metagRoot

F439521

General Info

Members	Datasets	Scaffolds	Average Seq Length
419	286	397	119

Family's Representative Sequence

Representative Sequence	3300012505\|Ga0157339_1012814\|Ga0157339_10128142
Length	141
Sequence	MKDDAFRLSSFVFCLPPNERIPMPNYVDGFVVPVPRNKAAAYRTLARKAGKIWREYGALAYIECVGDDVKPGKLTSFPQAVKLKPSEVVWFSWIVYKSRRHRDAVLAKVMKDPRMTGMAPSAMPFDGKRMIYGGFKSIVEL

Samples

	Sample ID	Description	Type	Environment
1	2582581308	Rhizobium sp. OK494	Isolate	Rhizosphere
2	2585427527	Rhizobium lusitanum YR374	Isolate	Rhizosphere
3	2585427530	Rhizobium tropici YR635	Isolate	Rhizosphere
4	2599185214	Variovorax sp. NFACC26	Isolate	Rhizoplane
5	2599185226	Variovorax sp. NFACC27	Isolate	Rhizoplane
6	2599185227	Variovorax sp. NFACC28	Isolate	Rhizoplane
7	2599185229	Variovorax sp. NFACC29	Isolate	Endosphere
8	2643221683	Variovorax sp. Root473	Isolate	Unclassified
9	2818991453	Rhizobium lusitanum 1158	Isolate	Unclassified
10	2842677519	Variovorax sp. R-72495	Isolate	Unclassified
11	2885198086	Variovorax sp. 679	Isolate	Unclassified
12	2885211737	Variovorax sp. 553	Isolate	Unclassified
13	2904541872	Variovorax sp. 1615	Isolate	Rhizosphere
14	2928070936	Variovorax gossypii 1167	Isolate	Unclassified
15	2928084124	Variovorax paradoxus 1218	Isolate	Unclassified
16	2929160207	Variovorax sp. R-72349 Hybrid assembly	Isolate	Unclassified
17	2929520902	Variovorax beijingensis 502	Isolate	Unclassified
18	2941489479	Lysobacter enzymogenes 2943	Isolate	Rhizosphere
19	2945909444	Variovorax sp. CRF3-Va-1 W1I1	Isolate	Rhizosphere
20	2945984333	Variovorax sp. W2I14	Isolate	Rhizosphere
21	2954767861	Variovorax sp. TBS-050B	Isolate	Rhizosphere
22	2995948881	Lysobacter enzymogenes B25	Isolate	Unclassified
23	3300002075	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4	Metagenome	Rhizosphere
24	3300002741	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL	Metagenome	Unclassified
25	3300002773	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS	Metagenome	Endosphere
26	3300003203	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
27	3300003322	Sugarcane root Sample L2	Metagenome	Unclassified
28	3300003771	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2	Metagenome	Endosphere
29	3300003773	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2	Metagenome	Endosphere
30	3300003775	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2	Metagenome	Endosphere
31	3300003781	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2	Metagenome	Endosphere
32	3300003784	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2	Metagenome	Endosphere
33	3300003790	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2	Metagenome	Endosphere
34	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
35	3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2)	Metagenome	Rhizosphere
36	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
37	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
38	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
39	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
40	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
41	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
42	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
43	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
44	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
45	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
46	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
47	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
48	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
49	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
50	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
51	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
52	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
53	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
54	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
55	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
56	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
57	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
58	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
59	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
60	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
61	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
62	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
63	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
64	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
65	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
66	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
67	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
68	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
69	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
70	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
71	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
72	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
73	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
74	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
75	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
76	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
77	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
78	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
79	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
80	3300005981	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Metagenome	Rhizosphere
81	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
82	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
83	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
84	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
85	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
86	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
87	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
88	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
89	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
90	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
91	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
92	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
93	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
94	3300006948	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15	Metagenome	Nodule
95	3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Metagenome	Rhizosphere
96	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
97	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
98	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
99	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
100	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
101	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
102	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
103	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
104	3300009978	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG	Metagenome	Rhizosphere
105	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
106	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
107	3300012505	Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610	Metagenome	Rhizosphere
108	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
109	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
110	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
111	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
112	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
113	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
114	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
115	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
116	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
117	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
118	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
119	3300015261	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG	Metagenome	Rhizosphere
120	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
121	3300015265	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG	Metagenome	Rhizosphere
122	3300015689	Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02	Metagenome	Rhizosphere
123	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
124	3300020069	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
125	3300020070	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
126	3300020082	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
127	3300025250	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2)	Metagenome	Unclassified
128	3300025256	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2)	Metagenome	Unclassified
129	3300025263	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3)	Metagenome	Endosphere
130	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
131	3300025291	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3)	Metagenome	Endosphere
132	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
133	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
134	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
135	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
136	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
137	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
138	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
148	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
149	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
150	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
151	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
152	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
153	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
154	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
155	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
156	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
157	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
158	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
159	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
160	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
161	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
162	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
163	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
164	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
165	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
166	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
167	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
168	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
169	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
170	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
171	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
172	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
173	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
174	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
175	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
176	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
177	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
178	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
179	3300027666	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2)	Metagenome	Nodule
180	3300027866	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2)	Metagenome	Endosphere
181	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
182	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
183	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
184	3300030522	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM	Metagenome	Unclassified
185	3300031249	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG	Metagenome	Rhizosphere
186	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
187	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
188	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
189	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
190	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
191	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
192	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
193	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
194	3300041404	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272	Metagenome	Rhizosphere
195	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
196	3300041460	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG	Metagenome	Rhizoplane
197	3300041491	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG	Metagenome	Unclassified
198	3300041505	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG	Metagenome	Unclassified
199	3300042007	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290	Metagenome	Rhizosphere
200	3300042010	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431	Metagenome	Rhizosphere
201	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
202	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
203	3300046520	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere	Metagenome	Rhizosphere
204	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
205	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
206	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
207	3300046664	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere	Metagenome	Rhizosphere
208	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
209	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
210	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
211	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
212	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
213	3300048089	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere	Metagenome	Rhizosphere
214	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
215	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
216	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
217	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
218	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
219	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
220	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
221	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
222	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
223	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
224	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
225	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
226	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
227	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
228	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
229	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
230	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
231	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
232	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
233	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
234	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
235	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
236	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
237	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
238	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
239	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
240	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
241	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
242	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
243	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
244	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
245	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
246	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
247	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
248	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
249	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
250	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
251	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
252	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
253	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
254	3300049671	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought	Metagenome	Rhizosphere
255	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
256	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
257	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
258	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
259	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
260	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
261	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
262	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
263	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
264	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
265	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
266	3300050495	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation	Metagenome	Endosphere
267	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
268	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
269	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
270	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
271	3300053079	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere	Metagenome	Endosphere
272	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
273	3300053094	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere	Metagenome	Endosphere
274	3300053108	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere	Metagenome	Endosphere
275	3300053116	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere	Metagenome	Endosphere
276	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
277	3300053142	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere	Metagenome	Endosphere
278	3300053151	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere	Metagenome	Endosphere
279	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
280	3300053158	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere	Metagenome	Endosphere
281	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere
282	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
283	3300059421	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
284	3300059426	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
285	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
286	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	94.03
Metatranscriptomes	0.72
Isolates	5.25

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	16.71
Nodule	0.48
Rhizoplane	3.82
Rhizosphere	70.64
Stem	0
Stem Tuber	0
Unclassified	8.35

