F439494

General Info

Members Datasets Scaffolds Average Seq Length
419 221 419 345

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10040923|Ga0081455_100409233
Length 377
Sequence MLIVMKPSATASEIDAVVNVVEAVGFRAHPMPGATRTAIGITGNEGPIDGRRFENLPGVAEVIRVTKPYKLITLDLRPDKTVVRASDATIGGPELAIIAGPCAIESREQAFAIAKTVQQSGARFFRGCVWKPRTSPYTFQGLGDKGWEMMSAVREEFGLKIVTEAVEESHVDLIEKLGDMIQIGARNMQNFSLLKRAGRSRLPVLLKRGMAATLEEWLLAAEYIMAEGNYNVILCERGVRTFAQHTRNTLDLASVPAIRRISHLPVIVDPSHGTGTAYMVTPLARAGVAAGADGLMIEVHNQPELSLSDSAQALTPSQYLQLVAEVRAIHELVSCSHGPAGRPSIINEQSDRPQAGGYNCDEMDLTSGSAKHAAADR

Samples

Sample ID Description Type Environment
1 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
90 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
91 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
93 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
138 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
142 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
143 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
144 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
145 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
146 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
147 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
148 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
149 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
150 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
151 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
152 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
153 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
154 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
155 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
156 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
157 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
158 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
159 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
160 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
161 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
162 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
163 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
164 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
165 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
166 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
167 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
168 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
169 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
170 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
171 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
172 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
173 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
174 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
175 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
176 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
177 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
178 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
179 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
180 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
181 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
182 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
183 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
184 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
185 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
186 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
187 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
188 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
189 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
190 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
191 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
192 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
193 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
194 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
195 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
196 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
197 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
198 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
199 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
200 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
201 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
202 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
