 3300050507 Bacteria 19948
391 nmdc:mga09592_260776_c1 3300050508 Bacteria 1503
392 nmdc:mga08y16_110612_c1 3300050511 Bacteria 2861
393 nmdc:mga08y16_1148136_c1 3300050511 Bacteria 750
394 nmdc:mga08y16_116695_c1 3300050511 Bacteria 2779
395 nmdc:mga0n895_227613_c1 3300050512 Bacteria 1893
396 nmdc:mga0n895_39152_c1 3300050512 Bacteria 4597
397 nmdc:mga0n895_45983_c1 3300050512 Bacteria 4263
398 nmdc:mga0n895_68470_c1 3300050512 Unclassified 1929
399 nmdc:mga0n895_792797_c1 3300050512 Bacteria 938
400 nmdc:mga0rr50_1025238_c1 3300050513 Bacteria 703
401 nmdc:mga0rr50_20012_c1 3300050513 Bacteria 4534
402 nmdc:mga0rr50_212505_c1 3300050513 Bacteria 1594
403 nmdc:mga0rr50_255233_c1 3300050513 Bacteria 1457
404 nmdc:mga0rr50_31078_c1 3300050513 Unclassified 3788
405 nmdc:mga0rr50_417094_c1 3300050513 Bacteria 1135
406 nmdc:mga0rr50_45159_c1 3300050513 Bacteria 3236
407 nmdc:mga0rr50_891105_c1 3300050513 Bacteria 759
408 nmdc:mga08x19_544055_c1 3300050514 Bacteria 821
409 nmdc:mga08x19_60475_c1 3300050514 Bacteria 2454
410 nmdc:mga08x19_81968_c1 3300050514 Bacteria 2119
411 nmdc:mga0a205_196946_c1 3300050515 Bacteria 1905
412 nmdc:mga0a205_21345_c1 3300050515 Bacteria 6126
413 nmdc:mga0a205_349744_c1 3300050515 Bacteria 1346
414 nmdc:mga0a205_61239_c1 3300050515 Bacteria 3635
415 nmdc:mga0a205_661922_c1 3300050515 Bacteria 895
416 Ga0495601_0058658 3300053077 Bacteria 2440
417 Ga0495595_0287341 3300053084 Bacteria 826
418 Ga0495619_0143311 3300053085 Unclassified 1646
419 Ga0590071_105089 3300059421 Bacteria 714
420 Ga0207679_10616158
421 Ga0065714_10106200
422 Ga0065712_10075799
423 Ga0065707_10397644
424 Ga0070676_10013663
425 Ga0070676_10468505
426 Ga0070676_10639538
427 Ga0070683_100338804
428 Ga0070690_100012029
429 Ga0070690_100376725
430 Ga0070670_100268002
431 Ga0068869_100081439
432 Ga0070666_10002893
433 Ga0070666_10155280
434 Ga0070666_10172907
435 Ga0070666_10294030
436 Ga0068868_100117831
437 Ga0068868_100706256
438 Ga0070689_100247282
439 Ga0070689_101376889
440 Ga0070687_100074006
441 Ga0070687_100868734
442 Ga0070692_10178906
443 Ga0070668_100013518
444 Ga0070669_100009638
445 Ga0070669_100010327
446 Ga0070669_100026179
447 Ga0070675_100140085
448 Ga0070671_100138651
449 Ga0070671_100333959
450 Ga0070674_100172595
451 Ga0070674_100233542
452 Ga0070674_100636446
453 Ga0070673_100211081
454 Ga0070673_100991241
455 Ga0070688_100036047
456 Ga0070688_100437752
457 Ga0070659_100194747
458 Ga0070667_100016593
459 Ga0070667_101090760
460 Ga0070710_10014366
461 Ga0070701_10005974
462 Ga0070701_10283804
463 Ga0070700_100402385
464 Ga0070700_100432808
465 Ga0070694_100004743
466 Ga0070678_100132646
467 Ga0070678_100622229
468 Ga0070662_100166248
469 Ga0068867_100052368
470 Ga0068867_100074751
471 Ga0068867_100116390
472 Ga0068867_100322314
473 Ga0068867_100435224
474 Ga0068867_100846726
475 Ga0070706_100373678
476 Ga0070707_100019122
477 Ga0070698_100026614
478 Ga0070698_100044115
479 Ga0070698_100185064
480 Ga0070698_100554443
481 Ga0070698_101367210
482 Ga0070699_100016959
483 Ga0070699_100329419
484 Ga0070699_100838477
485 Ga0070699_101281226
486 Ga0070684_100248496
487 Ga0070684_100479674
488 Ga0070697_100045788
489 Ga0070697_100097601
490 Ga0070672_100005912
491 Ga0070672_100084504
492 Ga0070672_100571976
493 Ga0070686_100002142
494 Ga0070686_100198203
495 Ga0070686_100369367
496 Ga0070686_100471906
497 Ga0070695_100039715
498 Ga0070695_100387642
499 Ga0070696_100064508
500 Ga0070696_100170698
501 Ga0070696_100234820
502 Ga0070693_100125236
503 Ga0070665_100004070
504 Ga0070665_100213505
505 Ga0070665_100549963
506 Ga0070665_101032491
507 Ga0070704_100051628
508 Ga0070704_101123093
509 Ga0068855_100390492
510 Ga0070664_100111469
511 Ga0068854_100174146
512 Ga0068854_100187664
513 Ga0070702_100003994
514 Ga0068852_100311251