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24738J21930_10066922	3300002075	Bacteria	741
2	JGI25157J39369_1005883	3300002741	Bacteria	1933
3	JGI25152J39213_1033236	3300002773	Bacteria	777
4	JGI25406J46586_10033031	3300003203	Bacteria	1916
5	rootL2_10254917	3300003322	Bacteria	2408
6	Ga0055526_1000032	3300003771	Bacteria	143118
7	Ga0055537_1000309	3300003773	Bacteria	33572
8	Ga0055537_1033306	3300003773	Bacteria	649
9	Ga0055524_1000017	3300003775	Bacteria	235608
10	Ga0055524_1000054	3300003775	Bacteria	143118
11	Ga0055536_1001974	3300003781	Bacteria	11778
12	Ga0055536_1002777	3300003781	Bacteria	9689
13	Ga0055534_1000041	3300003784	Bacteria	101875
14	Ga0055528_1000021	3300003790	Bacteria	143118
15	Ga0055540_1001996	3300003792	Bacteria	11405
16	Ga0065704_10328287	3300005289	Bacteria	829
17	Ga0070658_10070095	3300005327	Bacteria	2869
18	Ga0070683_100332812	3300005329	Bacteria	1446
19	Ga0070670_100179674	3300005331	Bacteria	1837
20	Ga0068869_100986924	3300005334	Bacteria	733
21	Ga0070682_100087080	3300005337	Bacteria	2036
22	Ga0070682_101596495	3300005337	Bacteria	564
23	Ga0068868_100080147	3300005338	Bacteria	2616
24	Ga0070660_100033154	3300005339	Bacteria	3890
25	Ga0070689_100743811	3300005340	Bacteria	859
26	Ga0070687_100996205	3300005343	Bacteria	607
27	Ga0070661_101446754	3300005344	Bacteria	579
28	Ga0070692_10015706	3300005345	Bacteria	3586
29	Ga0070668_100461088	3300005347	Bacteria	1094
30	Ga0070668_100688423	3300005347	Bacteria	901
31	Ga0070668_101050364	3300005347	Bacteria	734
32	Ga0070675_100077906	3300005354	Bacteria	2760
33	Ga0070674_101234745	3300005356	Bacteria	664
34	Ga0070673_100090186	3300005364	Bacteria	2504
35	Ga0070673_100323386	3300005364	Bacteria	1363
36	Ga0070688_101683065	3300005365	Bacteria	519
37	Ga0070659_100025324	3300005366	Bacteria	4555
38	Ga0070701_11373727	3300005438	Bacteria	507
39	Ga0070705_101158918	3300005440	Bacteria	635
40	Ga0070705_101269865	3300005440	Bacteria	609
41	Ga0070700_100018197	3300005441	Bacteria	4035
42	Ga0070694_100764479	3300005444	Bacteria	790
43	Ga0070663_100046612	3300005455	Bacteria	3068
44	Ga0070663_100097141	3300005455	Bacteria	2193
45	Ga0070663_102135906	3300005455	Bacteria	505
46	Ga0070678_101367816	3300005456	Bacteria	660
47	Ga0070662_100139273	3300005457	Bacteria	1879
48	Ga0070662_100899986	3300005457	Bacteria	755
49	Ga0068867_100493218	3300005459	Bacteria	1051
50	Ga0070685_10074177	3300005466	Bacteria	2024
51	Ga0070684_100244858	3300005535	Bacteria	1638
52	Ga0068853_100069924	3300005539	Bacteria	3055
53	Ga0068853_101454405	3300005539	Bacteria	663
54	Ga0068853_102320774	3300005539	Bacteria	520
55	Ga0070672_100011892	3300005543	Bacteria	6084
56	Ga0070672_101980095	3300005543	Bacteria	525
57	Ga0070696_100382787	3300005546	Bacteria	1097
58	Ga0070696_101056407	3300005546	Bacteria	681
59	Ga0070665_100266976	3300005548	Bacteria	1713
60	Ga0068855_100133822	3300005563	Bacteria	2829
61	Ga0068855_100201023	3300005563	Bacteria	2243
62	Ga0068855_102401802	3300005563	Bacteria	526
63	Ga0070664_100033932	3300005564	Bacteria	4278
64	Ga0068857_100578791	3300005577	Bacteria	1060
65	Ga0068854_100233032	3300005578	Bacteria	1462
66	Ga0068854_100527089	3300005578	Bacteria	999
67	Ga0068856_100791907	3300005614	Bacteria	968
68	Ga0068852_100063751	3300005616	Bacteria	3210
69	Ga0068852_100081000	3300005616	Bacteria	2880
70	Ga0068864_101056808	3300005618	Bacteria	807
71	Ga0068866_10052308	3300005718	Bacteria	2083
72	Ga0068866_10622148	3300005718	Unclassified	732
73	Ga0068861_100214252	3300005719	Bacteria	1624
74	Ga0068861_100367387	3300005719	Bacteria	1267
75	Ga0068858_100073299	3300005842	Bacteria	3179
76	Ga0068860_100135702	3300005843	Bacteria	2363
77	Ga0068862_100432265	3300005844	Bacteria	1237
78	Ga0081455_10047409	3300005937	Bacteria	3722
79	Ga0081538_10006659	3300005981	Bacteria	10126
80	Ga0081540_1034684	3300005983	Bacteria	2716
81	Ga0081539_10000244	3300005985	Bacteria	127514
82	Ga0075365_10035915	3300006038	Bacteria	3209
83	Ga0075365_10089393	3300006038	Bacteria	2097
84	Ga0075365_10668672	3300006038	Bacteria	734
85	Ga0075368_10121668	3300006042	Bacteria	1081
86	Ga0075368_10419269	3300006042	Bacteria	590
87	Ga0075363_100084372	3300006048	Bacteria	1742
88	Ga0075363_100308101	3300006048	Bacteria	920
89	Ga0075363_100542034	3300006048	Bacteria	693
90	Ga0075364_10029953	3300006051	Bacteria	3492
91	Ga0075364_10579849	3300006051	Bacteria	767
92	Ga0075362_10191583	3300006177	Bacteria	993
93	Ga0075367_10225873	3300006178	Bacteria	1172
94	Ga0075367_10486481	3300006178	Bacteria	782
95	Ga0075367_10782531	3300006178	Bacteria	607
96	Ga0075366_10001868	3300006195	Bacteria	10618
97	Ga0068871_101352261	3300006358	Bacteria	671
98	Ga0075430_100531922	3300006846	Bacteria	970
99	Ga0075433_10587184	3300006852	Unclassified	978
100	Ga0068865_100104108	3300006881	Bacteria	2083
101	Ga0099826_10000008	3300006948	Bacteria	380974
102	Ga0105244_10117030	3300009036	Bacteria	1293
103	Ga0105244_10427575	3300009036	Bacteria	609
104	Ga0105240_10000014	3300009093	Bacteria	482033
105	Ga0105240_10033266	3300009093	Bacteria	6665
106	Ga0111539_10054250	3300009094	Bacteria	4770
107	Ga0105245_10140444	3300009098	Bacteria	2274
108	Ga0114129_12299672	3300009147	Bacteria	647
109	Ga0105243_10000651	3300009148	Bacteria	34393
110	Ga0105243_10005188	3300009148	Bacteria	10198
111	Ga0105243_10122528	3300009148	Bacteria	2195
112	Ga0105242_11086890	3300009176	Unclassified	813
113	Ga0105242_11576350	3300009176	Bacteria	690
114	Ga0105237_10000371	3300009545	Bacteria	63699
115	Ga0105237_10012821	3300009545	Bacteria	8816
116	Ga0105237_10846302	3300009545	Bacteria	921
117	Ga0105237_10946163	3300009545	Bacteria	868
118	Ga0105249_10267892	3300009553	Bacteria	1700
119	Ga0105249_11528083	3300009553	Bacteria	740
120	Ga0105148_106873	3300009978	Bacteria	839
121	Ga0105239_10004698	3300010375	Bacteria	16222
122	Ga0105239_10052325	3300010375	Bacteria	4478
123	Ga0105246_10077399	3300011119	Bacteria	2360
124	Ga0105246_10107948	3300011119	Bacteria	2039
125	Ga0105246_12128327	3300011119	Bacteria	544
126	Ga0157339_1012814	3300012505	Bacteria	793
127	Ga0157371_10597403	3300013102	Bacteria	821
128	Ga0157370_10001013	3300013104	Bacteria	35493
129	Ga0157370_10662134	3300013104	Bacteria	954
130	Ga0157369_10177139	3300013105	Bacteria	2244
131	Ga0157374_10769363	3300013296	Bacteria	978
132	Ga0163162_10170621	3300013306	Bacteria	2300