203 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
204 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
205 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
206 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
207 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
208 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
209 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
210 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
211 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
212 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
213 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
214 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
215 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
216 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
217 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
218 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
219 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
220 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
221 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.52
Metatranscriptomes 0.48
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.58
Rhizosphere 95.23
Stem 0
Stem Tuber 0
Unclassified 1.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25405J52794_10003102 3300003911 Bacteria 2892
2 JGI25405J52794_10003410 3300003911 Bacteria 2785
3 JGI25405J52794_10007156 3300003911 Bacteria 2053
4 Ga0065704_10106064 3300005289 Bacteria 2089
5 Ga0065704_10131577 3300005289 Bacteria 1622
6 Ga0065712_10080998 3300005290 Bacteria 3050
7 Ga0065712_10085064 3300005290 Bacteria 2698
8 Ga0065712_10087869 3300005290 Bacteria 2535
9 Ga0065712_10088979 3300005290 Bacteria 2487
10 Ga0065712_10100898 3300005290 Bacteria 2049
11 Ga0065715_10001742 3300005293 Bacteria 5667
12 Ga0065715_10089294 3300005293 Bacteria 11457
13 Ga0070683_100000040 3300005329 Bacteria 117545
14 Ga0070683_100027635 3300005329 Bacteria 5119
15 Ga0070683_100076559 3300005329 Bacteria 3127
16 Ga0070683_100195795 3300005329 Bacteria 1919
17 Ga0070690_100139671 3300005330 Unclassified 1643
18 Ga0070670_100001093 3300005331 Bacteria 21540
19 Ga0070677_10037467 3300005333 Bacteria 1892
20 Ga0068869_100019293 3300005334 Bacteria 4656
21 Ga0068869_100027841 3300005334 Bacteria 3944
22 Ga0068869_100171726 3300005334 Bacteria 1694
23 Ga0070666_10007060 3300005335 Bacteria 6923
24 Ga0070666_10009405 3300005335 Bacteria 6090
25 Ga0070680_100030939 3300005336 Bacteria 4300
26 Ga0070682_100000014 3300005337 Bacteria 249552
27 Ga0070682_100342504 3300005337 Unclassified 1112
28 Ga0068868_100000018 3300005338 Bacteria 94882
29 Ga0068868_100004739 3300005338 Bacteria 9551
30 Ga0068868_100033859 3300005338 Bacteria 3941
31 Ga0070689_100025206 3300005340 Bacteria 4467
32 Ga0070689_100189931 3300005340 Unclassified 1672
33 Ga0070689_100191481 3300005340 Bacteria 1665
34 Ga0070661_100056777 3300005344 Bacteria 2869
35 Ga0070668_100106987 3300005347 Unclassified 2223
36 Ga0070669_100143214 3300005353 Bacteria 1845
37 Ga0070671_100000518 3300005355 Bacteria 27083
38 Ga0070671_100126158 3300005355 Bacteria 2154
39 Ga0070671_100199689 3300005355 Unclassified 1696
40 Ga0070688_100061527 3300005365 Unclassified 2374
41 Ga0070688_100121443 3300005365 Bacteria 1751
42 Ga0070667_100176206 3300005367 Bacteria 1890
43 Ga0070667_100183783 3300005367 Unclassified 1850
44 Ga0070709_10046377 3300005434 Unclassified 2702
45 Ga0070714_100117581 3300005435 Bacteria 2361
46 Ga0070714_100377889 3300005435 Bacteria 1335
47 Ga0070713_100009752 3300005436 Bacteria 6901
48 Ga0070713_100058284 3300005436 Bacteria 3220
49 Ga0070713_100134236 3300005436 Bacteria 2185
50 Ga0070705_100050199 3300005440 Bacteria 2425
51 Ga0070708_100025662 3300005445 Bacteria 5040
52 Ga0070708_100053928 3300005445 Bacteria 3569
53 Ga0070708_100220936 3300005445 Bacteria 1777
54 Ga0070708_100410519 3300005445 Bacteria 1277
55 Ga0070663_100062955 3300005455 Bacteria 2676
56 Ga0070678_100018153 3300005456 Bacteria 4554
57 Ga0070662_100106672 3300005457 Unclassified 2128
58 Ga0068867_100043724 3300005459 Unclassified 3280
59 Ga0070685_10011423 3300005466 Bacteria 4648
60 Ga0070685_10027410 3300005466 Bacteria 3148
61 Ga0070706_100067476 3300005467 Bacteria 3309
62 Ga0070706_100084864 3300005467 Bacteria 2934
63 Ga0070706_100164865 3300005467 Bacteria 2069
64 Ga0070706_100222386 3300005467 Bacteria 1762
65 Ga0070706_100232348 3300005467 Bacteria 1721