515 Ga0068859_100802399
516 Ga0068864_100074438
517 Ga0068864_100222925
518 Ga0068866_10082944
519 Ga0068861_100000951
520 Ga0068861_100128477
521 Ga0068861_100348863
522 Ga0068861_100895246
523 Ga0068851_10103840
524 Ga0068863_100005998
525 Ga0068863_100144167
526 Ga0068863_100336176
527 Ga0068863_100590615
528 Ga0068863_100593868
529 Ga0068858_100041771
530 Ga0068858_100092151
531 Ga0068858_100167329
532 Ga0068858_100706014
533 Ga0068860_100180551
534 Ga0068860_100198275
535 Ga0068860_100244756
536 Ga0068860_101125622
537 Ga0068862_100012559
538 Ga0068862_100261680
539 Ga0068862_100523327
540 Ga0068862_100835357
541 Ga0068862_101140811
542 Ga0081455_10029710
543 Ga0081539_10058070
544 Ga0075363_100269169
545 Ga0075432_10016350
546 Ga0070715_10065082
547 Ga0097621_100002360
548 Ga0097621_100025403
549 Ga0097621_100070002
550 Ga0097621_100152214
551 Ga0097621_100293065
552 Ga0097621_100906462
553 Ga0068871_100003005
554 Ga0068871_100053576
555 Ga0068871_100056167
556 Ga0068871_100067821
557 Ga0075428_100280569
558 Ga0075433_10075918
559 Ga0075433_10178505
560 Ga0075433_10241527
561 Ga0075433_10737135
562 Ga0075434_100041926
563 Ga0075429_100553019
564 Ga0068865_100023541
565 Ga0068865_100125469
566 Ga0068865_100154836
567 Ga0068865_100401596
568 Ga0075436_100242290
569 Ga0075436_100271592
570 Ga0097620_100802420
571 Ga0075435_100000538
572 Ga0075435_100025892
573 Ga0075435_100026269
574 Ga0075435_100092891
575 Ga0075435_100211460
576 Ga0075435_100423512
577 Ga0105251_10074605
578 Ga0105240_11149079
579 Ga0111539_10221005
580 Ga0111539_10614312
581 Ga0111539_10957490
582 Ga0105245_10008794
583 Ga0105245_10057665
584 Ga0105245_11157094
585 Ga0105247_10043175
586 Ga0114129_10004391
587 Ga0114129_10010902
588 Ga0114129_10022043
589 Ga0114129_10032946
590 Ga0114129_10201606
591 Ga0114129_11008250
592 Ga0105243_10002902
593 Ga0105243_11327935
594 Ga0105241_10289660
595 Ga0105242_10010564
596 Ga0105242_10078916
597 Ga0105242_10255850
598 Ga0105242_10674948
599 Ga0105248_10028141
600 Ga0105248_10039682
601 Ga0105248_10136386
602 Ga0105248_10140883
603 Ga0105248_10167242
604 Ga0105248_10220090
605 Ga0105248_10236069
606 Ga0105248_10246938
607 Ga0105248_10298791
608 Ga0105248_10659662
609 Ga0105248_10844962
610 Ga0105248_10920452
611 Ga0105248_11044088
612 Ga0105238_10350371
613 Ga0105238_10439121
614 Ga0105249_10016379
615 Ga0105249_10545850
616 Ga0105246_10313557
617 Ga0157378_10255211
618 Ga0157378_10870924
619 Ga0163162_10055826
620 Ga0163162_10681907
621 Ga0163162_10758952
622 Ga0157375_10080339
623 Ga0157375_10195555
624 Ga0157375_10310335
625 Ga0157375_10355037
626 Ga0163163_10026926
627 Ga0163163_10056436
628 Ga0163163_10258742
629 Ga0163163_10707406
630 Ga0163163_11609302
631 Ga0157380_10252131
632 Ga0157377_10157533
633 Ga0157379_10025903
634 Ga0157379_10279676
635 Ga0157379_10290396
636 Ga0157376_10047422
637 Ga0157376_10074945
638 Ga0157376_10289537
639 Ga0157376_10396679
640 Ga0207713_1097689
641 Ga0207642_10050985
642 Ga0207642_10158696
643 Ga0207688_10146529
644 Ga0207680_10001250
645 Ga0207680_10289521
646 Ga0207685_10096040
647 Ga0207645_10001594
648 Ga0207645_10516888
649 Ga0207643_10091865
650 Ga0207654_10026678
651 Ga0207662_10078603
652 Ga0207652_10227551
653 Ga0207646_10031961
654 Ga0207646_10904279
655 Ga0207681_10050623
656 Ga0207681_10107364
657 Ga0207681_10125431
658 Ga0207681_10284805
659 Ga0207694_10243891
660 Ga0207687_10031519
661 Ga0207644_10010081
662 Ga0207686_10046371
663 Ga0207686_10412549
664 Ga0207686_10524559
665 Ga0207709_10222709
666 Ga0207670_10215591
667 Ga0207670_10409273
668 Ga0207669_10060970
669 Ga0207669_10135218
670 Ga0207704_10038493
671 Ga0207704_10079295
672 Ga0207704_10251563
673 Ga0207704_10350462
674 Ga0207704_10376124
675 Ga0207691_10060205
676 Ga0207691_10173230