133	Ga0163162_10253820	3300013306	Bacteria	1890
134	Ga0157372_10564827	3300013307	Bacteria	1326
135	Ga0157375_10107402	3300013308	Bacteria	2884
136	Ga0163163_10243153	3300014325	Bacteria	1850
137	Ga0157380_10206461	3300014326	Bacteria	1747
138	Ga0157380_10280691	3300014326	Bacteria	1524
139	Ga0157380_12733906	3300014326	Bacteria	560
140	Ga0182008_10009294	3300014497	Bacteria	5313
141	Ga0182008_10126724	3300014497	Bacteria	1271
142	Ga0157377_10168930	3300014745	Bacteria	1366
143	Ga0182006_1071233	3300015261	Bacteria	1289
144	Ga0182007_10004389	3300015262	Bacteria	6402
145	Ga0182005_1002036	3300015265	Bacteria	7584
146	Ga0183360_10001	3300015689	Bacteria	3943671
147	Ga0163161_10001642	3300017792	Bacteria	16447
148	Ga0197907_11069277	3300020069	Bacteria	1478
149	Ga0206356_11361170	3300020070	Bacteria	656
150	Ga0206353_10055967	3300020082	Bacteria	2096
151	Ga0209026_1000207	3300025250	Bacteria	81332
152	Ga0209759_1003949	3300025256	Bacteria	5704
153	Ga0209759_1014266	3300025256	Bacteria	2111
154	Ga0209565_1000001	3300025263	Bacteria	2950419
155	Ga0209565_1004493	3300025263	Bacteria	4220
156	Ga0209565_1005028	3300025263	Bacteria	3914
157	Ga0209673_1000001	3300025273	Bacteria	3176258
158	Ga0209675_1000001	3300025291	Bacteria	2950293
159	Ga0209676_1000304	3300025292	Bacteria	98482
160	Ga0209564_1000001	3300025295	Bacteria	3176258
161	Ga0209564_1015297	3300025295	Bacteria	3130
162	Ga0209050_1030999	3300025298	Bacteria	1675
163	Ga0209256_1000002	3300025299	Bacteria	1906740
164	Ga0209256_1000018	3300025299	Bacteria	568467
165	Ga0209256_1045421	3300025299	Bacteria	1092
166	Ga0209051_1000117	3300025303	Bacteria	150156
167	Ga0209257_1020775	3300025304	Bacteria	2411
168	Ga0207656_10154791	3300025321	Bacteria	1087
169	Ga0207688_10000869	3300025901	Bacteria	15256
170	Ga0207680_10861131	3300025903	Bacteria	650
171	Ga0207647_10044996	3300025904	Bacteria	2755
172	Ga0207705_10214285	3300025909	Bacteria	1461
173	Ga0207695_10000037	3300025913	Bacteria	476303
174	Ga0207695_10045297	3300025913	Bacteria	4670
175	Ga0207671_10000490	3300025914	Bacteria	53783
176	Ga0207671_10003788	3300025914	Bacteria	14849
177	Ga0207660_10550455	3300025917	Bacteria	938
178	Ga0207662_10940571	3300025918	Bacteria	613
179	Ga0207657_10111611	3300025919	Bacteria	2257
180	Ga0207649_10375028	3300025920	Bacteria	1059
181	Ga0207681_11149253	3300025923	Bacteria	652
182	Ga0207650_10265428	3300025925	Bacteria	1394
183	Ga0207659_10037750	3300025926	Bacteria	3356
184	Ga0207687_10252050	3300025927	Bacteria	1404
185	Ga0207706_10095259	3300025933	Bacteria	2618
186	Ga0207709_10000313	3300025935	Bacteria	52906
187	Ga0207709_10096728	3300025935	Bacteria	1943
188	Ga0207670_10214104	3300025936	Bacteria	1471
189	Ga0207704_10012913	3300025938	Bacteria	4161
190	Ga0207665_10010245	3300025939	Bacteria	6158
191	Ga0207691_10005127	3300025940	Bacteria	12642
192	Ga0207689_10700284	3300025942	Bacteria	854
193	Ga0207661_10141697	3300025944	Bacteria	2069
194	Ga0207661_10654703	3300025944	Bacteria	965
195	Ga0207679_10950085	3300025945	Bacteria	787
196	Ga0207679_11652595	3300025945	Bacteria	587
197	Ga0207667_10283719	3300025949	Bacteria	1692
198	Ga0207667_10335121	3300025949	Bacteria	1544
199	Ga0207667_11760470	3300025949	Bacteria	585
200	Ga0207651_10514612	3300025960	Bacteria	1036
201	Ga0207712_10369009	3300025961	Bacteria	1198
202	Ga0207668_10351800	3300025972	Bacteria	1232
203	Ga0207668_10399920	3300025972	Bacteria	1161
204	Ga0207640_10067352	3300025981	Bacteria	2396
205	Ga0207640_10372213	3300025981	Bacteria	1155
206	Ga0207658_10592099	3300025986	Bacteria	996
207	Ga0207658_11854453	3300025986	Bacteria	550
208	Ga0207703_10125831	3300026035	Bacteria	2206
209	Ga0207639_10192849	3300026041	Bacteria	1741
210	Ga0207639_10541385	3300026041	Bacteria	1068
211	Ga0207639_12033895	3300026041	Bacteria	536
212	Ga0207678_10004621	3300026067	Bacteria	12368
213	Ga0207678_10006781	3300026067	Bacteria	10151
214	Ga0207708_10010233	3300026075	Bacteria	6964
215	Ga0207702_10759675	3300026078	Bacteria	957
216	Ga0207648_10042365	3300026089	Bacteria	3996
217	Ga0207676_10991925	3300026095	Bacteria	827
218	Ga0207674_10053507	3300026116	Bacteria	4114
219	Ga0207674_10725294	3300026116	Bacteria	959
220	Ga0207675_100166620	3300026118	Bacteria	2105
221	Ga0207675_101246370	3300026118	Bacteria	764
222	Ga0207683_11339600	3300026121	Bacteria	662
223	Ga0207698_10046387	3300026142	Bacteria	3281
224	Ga0207698_10705572	3300026142	Bacteria	1004
225	Ga0209282_1000005	3300027666	Bacteria	380858
226	Ga0209813_10265728	3300027866	Bacteria	656
227	Ga0209813_10394659	3300027866	Bacteria	556
228	Ga0268265_10427584	3300028380	Bacteria	1231
229	Ga0268265_11889646	3300028380	Bacteria	604
230	Ga0268264_10493966	3300028381	Bacteria	1192
231	Ga0268264_10970758	3300028381	Bacteria	855
232	Ga0307515_10431493	3300028794	Bacteria	936
233	Ga0307512_10108065	3300030522	Bacteria	1848
234	Ga0265339_10210962	3300031249	Bacteria	954
235	Ga0307513_10161499	3300031456	Bacteria	2133
236	Ga0307408_100239481	3300031548	Bacteria	1490
237	Ga0307408_100536686	3300031548	Bacteria	1030
238	Ga0307408_101234150	3300031548	Bacteria	698
239	Ga0307405_10213556	3300031731	Bacteria	1410
240	Ga0307406_10080233	3300031901	Bacteria	2166
241	Ga0307406_10129442	3300031901	Bacteria	1769
242	Ga0307407_10251048	3300031903	Unclassified	1212
243	Ga0307407_10543537	3300031903	Archaea	858
244	Ga0307407_10958381	3300031903	Bacteria	659
245	Ga0307409_101851565	3300031995	Bacteria	633
246	Ga0307416_100100232	3300032002	Bacteria	2518
247	Ga0307416_100127144	3300032002	Bacteria	2285
248	Ga0395898_1124982	3300037466	Bacteria	718
249	Ga0439436_0150410	3300041404	Bacteria	656
250	Ga0439465_0017039	3300041413	Bacteria	2267
251	Ga0451802_1844462	3300041460	Bacteria	657
252	Ga0451833_0862804	3300041491	Bacteria	565
253	Ga0451849_0110161	3300041505	Bacteria	641
254	Ga0439449_0074404	3300042007	Bacteria	1252
255	Ga0439452_051727	3300042010	Bacteria	939
256	Ga0451577_0078439	3300042876	Bacteria	2944
257	Ga0451577_0143239	3300042876	Bacteria	2148
258	Ga0495620_0059149	3300046515	Bacteria	1602
259	Ga0495637_0046801	3300046520	Bacteria	1828
260	Ga0495648_0323456	3300046524	Bacteria	714
261	Ga0495654_0013119	3300046530	Bacteria	4438
262	Ga0495625_0061884	3300046660	Bacteria	2647
263	Ga0495659_0045932	3300046664	Bacteria	1576
264	Ga0495647_0013438	3300046681	Bacteria	2836
265	Ga0495658_0072840	3300046683	Bacteria	1999