66 Ga0070706_100298436 3300005467 Bacteria 1503
67 Ga0070707_100000044 3300005468 Bacteria 108715
68 Ga0070707_100006052 3300005468 Bacteria 11295
69 Ga0070707_100007459 3300005468 Bacteria 10156
70 Ga0070707_100010968 3300005468 Bacteria 8441
71 Ga0070707_100025781 3300005468 Bacteria 5580
72 Ga0070707_100034011 3300005468 Bacteria 4862
73 Ga0070707_100040797 3300005468 Bacteria 4441
74 Ga0070707_100099186 3300005468 Bacteria 2822
75 Ga0070707_100123605 3300005468 Bacteria 2513
76 Ga0070707_100177479 3300005468 Bacteria 2076
77 Ga0070707_100379868 3300005468 Bacteria 1372
78 Ga0070698_100000832 3300005471 Bacteria 33743
79 Ga0070698_100003689 3300005471 Bacteria 16813
80 Ga0070698_100020868 3300005471 Bacteria 6865
81 Ga0070698_100054554 3300005471 Bacteria 4057
82 Ga0070698_100231221 3300005471 Bacteria 1782
83 Ga0070699_100000427 3300005518 Bacteria 40529
84 Ga0070699_100061631 3300005518 Bacteria 3250
85 Ga0070699_100287687 3300005518 Bacteria 1473
86 Ga0070679_100062659 3300005530 Bacteria 3708
87 Ga0070679_100112520 3300005530 Bacteria 2708
88 Ga0070684_100003182 3300005535 Bacteria 12277
89 Ga0070684_100005720 3300005535 Bacteria 9550
90 Ga0070684_100034801 3300005535 Bacteria 4308
91 Ga0070684_100277497 3300005535 Bacteria 1535
92 Ga0070697_100000011 3300005536 Bacteria 163240
93 Ga0070697_100007971 3300005536 Bacteria 8257
94 Ga0070697_100138910 3300005536 Bacteria 2042
95 Ga0070697_100160821 3300005536 Bacteria 1897
96 Ga0070697_100220670 3300005536 Bacteria 1616
97 Ga0070697_100267188 3300005536 Bacteria 1466
98 Ga0070697_100356449 3300005536 Bacteria 1264
99 Ga0068853_100002024 3300005539 Bacteria 14993
100 Ga0068853_100172901 3300005539 Bacteria 1955
101 Ga0070672_100007328 3300005543 Bacteria 7480
102 Ga0070672_100101132 3300005543 Unclassified 2339
103 Ga0070686_100155954 3300005544 Bacteria 1603
104 Ga0070665_100002223 3300005548 Bacteria 21641
105 Ga0070665_100068090 3300005548 Bacteria 3569
106 Ga0070704_100010864 3300005549 Bacteria 5554
107 Ga0068855_100237105 3300005563 Bacteria 2040
108 Ga0070664_100095106 3300005564 Bacteria 2584
109 Ga0068854_100006027 3300005578 Bacteria 7680
110 Ga0068854_100017776 3300005578 Bacteria 4764
111 Ga0068856_100073568 3300005614 Bacteria 3383
112 Ga0070702_100240729 3300005615 Bacteria 1221
113 Ga0068852_100214038 3300005616 Bacteria 1829
114 Ga0068859_100033159 3300005617 Bacteria 5187
115 Ga0068859_100062197 3300005617 Bacteria 3763
116 Ga0068864_100000589 3300005618 Bacteria 30925
117 Ga0068864_100004135 3300005618 Bacteria 11904
118 Ga0068863_100033483 3300005841 Bacteria 4895
119 Ga0068863_100121687 3300005841 Bacteria 2489
120 Ga0068863_100178797 3300005841 Bacteria 2037
121 Ga0068863_100184262 3300005841 Unclassified 2005
122 Ga0068858_100000243 3300005842 Bacteria 58808
123 Ga0068858_100207383 3300005842 Bacteria 1854
124 Ga0068858_100342248 3300005842 Bacteria 1431
125 Ga0068860_100099504 3300005843 Unclassified 2773
126 Ga0068860_100137193 3300005843 Bacteria 2349
127 Ga0068862_100067728 3300005844 Bacteria 3079
128 Ga0081455_10000382 3300005937 Bacteria 58627
129 Ga0081455_10002396 3300005937 Bacteria 22378
130 Ga0081455_10004372 3300005937 Bacteria 15913
131 Ga0081455_10040923 3300005937 Bacteria 4083
132 Ga0081455_10056273 3300005937 Bacteria 3341
133 Ga0081455_10162927 3300005937 Bacteria 1707
134 Ga0081540_1000018 3300005983 Bacteria 164931
135 Ga0081540_1025518 3300005983 Bacteria 3397
136 Ga0081539_10017643 3300005985 Bacteria 4999
137 Ga0070717_10000278 3300006028 Bacteria 35073
138 Ga0070717_10002165 3300006028 Bacteria 13779
139 Ga0070717_10020031 3300006028 Bacteria 5255
140 Ga0070717_10097939 3300006028 Bacteria 2485
141 Ga0070712_100021909 3300006175 Bacteria 4201
142 Ga0070712_100063565 3300006175 Bacteria 2614
143 Ga0097621_100002089 3300006237 Bacteria 13681
144 Ga0097621_100142084 3300006237 Bacteria 2052
145 Ga0068871_100019157 3300006358 Bacteria 5222
146 Ga0075431_100015431 3300006847 Bacteria 7739
147 Ga0075434_100037167 3300006871 Bacteria 4820
148 Ga0075434_100280583 3300006871 Bacteria 1685
149 Ga0075434_100392607 3300006871 Bacteria 1408
150 Ga0097620_100033162 3300006931 Bacteria 5187
151 Ga0097620_100062197 3300006931 Bacteria 3763
152 Ga0075435_100009353 3300007076 Bacteria 7089
153 Ga0075435_100052238 3300007076 Bacteria 3294
154 Ga0105240_10150827 3300009093 Unclassified 2769
155 Ga0105240_10556916 3300009093 Bacteria 1268
156 Ga0111539_10000837 3300009094 Bacteria 40029