677 Ga0207691_10250045
678 Ga0207711_10008831
679 Ga0207711_10037751
680 Ga0207711_10060240
681 Ga0207711_10096338
682 Ga0207711_10209751
683 Ga0207711_10225800
684 Ga0207711_10305592
685 Ga0207711_10830170
686 Ga0207689_10126737
687 Ga0207667_10595644
688 Ga0207651_10562155
689 Ga0207712_10098887
690 Ga0207712_10416741
691 Ga0207668_10032464
692 Ga0207668_10201563
693 Ga0207668_10249339
694 Ga0207640_10047625
695 Ga0207640_10060639
696 Ga0207677_10042816
697 Ga0207677_10095991
698 Ga0207677_10222884
699 Ga0207703_10078150
700 Ga0207703_10154481
701 Ga0207703_10389905
702 Ga0207703_10595727
703 Ga0207708_10155195
704 Ga0207708_10722783
705 Ga0207641_10007745
706 Ga0207641_10293515
707 Ga0207641_10537891
708 Ga0207641_10644578
709 Ga0207648_10012866
710 Ga0207648_10171146
711 Ga0207648_10509972
712 Ga0207648_10541459
713 Ga0207648_10782925
714 Ga0207676_10088553
715 Ga0207676_10196794
716 Ga0207674_10799451
717 Ga0207675_100001907
718 Ga0207675_100135075
719 Ga0207675_100363802
720 Ga0207675_100773237
721 Ga0207675_100774860
722 Ga0207683_10030413
723 Ga0207683_10159711
724 Ga0207683_10229936
725 Ga0207698_10318690
726 Ga0207428_10081997
727 Ga0207428_10113017
728 Ga0268266_10094646
729 Ga0268266_10292583
730 Ga0268266_11076274
731 Ga0268265_10186693
732 Ga0268265_10308181
733 Ga0268265_11319449
734 Ga0268264_10086153
735 Ga0268264_10171038
736 Ga0268264_10558582
737 Ga0268264_10843411
738 Ga0268264_10869453
739 Ga0307408_100869306
740 Ga0373958_0000289
741 Ga0373959_0001751
742 Ga0373938_0001056
743 Ga0373928_0002669
744 Ga0373929_0001845
745 Ga0373940_0004879
746 Ga0373944_0050726
747 Ga0373949_0001175
748 Ga0373951_0001923
749 Ga0373952_0000424
750 Ga0373932_0001098
751 Ga0373932_0238439
752 Ga0373939_0000373
753 Ga0373941_0000326
754 Ga0373941_0019762
755 Ga0373941_0077472
756 Ga0373960_0000339
757 Ga0373942_0001357
758 Ga0373961_0001420
759 Ga0373962_0000969
760 Ga0373962_0077780
761 Ga0373962_0111948
762 Ga0316574_0172467
763 Ga0373931_0232885
764 Ga0373927_0504154
765 Ga0373947_0043973
766 Ga0373937_0325044
767 Ga0373925_0218920
768 Ga0400484_14671
769 Ga0466963_0027044
770 Ga0451576_0006488
771 Ga0466967_0166757
772 Ga0495629_0042764
773 Ga0495628_0593695
774 Ga0495640_0468077
775 Ga0495586_0513993
776 Ga0495587_0151866
777 Ga0495645_0002316
778 Ga0495667_0504705
779 Ga0495635_0505461
780 Ga0495658_0037269
781 Ga0495636_0231586
782 Ga0495676_0377970
783 Ga0495680_0449793
784 Ga0495684_0075227
785 Ga0496102_0086766
786 Ga0496102_1378154
787 Ga0496104_0060696
788 Ga0496104_0613305
789 Ga0496105_0337412
790 Ga0496106_0145275
791 Ga0496108_0006559
792 Ga0496108_0811616
793 Ga0496109_0116493
794 Ga0496109_0510841
795 Ga0496109_0773086
796 Ga0496110_0216009
797 Ga0496112_0001090
798 Ga0496112_0269851
799 Ga0496112_0750450
800 Ga0496113_0053085
801 Ga0496114_0041721
802 Ga0501080_0334264
803 Ga0501083_0162983
804 nmdc:mga05p37_12103_c1
805 nmdc:mga05p37_166060_c1
806 nmdc:mga05p37_47878_c1
807 nmdc:mga05p37_5644_c1
808 nmdc:mga05p37_647952_c1
809 nmdc:mga05p37_953_c2
810 nmdc:mga09592_260776_c1
811 nmdc:mga08y16_110612_c1
812 nmdc:mga08y16_1148136_c1
813 nmdc:mga08y16_116695_c1
814 nmdc:mga0n895_227613_c1
815 nmdc:mga0n895_39152_c1
816 nmdc:mga0n895_45983_c1
817 nmdc:mga0n895_68470_c1
818 nmdc:mga0n895_792797_c1
819 nmdc:mga0rr50_1025238_c1
820 nmdc:mga0rr50_20012_c1
821 nmdc:mga0rr50_212505_c1
822 nmdc:mga0rr50_255233_c1
823 nmdc:mga0rr50_31078_c1
824 nmdc:mga0rr50_417094_c1
825 nmdc:mga0rr50_45159_c1
826 nmdc:mga0rr50_891105_c1
827 nmdc:mga08x19_544055_c1
828 nmdc:mga08x19_60475_c1
829 nmdc:mga08x19_81968_c1
830 nmdc:mga0a205_196946_c1
831 nmdc:mga0a205_21345_c1
832 nmdc:mga0a205_349744_c1
833 nmdc:mga0a205_61239_c1
834 nmdc:mga0a205_661922_c1
835 Ga0495601_0058658
836 Ga0495595_0287341
837 Ga0495619_0143311
838 Ga0590071_105089