266	Ga0495658_0268489	3300046683	Bacteria	1075
267	Ga0495670_0303755	3300046691	Bacteria	855
268	Ga0495671_0001625	3300046692	Bacteria	14758
269	Ga0495676_0346576	3300047321	Bacteria	994
270	Ga0495614_0217564	3300048089	Bacteria	868
271	Ga0496100_0003636	3300048903	Bacteria	8058
272	Ga0496100_1410866	3300048903	Bacteria	550
273	Ga0496102_0003723	3300048905	Bacteria	12887
274	Ga0496103_0007585	3300048906	Bacteria	6461
275	Ga0496106_0111162	3300048909	Bacteria	2133
276	Ga0496107_0027317	3300048910	Bacteria	4052
277	Ga0496107_0195505	3300048910	Bacteria	1503
278	Ga0496108_0717296	3300048911	Bacteria	866
279	Ga0496109_0067687	3300048912	Bacteria	3272
280	Ga0496110_1366763	3300048913	Bacteria	618
281	Ga0496113_0008924	3300048916	Bacteria	6561
282	Ga0496113_0117159	3300048916	Bacteria	2079
283	Ga0496116_0008405	3300048919	Bacteria	8961
284	Ga0496117_0001336	3300048920	Bacteria	36255
285	Ga0496118_0004095	3300048921	Bacteria	17672
286	Ga0496119_0005806	3300048922	Bacteria	11672
287	Ga0496120_0002450	3300048923	Bacteria	18765
288	Ga0496121_0000523	3300048924	Bacteria	73281
289	Ga0496121_0001813	3300048924	Bacteria	34507
290	Ga0496121_0008625	3300048924	Bacteria	11931
291	Ga0496122_0006435	3300048925	Bacteria	13487
292	Ga0496123_0005654	3300048926	Bacteria	12483
293	Ga0496123_0174602	3300048926	Bacteria	1129
294	Ga0496124_0005932	3300048927	Bacteria	13515
295	Ga0496125_0010744	3300048928	Bacteria	9222
296	Ga0496125_0263108	3300048928	Bacteria	1080
297	Ga0496126_0174771	3300048929	Bacteria	1827
298	Ga0501031_0045396	3300049568	Bacteria	2867
299	Ga0501033_0995038	3300049570	Bacteria	561
300	Ga0501033_1018104	3300049570	Bacteria	553
301	Ga0501034_0000581	3300049571	Bacteria	57797
302	Ga0501034_0146698	3300049571	Bacteria	2337
303	Ga0501036_0164888	3300049572	Bacteria	1868
304	Ga0501036_0239409	3300049572	Bacteria	1522
305	Ga0501037_0970034	3300049573	Bacteria	555
306	Ga0501039_0103381	3300049575	Bacteria	2224
307	Ga0501039_0920328	3300049575	Bacteria	680
308	Ga0501040_0294900	3300049576	Bacteria	1159
309	Ga0501040_0353641	3300049576	Bacteria	1053
310	Ga0501040_0361073	3300049576	Bacteria	1041
311	Ga0501041_0253046	3300049577	Bacteria	1107
312	Ga0501042_0014091	3300049578	Bacteria	5452
313	Ga0501043_1095675	3300049579	Bacteria	563
314	Ga0501046_0042667	3300049580	Bacteria	3615
315	Ga0501046_0397215	3300049580	Bacteria	996
316	Ga0501047_0066180	3300049581	Bacteria	3483
317	Ga0501047_0166687	3300049581	Bacteria	2073
318	Ga0501048_0170203	3300049582	Bacteria	1543
319	Ga0501048_0359340	3300049582	Unclassified	1039
320	Ga0501067_0482824	3300049583	Bacteria	693
321	Ga0501070_0501820	3300049586	Bacteria	975
322	Ga0501070_1316340	3300049586	Bacteria	551
323	Ga0501072_0008430	3300049588	Bacteria	7823
324	Ga0501072_0011605	3300049588	Bacteria	6731
325	Ga0501072_0279435	3300049588	Unclassified	1328
326	Ga0501072_0552023	3300049588	Bacteria	910
327	Ga0501072_0841705	3300049588	Bacteria	717
328	Ga0501073_0296864	3300049589	Bacteria	1115
329	Ga0501073_0523993	3300049589	Bacteria	819
330	Ga0501073_1084025	3300049589	Bacteria	551
331	Ga0501074_0167585	3300049590	Bacteria	1568
332	Ga0501074_0389815	3300049590	Bacteria	988
333	Ga0501074_0948566	3300049590	Bacteria	605
334	Ga0501075_0093522	3300049591	Bacteria	2282
335	Ga0501075_0550689	3300049591	Bacteria	880
336	Ga0501076_0004698	3300049592	Bacteria	9743
337	Ga0501076_0016144	3300049592	Bacteria	5653
338	Ga0501076_0346681	3300049592	Bacteria	1219
339	Ga0501076_0407098	3300049592	Bacteria	1119
340	Ga0501238_011975	3300049671	Bacteria	1169
341	Ga0501079_0205960	3300049741	Bacteria	1536
342	Ga0501079_0526786	3300049741	Bacteria	929
343	Ga0501079_1021078	3300049741	Unclassified	651
344	Ga0501079_1094978	3300049741	Bacteria	628
345	Ga0501080_0793341	3300049742	Unclassified	831
346	Ga0501081_0026957	3300049743	Bacteria	3877
347	Ga0501081_0028884	3300049743	Bacteria	3745
348	Ga0501081_0100665	3300049743	Bacteria	2043
349	Ga0501081_1339582	3300049743	Unclassified	543
350	Ga0501083_1024678	3300049744	Bacteria	537
351	Ga0501083_1089728	3300049744	Bacteria	520
352	Ga0501044_0257263	3300049823	Bacteria	1685
353	Ga0501044_0911753	3300049823	Bacteria	753
354	Ga0501044_1314498	3300049823	Unclassified	589
355	Ga0501045_0063412	3300049824	Bacteria	2712
356	Ga0501045_0112200	3300049824	Bacteria	2021
357	Ga0501045_0222508	3300049824	Bacteria	1405
358	Ga0501045_0324799	3300049824	Bacteria	1145
359	nmdc:mga03683_413705_c1	3300050489	Bacteria	645
360	nmdc:mga03n38_57717_c1	3300050490	Bacteria	1756
361	nmdc:mga03n38_664934_c1	3300050490	Bacteria	598
362	nmdc:mga03n38_833025_c1	3300050490	Bacteria	539
363	nmdc:mga0yw44_230617_c1	3300050492	Bacteria	1229
364	nmdc:mga0yw44_307062_c1	3300050492	Bacteria	1064
365	nmdc:mga0yw44_541371_c1	3300050492	Bacteria	790
366	nmdc:mga0k408_112060_c1	3300050493	Bacteria	1613
367	nmdc:mga06z11_236937_c1	3300050494	Bacteria	1071
368	nmdc:mga06z11_757139_c1	3300050494	Bacteria	592
369	nmdc:mga04h51_108188_c1	3300050495	Bacteria	1021
370	nmdc:mga04h51_267272_c1	3300050495	Bacteria	689
371	nmdc:mga04h51_367613_c1	3300050495	Bacteria	597
372	nmdc:mga07m45_267699_c1	3300050496	Unclassified	994
373	nmdc:mga0qj67_689577_c1	3300050509	Bacteria	813
374	nmdc:mga08y16_282061_c1	3300050511	Bacteria	1713
375	nmdc:mga0a205_495409_c1	3300050515	Bacteria	1079
376	Ga0500610_0007501	3300053079	Bacteria	4676
377	Ga0500643_120289	3300053087	Bacteria	707
378	Ga0500566_0248630	3300053094	Bacteria	866
379	Ga0500562_000090	3300053108	Bacteria	37346
380	Ga0500592_000331	3300053116	Bacteria	8029
381	Ga0500568_0006786	3300053139	Bacteria	5707
382	Ga0500577_0000034	3300053142	Bacteria	32365
383	Ga0500604_0020381	3300053151	Bacteria	1866
384	Ga0500616_0004089	3300053153	Bacteria	10595
385	Ga0500627_0000665	3300053158	Bacteria	9121
386	Ga0500627_0001815	3300053158	Bacteria	6084
387	Ga0500627_0035313	3300053158	Bacteria	2123
388	Ga0500645_002762	3300053730	Bacteria	7604
389	Ga0501084_0014532	3300054114	Bacteria	6527
390	Ga0501084_0280755	3300054114	Bacteria	1406
391	Ga0501084_0567900	3300054114	Bacteria	958
392	Ga0590071_004131	3300059421	Bacteria	3543
393	Ga0590077_010431	3300059426	Unclassified	1911
394	Ga0501082_0171946	3300060353	Bacteria	1884
395	Ga0501082_0387658	3300060353	Bacteria	1219
396	Ga0530510_0135029	3300061734	Unclassified	1816
397	Ga0530510_0501069	3300061734	Unclassified	920

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300030522	Ga0307512_10108065	Ga0307512_101080652	97
2	3300046515	Ga0495620_0059149	Ga0495620_0059149_867_1226	97
3	3300046524	Ga0495648_0323456	Ga0495648_0323456_253_612	97
4	3300046664	Ga0495659_0045932	Ga0495659_0045932_379_738	97
5	3300046692	Ga0495671_0001625	Ga0495671_0001625_13290_13649	97
6	3300053079	Ga0500610_0007501	Ga0500610_0007501_169_528	97
7	3300053158	Ga0500627_0000665	Ga0500627_0000665_6269_6628	97
8	3300005455	Ga0070663_102135906	Ga0070663_1021359061	98
9	3300005539	Ga0068853_102320774	Ga0068853_1023207741	98
10	3300014497	Ga0182008_10009294	Ga0182008_100092942	98
11	3300015261	Ga0182006_1071233	Ga0182006_10712332	98
12	3300026041	Ga0207639_10541385	Ga0207639_105413852	98
13	3300032002	Ga0307416_100100232	Ga0307416_1001002322	98
14	3300048928	Ga0496125_0263108	Ga0496125_0263108_186_602	98
15	3300046520	Ga0495637_0046801	Ga0495637_0046801_371_730	99
16	3300046660	Ga0495625_0061884	Ga0495625_0061884_1243_1602	99
17	3300046683	Ga0495658_0268489	Ga0495658_0268489_257_616	99
18	3300046691	Ga0495670_0303755	Ga0495670_0303755_149_508	99
19	3300048089	Ga0495614_0217564	Ga0495614_0217564_102_461	99
20	3300053087	Ga0500643_120289	Ga0500643_120289_281_640	99
21	3300009148	Ga0105243_10122528	Ga0105243_101225281	101
22	3300017792	Ga0163161_10001642	Ga0163161_1000164212	104
23	3300006048	Ga0075363_100084372	Ga0075363_1000843723	108
24	3300050490	nmdc:mga03n38_664934_c1	nmdc:mga03n38_664934_c1_23_355	110
25	iso_pu_bacteria	2582581308	2585279154	112
26	iso_pu_bacteria	2585427527	2585531361	112
27	iso_pu_bacteria	2585427530	2585552716	112
28	iso_pu_bacteria	2818991453	2819641466	112
29	iso_pu_bacteria	2941489479	2941490553	113
30	iso_pu_bacteria	2995948881	2995951492	113
31	iso_pu_bacteria	2599185214	2599626354	115
32	iso_pu_bacteria	2599185226	2599676322	115
33	iso_pu_bacteria	2599185227	2599682056	115
34	iso_pu_bacteria	2599185229	2599695706	115
35	iso_pu_bacteria	2643221683	2644466873	115
36	iso_pu_bacteria	2842677519	2842680321	115
37	iso_pu_bacteria	2885198086	2885203041	115
38	iso_pu_bacteria	2885211737	2885216562	115
39	iso_pu_bacteria	2904541872	2904545322	115
40	iso_pu_bacteria	2928070936	2928075324	115
41	iso_pu_bacteria	2928084124	2928088515	115
42	iso_pu_bacteria	2929160207	2929165511	115
43	iso_pu_bacteria	2929520902	2929522556	115
44	iso_pu_bacteria	2945909444	2945909816	115
45	iso_pu_bacteria	2945984333	2945988190	115
46	iso_pu_bacteria	2954767861	2954769049	115
47	3300003775	Ga0055524_1000017	Ga0055524_1000017213	116
48	3300005563	Ga0068855_100201023	Ga0068855_1002010234	116
49	3300005578	Ga0068854_100233032	Ga0068854_1002330323	116
50	3300005614	Ga0068856_100791907	Ga0068856_1007919071	116
51	3300005616	Ga0068852_100063751	Ga0068852_1000637515	116
52	3300009036	Ga0105244_10117030	Ga0105244_101170302	116
53	3300009093	Ga0105240_10000014	Ga0105240_10000014429	116
54	3300009545	Ga0105237_10012821	Ga0105237_100128216	116
55	3300010375	Ga0105239_10004698	Ga0105239_1000469813	116
56	3300013104	Ga0157370_10001013	Ga0157370_100010138	116
57	3300013105	Ga0157369_10177139	Ga0157369_101771393	116
58	3300014326	Ga0157380_10280691	Ga0157380_102806912	116
59	3300014497	Ga0182008_10126724	Ga0182008_101267243	116
60	3300015262	Ga0182007_10004389	Ga0182007_100043897	116
61	3300015265	Ga0182005_1002036	Ga0182005_10020365	116
62	3300025263	Ga0209565_1004493	Ga0209565_10044933	116
63	3300025295	Ga0209564_1015297	Ga0209564_10152972	116
64	3300025299	Ga0209256_1000018	Ga0209256_1000018265	116
65	3300025913	Ga0207695_10000037	Ga0207695_10000037431	116
66	3300025914	Ga0207671_10003788	Ga0207671_1000378810	116
67	3300025949	Ga0207667_10283719	Ga0207667_102837192	116
68	3300025981	Ga0207640_10372213	Ga0207640_103722133	116
69	3300026142	Ga0207698_10046387	Ga0207698_100463874	116
70	3300048903	Ga0496100_0003636	Ga0496100_0003636_3444_3797	116
71	3300048905	Ga0496102_0003723	Ga0496102_0003723_9517_9870	116
72	3300048906	Ga0496103_0007585	Ga0496103_0007585_2831_3184	116
73	3300048916	Ga0496113_0008924	Ga0496113_0008924_4129_4482	116
74	3300048919	Ga0496116_0008405	Ga0496116_0008405_2847_3200	116
75	3300048920	Ga0496117_0001336	Ga0496117_0001336_33199_33552	116
76	3300048921	Ga0496118_0004095	Ga0496118_0004095_2704_3057	116
77	3300048922	Ga0496119_0005806	Ga0496119_0005806_9192_9545	116
78	3300048923	Ga0496120_0002450	Ga0496120_0002450_2699_3052	116
79	3300048924	Ga0496121_0001813	Ga0496121_0001813_2807_3160	116
80	3300048925	Ga0496122_0006435	Ga0496122_0006435_8663_9016	116
81	3300048926	Ga0496123_0005654	Ga0496123_0005654_7388_7741	116
82	3300048927	Ga0496124_0005932	Ga0496124_0005932_10461_10814	116
83	3300048928	Ga0496125_0010744	Ga0496125_0010744_3062_3415	116
84	3300048929	Ga0496126_0174771	Ga0496126_0174771_643_996	116
85	3300003322	rootL2_10254917	rootL2_102549172	117
86	3300003771	Ga0055526_1000032	Ga0055526_100003269	117
87	3300003773	Ga0055537_1000309	Ga0055537_10003095	117
88	3300003773	Ga0055537_1033306	Ga0055537_10333062	117
89	3300003775	Ga0055524_1000054	Ga0055524_100005469	117
90	3300003784	Ga0055534_1000041	Ga0055534_100004145	117
91	3300003790	Ga0055528_1000021	Ga0055528_100002145	117
92	3300005456	Ga0070678_101367816	Ga0070678_1013678162	117
93	3300005539	Ga0068853_101454405	Ga0068853_1014544051	117
94	3300006042	Ga0075368_10121668	Ga0075368_101216682	117
95	3300006177	Ga0075362_10191583	Ga0075362_101915832	117
96	3300006178	Ga0075367_10225873	Ga0075367_102258733	117
97	3300006195	Ga0075366_10001868	Ga0075366_100018682	117
98	3300009147	Ga0114129_12299672	Ga0114129_122996721	117
99	3300015689	Ga0183360_10001	Ga0183360_100011714	117
100	3300025263	Ga0209565_1000001	Ga0209565_10000012099	117
101	3300025263	Ga0209565_1005028	Ga0209565_10050283	117
102	3300025273	Ga0209673_1000001	Ga0209673_10000012099	117
103	3300025291	Ga0209675_1000001	Ga0209675_1000001433	117
104	3300025295	Ga0209564_1000001	Ga0209564_1000001595	117
105	3300025299	Ga0209256_1000002	Ga0209256_1000002957	117
106	3300026041	Ga0207639_12033895	Ga0207639_120338951	117
107	3300026121	Ga0207683_11339600	Ga0207683_113396002	117
108	3300031249	Ga0265339_10210962	Ga0265339_102109621	117
109	3300031903	Ga0307407_10251048	Ga0307407_102510482	117
110	3300037466	Ga0395898_1124982	Ga0395898_1124982_126_479	117
111	3300046530	Ga0495654_0013119	Ga0495654_0013119_2553_2906	117
112	3300048924	Ga0496121_0008625	Ga0496121_0008625_5269_5622	117
113	3300049571	Ga0501034_0146698	Ga0501034_0146698_15_413	117
114	3300049573	Ga0501037_0970034	Ga0501037_0970034_78_434	117
115	3300049575	Ga0501039_0920328	Ga0501039_0920328_190_582	117
116	3300049576	Ga0501040_0294900	Ga0501040_0294900_33_431	117
117	3300049580	Ga0501046_0042667	Ga0501046_0042667_220_618	117
118	3300049581	Ga0501047_0066180	Ga0501047_0066180_2170_2568	117
119	3300049581	Ga0501047_0166687	Ga0501047_0166687_1520_1873	117
120	3300049583	Ga0501067_0482824	Ga0501067_0482824_211_609	117
121	3300049586	Ga0501070_1316340	Ga0501070_1316340_104_502	117
122	3300049589	Ga0501073_0296864	Ga0501073_0296864_570_968	117
123	3300049589	Ga0501073_0523993	Ga0501073_0523993_391_792	117
124	3300049823	Ga0501044_0257263	Ga0501044_0257263_355_753	117
125	3300049823	Ga0501044_0911753	Ga0501044_0911753_384_740	117
126	3300049823	Ga0501044_1314498	Ga0501044_1314498_97_489	117
127	3300050493	nmdc:mga0k408_112060_c1	nmdc:mga0k408_112060_c1_286_642	117
128	3300050495	nmdc:mga04h51_108188_c1	nmdc:mga04h51_108188_c1_626_982	117
129	3300053116	Ga0500592_000331	Ga0500592_000331_5190_5543	117
130	3300053139	Ga0500568_0006786	Ga0500568_0006786_1954_2310	117
131	3300053151	Ga0500604_0020381	Ga0500604_0020381_913_1266	117
132	3300053153	Ga0500616_0004089	Ga0500616_0004089_6455_6808	117
133	3300053158	Ga0500627_0001815	Ga0500627_0001815_5103_5456	117
134	3300053158	Ga0500627_0035313	Ga0500627_0035313_593_946	117
135	3300002741	JGI25157J39369_1005883	JGI25157J39369_10058831	118
136	3300002773	JGI25152J39213_1033236	JGI25152J39213_10332362	118
137	3300003203	JGI25406J46586_10033031	JGI25406J46586_100330312	118
138	3300003781	Ga0055536_1001974	Ga0055536_10019742	118
139	3300003781	Ga0055536_1002777	Ga0055536_10027779	118
140	3300003792	Ga0055540_1001996	Ga0055540_10019962	118
141	3300005289	Ga0065704_10328287	Ga0065704_103282872	118
142	3300005331	Ga0070670_100179674	Ga0070670_1001796742	118
143	3300005347	Ga0070668_100461088	Ga0070668_1004610882	118
144	3300005347	Ga0070668_101050364	Ga0070668_1010503641	118