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00908

dTDP_sugar_isom

dTDP-4-dehydrorhamnose 3,5-epimerase

5

160

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ixk-assembly1.cif.gz_B rmlc p aeruginosa with dtdp-4-keto rhamnnose (the product of the reaction) 0.9794 2 174
7pvi-assembly1.cif.gz_BBB dtdp-sugar epimerase 0.9752 2 173
2ixh-assembly1.cif.gz_A rmlc p aeruginosa with dtdp-rhamnose 0.9745 2 174
6ndr-assembly1.cif.gz_B crystal structure of dtdp-6-deoxy-d-glucose-3,5-epimerase rmlc from legionella pneumophila philadelphia 1 in complex with dtdp-4-keto-l-rhamnose 0.9731 2 182
1ep0-assembly1.cif.gz_A high resolution crystal structure of dtdp-6-deoxy-d-xylo-4-hexulose 3,5-epimerase from methanobacterium thermoautotrophicum 0.9725 2 174
ID Description Score Start End Superfamily
1epzA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9727 2 174 2.60.120.10
2ixcB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9589 1 181 2.60.120.10
6dinA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9586 2 174 2.60.120.10
2c0zA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9544 1 181 2.60.120.10
2b9uD00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9504 2 174 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A7C8XNS0-F1-model_v4 deleted 0.9951 43 164
AF-A0A432R1U7-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9934 44 173 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A382AVK9-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase 0.9924 35 181 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A4U9HCF6-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9922 40 175 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A1F2TUZ0-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase 0.9904 46 181 GO:0000271
GO:0005829
GO:0008830

Map