145	3300005364	Ga0070673_100323386	Ga0070673_1003233863	118
146	3300005440	Ga0070705_101158918	Ga0070705_1011589181	118
147	3300005455	Ga0070663_100097141	Ga0070663_1000971412	118
148	3300005457	Ga0070662_100899986	Ga0070662_1008999862	118
149	3300005543	Ga0070672_101980095	Ga0070672_1019800951	118
150	3300005546	Ga0070696_100382787	Ga0070696_1003827872	118
151	3300005563	Ga0068855_100133822	Ga0068855_1001338222	118
152	3300005578	Ga0068854_100527089	Ga0068854_1005270892	118
153	3300005718	Ga0068866_10622148	Ga0068866_106221481	118
154	3300005719	Ga0068861_100367387	Ga0068861_1003673873	118
155	3300005844	Ga0068862_100432265	Ga0068862_1004322653	118
156	3300005983	Ga0081540_1034684	Ga0081540_10346843	118
157	3300005985	Ga0081539_10000244	Ga0081539_10000244127	118
158	3300006038	Ga0075365_10089393	Ga0075365_100893934	118
159	3300006038	Ga0075365_10668672	Ga0075365_106686721	118
160	3300006042	Ga0075368_10419269	Ga0075368_104192692	118
161	3300006048	Ga0075363_100308101	Ga0075363_1003081012	118
162	3300006051	Ga0075364_10579849	Ga0075364_105798492	118
163	3300006178	Ga0075367_10486481	Ga0075367_104864812	118
164	3300006178	Ga0075367_10782531	Ga0075367_107825312	118
165	3300006358	Ga0068871_101352261	Ga0068871_1013522612	118
166	3300006846	Ga0075430_100531922	Ga0075430_1005319222	118
167	3300006852	Ga0075433_10587184	Ga0075433_105871842	118
168	3300006948	Ga0099826_10000008	Ga0099826_10000008256	118
169	3300009093	Ga0105240_10033266	Ga0105240_100332665	118
170	3300009148	Ga0105243_10000651	Ga0105243_1000065113	118
171	3300009176	Ga0105242_11086890	Ga0105242_110868901	118
172	3300009545	Ga0105237_10000371	Ga0105237_1000037111	118
173	3300009545	Ga0105237_10846302	Ga0105237_108463022	118
174	3300009553	Ga0105249_11528083	Ga0105249_115280831	118
175	3300009978	Ga0105148_106873	Ga0105148_1068732	118
176	3300011119	Ga0105246_12128327	Ga0105246_121283272	118
177	3300012505	Ga0157339_1012814	Ga0157339_10128142	118
178	3300013104	Ga0157370_10662134	Ga0157370_106621341	118
179	3300013306	Ga0163162_10253820	Ga0163162_102538202	118
180	3300013307	Ga0157372_10564827	Ga0157372_105648272	118
181	3300014326	Ga0157380_12733906	Ga0157380_127339061	118
182	3300020069	Ga0197907_11069277	Ga0197907_110692772	118
183	3300020070	Ga0206356_11361170	Ga0206356_113611701	118
184	3300020082	Ga0206353_10055967	Ga0206353_100559673	118
185	3300025250	Ga0209026_1000207	Ga0209026_100020766	118
186	3300025256	Ga0209759_1003949	Ga0209759_10039494	118
187	3300025256	Ga0209759_1014266	Ga0209759_10142663	118
188	3300025292	Ga0209676_1000304	Ga0209676_100030487	118
189	3300025298	Ga0209050_1030999	Ga0209050_10309992	118
190	3300025299	Ga0209256_1045421	Ga0209256_10454211	118
191	3300025303	Ga0209051_1000117	Ga0209051_100011759	118
192	3300025304	Ga0209257_1020775	Ga0209257_10207752	118
193	3300025904	Ga0207647_10044996	Ga0207647_100449964	118
194	3300025913	Ga0207695_10045297	Ga0207695_100452975	118
195	3300025914	Ga0207671_10000490	Ga0207671_1000049031	118
196	3300025917	Ga0207660_10550455	Ga0207660_105504551	118
197	3300025925	Ga0207650_10265428	Ga0207650_102654282	118
198	3300025935	Ga0207709_10000313	Ga0207709_1000031328	118
199	3300025939	Ga0207665_10010245	Ga0207665_100102453	118
200	3300025949	Ga0207667_10335121	Ga0207667_103351212	118
201	3300025972	Ga0207668_10351800	Ga0207668_103518001	118
202	3300025981	Ga0207640_10067352	Ga0207640_100673523	118
203	3300025986	Ga0207658_11854453	Ga0207658_118544531	118
204	3300026067	Ga0207678_10006781	Ga0207678_100067819	118
205	3300026118	Ga0207675_101246370	Ga0207675_1012463702	118
206	3300027666	Ga0209282_1000005	Ga0209282_1000005255	118
207	3300027866	Ga0209813_10265728	Ga0209813_102657282	118
208	3300028380	Ga0268265_10427584	Ga0268265_104275843	118
209	3300028381	Ga0268264_10493966	Ga0268264_104939662	118
210	3300028794	Ga0307515_10431493	Ga0307515_104314932	118
211	3300031456	Ga0307513_10161499	Ga0307513_101614993	118
212	3300031731	Ga0307405_10213556	Ga0307405_102135562	118
213	3300031903	Ga0307407_10958381	Ga0307407_109583812	118
214	3300031995	Ga0307409_101851565	Ga0307409_1018515652	118
215	3300032002	Ga0307416_100127144	Ga0307416_1001271443	118
216	3300041460	Ga0451802_1844462	Ga0451802_1844462_240_602	118
217	3300041491	Ga0451833_0862804	Ga0451833_0862804_141_500	118
218	3300041505	Ga0451849_0110161	Ga0451849_0110161_117_539	118
219	3300046681	Ga0495647_0013438	Ga0495647_0013438_571_930	118
220	3300048910	Ga0496107_0027317	Ga0496107_0027317_395_757	118
221	3300048924	Ga0496121_0000523	Ga0496121_0000523_67378_67740	118
222	3300048926	Ga0496123_0174602	Ga0496123_0174602_729_1088	118
223	3300049570	Ga0501033_0995038	Ga0501033_0995038_22_378	118
224	3300049571	Ga0501034_0000581	Ga0501034_0000581_45027_45386	118
225	3300049578	Ga0501042_0014091	Ga0501042_0014091_2324_2695	118
226	3300049588	Ga0501072_0011605	Ga0501072_0011605_2514_2873	118
227	3300049590	Ga0501074_0167585	Ga0501074_0167585_242_736	118
228	3300049590	Ga0501074_0948566	Ga0501074_0948566_151_510	118
229	3300049671	Ga0501238_011975	Ga0501238_011975_289_648	118
230	3300050492	nmdc:mga0yw44_230617_c1	nmdc:mga0yw44_230617_c1_780_1136	118
231	3300050492	nmdc:mga0yw44_541371_c1	nmdc:mga0yw44_541371_c1_143_499	118
232	3300050494	nmdc:mga06z11_236937_c1	nmdc:mga06z11_236937_c1_285_641	118
233	3300050494	nmdc:mga06z11_757139_c1	nmdc:mga06z11_757139_c1_67_423	118
234	3300050495	nmdc:mga04h51_267272_c1	nmdc:mga04h51_267272_c1_253_609	118
235	3300050496	nmdc:mga07m45_267699_c1	nmdc:mga07m45_267699_c1_347_703	118
236	3300050509	nmdc:mga0qj67_689577_c1	nmdc:mga0qj67_689577_c1_130_498	118
237	3300050515	nmdc:mga0a205_495409_c1	nmdc:mga0a205_495409_c1_459_854	118
238	3300053094	Ga0500566_0248630	Ga0500566_0248630_373_735	118
239	3300053108	Ga0500562_000090	Ga0500562_000090_28708_29064	118
240	3300053142	Ga0500577_0000034	Ga0500577_0000034_9832_10188	118
241	3300053730	Ga0500645_002762	Ga0500645_002762_4759_5115	118
242	3300054114	Ga0501084_0280755	Ga0501084_0280755_278_682	118
243	3300059421	Ga0590071_004131	Ga0590071_004131_620_979	118
244	3300059426	Ga0590077_010431	Ga0590077_010431_700_1059	118
245	3300060353	Ga0501082_0171946	Ga0501082_0171946_934_1338	118
246	3300002075	JGI24738J21930_10066922	JGI24738J21930_100669223	119
247	3300005327	Ga0070658_10070095	Ga0070658_100700952	119
248	3300005329	Ga0070683_100332812	Ga0070683_1003328121	119
249	3300005334	Ga0068869_100986924	Ga0068869_1009869241	119
250	3300005337	Ga0070682_100087080	Ga0070682_1000870805	119
251	3300005337	Ga0070682_101596495	Ga0070682_1015964951	119
252	3300005338	Ga0068868_100080147	Ga0068868_1000801472	119
253	3300005339	Ga0070660_100033154	Ga0070660_1000331542	119
254	3300005340	Ga0070689_100743811	Ga0070689_1007438113	119
255	3300005343	Ga0070687_100996205	Ga0070687_1009962051	119
256	3300005344	Ga0070661_101446754	Ga0070661_1014467541	119
257	3300005345	Ga0070692_10015706	Ga0070692_100157062	119
258	3300005347	Ga0070668_100688423	Ga0070668_1006884231	119
259	3300005354	Ga0070675_100077906	Ga0070675_1000779065	119
260	3300005356	Ga0070674_101234745	Ga0070674_1012347451	119
261	3300005364	Ga0070673_100090186	Ga0070673_1000901862	119
262	3300005365	Ga0070688_101683065	Ga0070688_1016830651	119
263	3300005366	Ga0070659_100025324	Ga0070659_1000253243	119
264	3300005438	Ga0070701_11373727	Ga0070701_113737271	119
265	3300005440	Ga0070705_101269865	Ga0070705_1012698651	119
266	3300005441	Ga0070700_100018197	Ga0070700_1000181977	119
267	3300005444	Ga0070694_100764479	Ga0070694_1007644792	119
268	3300005455	Ga0070663_100046612	Ga0070663_1000466122	119
269	3300005457	Ga0070662_100139273	Ga0070662_1001392732	119
270	3300005459	Ga0068867_100493218	Ga0068867_1004932183	119
271	3300005466	Ga0070685_10074177	Ga0070685_100741775	119
272	3300005535	Ga0070684_100244858	Ga0070684_1002448581	119
273	3300005539	Ga0068853_100069924	Ga0068853_1000699242	119
274	3300005543	Ga0070672_100011892	Ga0070672_1000118925	119
275	3300005546	Ga0070696_101056407	Ga0070696_1010564072	119
276	3300005548	Ga0070665_100266976	Ga0070665_1002669764	119
277	3300005563	Ga0068855_102401802	Ga0068855_1024018021	119
278	3300005564	Ga0070664_100033932	Ga0070664_1000339324	119
279	3300005577	Ga0068857_100578791	Ga0068857_1005787911	119
280	3300005616	Ga0068852_100081000	Ga0068852_1000810002	119
281	3300005618	Ga0068864_101056808	Ga0068864_1010568081	119
282	3300005718	Ga0068866_10052308	Ga0068866_100523081	119
283	3300005719	Ga0068861_100214252	Ga0068861_1002142522	119
284	3300005842	Ga0068858_100073299	Ga0068858_1000732991	119
285	3300005843	Ga0068860_100135702	Ga0068860_1001357022	119
286	3300005937	Ga0081455_10047409	Ga0081455_100474094	119
287	3300005981	Ga0081538_10006659	Ga0081538_100066598	119
288	3300006038	Ga0075365_10035915	Ga0075365_100359152	119
289	3300006048	Ga0075363_100542034	Ga0075363_1005420341	119
290	3300006051	Ga0075364_10029953	Ga0075364_100299531	119
291	3300006881	Ga0068865_100104108	Ga0068865_1001041085	119
292	3300009036	Ga0105244_10427575	Ga0105244_104275751	119
293	3300009094	Ga0111539_10054250	Ga0111539_100542509	119
294	3300009098	Ga0105245_10140444	Ga0105245_101404444	119
295	3300009148	Ga0105243_10005188	Ga0105243_100051885	119
296	3300009176	Ga0105242_11576350	Ga0105242_115763501	119
297	3300009545	Ga0105237_10946163	Ga0105237_109461631	119
298	3300009553	Ga0105249_10267892	Ga0105249_102678922	119
299	3300010375	Ga0105239_10052325	Ga0105239_100523255	119
300	3300011119	Ga0105246_10077399	Ga0105246_100773992	119
301	3300011119	Ga0105246_10107948	Ga0105246_101079482	119
302	3300013102	Ga0157371_10597403	Ga0157371_105974031	119
303	3300013296	Ga0157374_10769363	Ga0157374_107693632	119
304	3300013306	Ga0163162_10170621	Ga0163162_101706212	119
305	3300013308	Ga0157375_10107402	Ga0157375_101074024	119
306	3300014325	Ga0163163_10243153	Ga0163163_102431533	119
307	3300014326	Ga0157380_10206461	Ga0157380_102064612	119
308	3300014745	Ga0157377_10168930	Ga0157377_101689301	119
309	3300025321	Ga0207656_10154791	Ga0207656_101547912	119
310	3300025901	Ga0207688_10000869	Ga0207688_100008693	119
311	3300025903	Ga0207680_10861131	Ga0207680_108611312	119
312	3300025909	Ga0207705_10214285	Ga0207705_102142854	119
313	3300025918	Ga0207662_10940571	Ga0207662_109405711	119
314	3300025919	Ga0207657_10111611	Ga0207657_101116115	119
315	3300025920	Ga0207649_10375028	Ga0207649_103750281	119
316	3300025923	Ga0207681_11149253	Ga0207681_111492531	119
317	3300025926	Ga0207659_10037750	Ga0207659_100377501	119
318	3300025927	Ga0207687_10252050	Ga0207687_102520503	119
319	3300025933	Ga0207706_10095259	Ga0207706_100952595	119
320	3300025935	Ga0207709_10096728	Ga0207709_100967285	119
321	3300025936	Ga0207670_10214104	Ga0207670_102141041	119
322	3300025938	Ga0207704_10012913	Ga0207704_100129132	119
323	3300025940	Ga0207691_10005127	Ga0207691_100051277	119
324	3300025942	Ga0207689_10700284	Ga0207689_107002843	119
325	3300025944	Ga0207661_10141697	Ga0207661_101416971	119
326	3300025944	Ga0207661_10654703	Ga0207661_106547031	119
327	3300025945	Ga0207679_10950085	Ga0207679_109500852	119
328	3300025945	Ga0207679_11652595	Ga0207679_116525951	119
329	3300025949	Ga0207667_11760470	Ga0207667_117604701	119
330	3300025960	Ga0207651_10514612	Ga0207651_105146123	119
331	3300025961	Ga0207712_10369009	Ga0207712_103690094	119
332	3300025972	Ga0207668_10399920	Ga0207668_103999203	119
333	3300025986	Ga0207658_10592099	Ga0207658_105920991	119
334	3300026035	Ga0207703_10125831	Ga0207703_101258311	119
335	3300026041	Ga0207639_10192849	Ga0207639_101928492	119
336	3300026067	Ga0207678_10004621	Ga0207678_100046218	119
337	3300026075	Ga0207708_10010233	Ga0207708_100102338	119
338	3300026078	Ga0207702_10759675	Ga0207702_107596753	119
339	3300026089	Ga0207648_10042365	Ga0207648_100423654	119
340	3300026095	Ga0207676_10991925	Ga0207676_109919251	119
341	3300026116	Ga0207674_10053507	Ga0207674_100535071	119
342	3300026116	Ga0207674_10725294	Ga0207674_107252942	119
343	3300026118	Ga0207675_100166620	Ga0207675_1001666204	119
344	3300026142	Ga0207698_10705572	Ga0207698_107055723	119
345	3300027866	Ga0209813_10394659	Ga0209813_103946591	119
346	3300028380	Ga0268265_11889646	Ga0268265_118896461	119
347	3300028381	Ga0268264_10970758	Ga0268264_109707581	119
348	3300031548	Ga0307408_100239481	Ga0307408_1002394813	119
349	3300031548	Ga0307408_100536686	Ga0307408_1005366862	119
350	3300031548	Ga0307408_101234150	Ga0307408_1012341501	119
351	3300031901	Ga0307406_10080233	Ga0307406_100802332	119
352	3300031901	Ga0307406_10129442	Ga0307406_101294422	119
353	3300031903	Ga0307407_10543537	Ga0307407_105435371	119
354	3300041404	Ga0439436_0150410	Ga0439436_0150410_163_528	119
355	3300041413	Ga0439465_0017039	Ga0439465_0017039_1021_1386	119
356	3300042007	Ga0439449_0074404	Ga0439449_0074404_314_679	119
357	3300042010	Ga0439452_051727	Ga0439452_051727_379_744	119
358	3300042876	Ga0451577_0078439	Ga0451577_0078439_438_797	119
359	3300042876	Ga0451577_0143239	Ga0451577_0143239_1474_1839	119
360	3300046683	Ga0495658_0072840	Ga0495658_0072840_417_776	119
361	3300047321	Ga0495676_0346576	Ga0495676_0346576_34_393	119
362	3300048903	Ga0496100_1410866	Ga0496100_1410866_51_410	119
363	3300048909	Ga0496106_0111162	Ga0496106_0111162_1657_2016	119
364	3300048910	Ga0496107_0195505	Ga0496107_0195505_96_455	119
365	3300048911	Ga0496108_0717296	Ga0496108_0717296_50_409	119
366	3300048912	Ga0496109_0067687	Ga0496109_0067687_702_1061	119
367	3300048913	Ga0496110_1366763	Ga0496110_1366763_236_595	119
368	3300048916	Ga0496113_0117159	Ga0496113_0117159_159_518	119
369	3300049568	Ga0501031_0045396	Ga0501031_0045396_2050_2469	119
370	3300049570	Ga0501033_1018104	Ga0501033_1018104_76_495	119
371	3300049572	Ga0501036_0164888	Ga0501036_0164888_326_685	119
372	3300049572	Ga0501036_0239409	Ga0501036_0239409_1150_1509	119
373	3300049575	Ga0501039_0103381	Ga0501039_0103381_1791_2150	119
374	3300049576	Ga0501040_0353641	Ga0501040_0353641_25_384	119
375	3300049576	Ga0501040_0361073	Ga0501040_0361073_247_606	119
376	3300049577	Ga0501041_0253046	Ga0501041_0253046_268_627	119
377	3300049579	Ga0501043_1095675	Ga0501043_1095675_135_494	119
378	3300049580	Ga0501046_0397215	Ga0501046_0397215_79_438	119
379	3300049582	Ga0501048_0170203	Ga0501048_0170203_288_647	119
380	3300049582	Ga0501048_0359340	Ga0501048_0359340_207_566	119
381	3300049586	Ga0501070_0501820	Ga0501070_0501820_485_904	119
382	3300049588	Ga0501072_0008430	Ga0501072_0008430_6356_6775	119
383	3300049588	Ga0501072_0279435	Ga0501072_0279435_723_1082	119
384	3300049588	Ga0501072_0552023	Ga0501072_0552023_255_614	119
385	3300049588	Ga0501072_0841705	Ga0501072_0841705_306_665	119
386	3300049589	Ga0501073_1084025	Ga0501073_1084025_73_432	119
387	3300049590	Ga0501074_0389815	Ga0501074_0389815_30_389	119
388	3300049591	Ga0501075_0093522	Ga0501075_0093522_1581_2000	119
389	3300049591	Ga0501075_0550689	Ga0501075_0550689_150_509	119
390	3300049592	Ga0501076_0004698	Ga0501076_0004698_2918_3277	119
391	3300049592	Ga0501076_0016144	Ga0501076_0016144_56_475	119
392	3300049592	Ga0501076_0346681	Ga0501076_0346681_93_452	119
393	3300049592	Ga0501076_0407098	Ga0501076_0407098_38_397	119
394	3300049741	Ga0501079_0205960	Ga0501079_0205960_1095_1454	119
395	3300049741	Ga0501079_0526786	Ga0501079_0526786_194_553	119
396	3300049741	Ga0501079_1021078	Ga0501079_1021078_121_480	119
397	3300049741	Ga0501079_1094978	Ga0501079_1094978_17_379	119
398	3300049742	Ga0501080_0793341	Ga0501080_0793341_285_644	119
399	3300049743	Ga0501081_0026957	Ga0501081_0026957_540_959	119
400	3300049743	Ga0501081_0028884	Ga0501081_0028884_2504_2863	119
401	3300049743	Ga0501081_0100665	Ga0501081_0100665_462_821	119
402	3300049743	Ga0501081_1339582	Ga0501081_1339582_150_509	119
403	3300049744	Ga0501083_1024678	Ga0501083_1024678_123_482	119
404	3300049744	Ga0501083_1089728	Ga0501083_1089728_39_398	119
405	3300049824	Ga0501045_0063412	Ga0501045_0063412_1590_1949	119
406	3300049824	Ga0501045_0112200	Ga0501045_0112200_1337_1756	119
407	3300049824	Ga0501045_0222508	Ga0501045_0222508_792_1151	119
408	3300049824	Ga0501045_0324799	Ga0501045_0324799_574_933	119
409	3300050489	nmdc:mga03683_413705_c1	nmdc:mga03683_413705_c1_269_628	119
410	3300050490	nmdc:mga03n38_57717_c1	nmdc:mga03n38_57717_c1_256_615	119
411	3300050490	nmdc:mga03n38_833025_c1	nmdc:mga03n38_833025_c1_17_376	119
412	3300050492	nmdc:mga0yw44_307062_c1	nmdc:mga0yw44_307062_c1_529_888	119
413	3300050495	nmdc:mga04h51_367613_c1	nmdc:mga04h51_367613_c1_171_530	119
414	3300050511	nmdc:mga08y16_282061_c1	nmdc:mga08y16_282061_c1_424_783	119
415	3300054114	Ga0501084_0014532	Ga0501084_0014532_802_1221	119
416	3300054114	Ga0501084_0567900	Ga0501084_0567900_474_833	119
417	3300060353	Ga0501082_0387658	Ga0501082_0387658_844_1203	119
418	3300061734	Ga0530510_0135029	Ga0530510_0135029_392_751	119
419	3300061734	Ga0530510_0501069	Ga0530510_0501069_321_740	119

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07237

DUF1428

Protein of unknown function (DUF1428)

25

127

0.98 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
2okq-assembly1.cif.gz_B	crystal structure of unknown conserved ybaa protein from shigella flexneri	0.9311	2	119
2okq-assembly1.cif.gz_A	crystal structure of unknown conserved ybaa protein from shigella flexneri	0.9258	2	117
2okq-assembly1.cif.gz_A	crystal structure of unknown conserved ybaa protein from shigella flexneri	0.8888	2	117
2okq-assembly1.cif.gz_B	crystal structure of unknown conserved ybaa protein from shigella flexneri	0.8562	2	119
2pgc-assembly1.cif.gz_C	crystal structure of a a marine metagenome protein (jcvi_pep_1096685590403) from uncultured marine organism at 2.53 a resolution	0.7526	3	117

ID	Description	Score	Start	End	Superfamily
af_P0AAQ6_1_117_3.30.70.100	Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;	0.9275	3	119	3.30.70.100
af_P0AAQ6_1_117_3.30.70.100	Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;	0.9125	3	119	3.30.70.100
3hx9B00	Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;	0.7269	4	119	3.30.70.100
af_Q55CR9_1_97_3.30.70.100	Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;	0.7267	2	116	3.30.70.100
3fgvB00	Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;	0.7265	4	115	3.30.70.100

ID	Description	Score	Start	End
AF-A0A2V9R7F6-F1-model_v4	DUF1428 domain-containing protein	0.9663	3	119
AF-A0A7T2YUM7-F1-model_v4	DUF1428 domain-containing protein	0.9643	3	119
AF-A0A2T3X314-F1-model_v4	deleted	0.9602	3	119
AF-D4XFR6-F1-model_v4	RNA signal recognition particle 4.5S RNA	0.9564	2	119
AF-A0A090FP03-F1-model_v4	DUF1428 family protein	0.9557	3	119

Feature Viewer

pLDDT	pTM	Quality
92.17	0.84	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F439521

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF07237

DUF1428

Protein of unknown function (DUF1428)

25

127

0.98

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map