157 Ga0105245_10000024 3300009098 Bacteria 178565
158 Ga0105245_10000893 3300009098 Bacteria 27163
159 Ga0105245_10186069 3300009098 Bacteria 1987
160 Ga0105245_10269543 3300009098 Bacteria 1660
161 Ga0114129_10015499 3300009147 Bacteria 10839
162 Ga0114129_10084328 3300009147 Bacteria 4412
163 Ga0114129_10126608 3300009147 Bacteria 3512
164 Ga0114129_10254449 3300009147 Bacteria 2356
165 Ga0114129_10339681 3300009147 Bacteria 1992
166 Ga0105243_10488792 3300009148 Bacteria 1163
167 Ga0105241_10178712 3300009174 Bacteria 1758
168 Ga0105242_10004508 3300009176 Bacteria 10819
169 Ga0105242_10099220 3300009176 Unclassified 2465
170 Ga0105248_10106298 3300009177 Bacteria 3164
171 Ga0105238_10000001 3300009551 Bacteria 2036163
172 Ga0105249_10024683 3300009553 Bacteria 5404
173 Ga0105239_10228339 3300010375 Bacteria 2088
174 Ga0157371_10144170 3300013102 Bacteria 1697
175 Ga0157370_10168670 3300013104 Bacteria 2035
176 Ga0157369_10000139 3300013105 Bacteria 102679
177 Ga0157374_10000012 3300013296 Bacteria 462353
178 Ga0157374_10052381 3300013296 Bacteria 3801
179 Ga0157374_10179224 3300013296 Bacteria 2069
180 Ga0157374_10321716 3300013296 Bacteria 1533
181 Ga0157378_10000393 3300013297 Bacteria 43092
182 Ga0157378_10001059 3300013297 Bacteria 25185
183 Ga0157378_10007219 3300013297 Bacteria 9706
184 Ga0157378_10012303 3300013297 Bacteria 7493
185 Ga0163162_10169440 3300013306 Bacteria 2308
186 Ga0163162_10200394 3300013306 Unclassified 2125
187 Ga0157375_10000001 3300013308 Bacteria 696576
188 Ga0157375_10000008 3300013308 Bacteria 373560
189 Ga0157375_10000793 3300013308 Bacteria 27652
190 Ga0157375_10086848 3300013308 Bacteria 3180
191 Ga0157375_10196666 3300013308 Unclassified 2171
192 Ga0163163_10102808 3300014325 Bacteria 2882
193 Ga0163163_10144280 3300014325 Unclassified 2424
194 Ga0163163_10201625 3300014325 Bacteria 2038
195 Ga0163163_10203473 3300014325 Bacteria 2028
196 Ga0157380_10023497 3300014326 Unclassified 4650
197 Ga0157380_10051380 3300014326 Bacteria 3260
198 Ga0157380_10099021 3300014326 Bacteria 2424
199 Ga0157380_10100893 3300014326 Bacteria 2404
200 Ga0157377_10000002 3300014745 Bacteria 473827
201 Ga0157377_10001410 3300014745 Bacteria 10365
202 Ga0157379_10021814 3300014968 Bacteria 5674
203 Ga0157379_10273316 3300014968 Bacteria 1537
204 Ga0157376_10000004 3300014969 Bacteria 508493
205 Ga0157376_10000024 3300014969 Bacteria 220018
206 Ga0157376_10048459 3300014969 Bacteria 3513
207 Ga0157376_10203700 3300014969 Bacteria 1822
208 Ga0213873_10010298 3300021358 Bacteria 1968
209 Ga0213876_10000012 3300021384 Bacteria 396530
210 Ga0213876_10012261 3300021384 Bacteria 4564
211 Ga0207666_1000841 3300025271 Unclassified 3687
212 Ga0207673_1000316 3300025290 Bacteria 4866
213 Ga0207697_10004321 3300025315 Bacteria 6808
214 Ga0207697_10006019 3300025315 Bacteria 5550
215 Ga0207697_10006598 3300025315 Bacteria 5238
216 Ga0207697_10011859 3300025315 Bacteria 3674
217 Ga0207697_10023308 3300025315 Bacteria 2534
218 Ga0207642_10023903 3300025899 Bacteria 2449
219 Ga0207688_10097964 3300025901 Bacteria 1690
220 Ga0207680_10012532 3300025903 Bacteria 4321
221 Ga0207680_10016487 3300025903 Bacteria 3880
222 Ga0207699_10043635 3300025906 Bacteria 2606
223 Ga0207705_10205222 3300025909 Bacteria 1494
224 Ga0207684_10000263 3300025910 Bacteria 78040
225 Ga0207684_10007107 3300025910 Bacteria 10118
226 Ga0207684_10043063 3300025910 Bacteria 3826
227 Ga0207684_10043684 3300025910 Bacteria 3800
228 Ga0207684_10054670 3300025910 Bacteria 3387
229 Ga0207684_10142956 3300025910 Bacteria 2057
230 Ga0207684_10156915 3300025910 Bacteria 1958
231 Ga0207707_10158779 3300025912 Bacteria 1977
232 Ga0207693_10004539 3300025915 Bacteria 11722
233 Ga0207693_10034999 3300025915 Bacteria 3961
234 Ga0207693_10049081 3300025915 Bacteria 3314
235 Ga0207693_10054624 3300025915 Bacteria 3133
236 Ga0207663_10036530 3300025916 Bacteria 2956
237 Ga0207662_10021025 3300025918 Bacteria 3725
238 Ga0207649_10015800 3300025920 Bacteria 4244
239 Ga0207652_10050965 3300025921 Bacteria 3547
240 Ga0207646_10000012 3300025922 Bacteria 367049
241 Ga0207646_10000155 3300025922 Bacteria 94258
242 Ga0207646_10003412 3300025922 Bacteria 17937
243 Ga0207646_10006120 3300025922 Bacteria 12528
244 Ga0207646_10044905 3300025922 Bacteria 3966
245 Ga0207646_10094187 3300025922 Bacteria 2682
246 Ga0207646_10100820 3300025922 Bacteria 2588
247 Ga0207646_10230247 3300025922 Bacteria 1674
248 Ga0207681_10180490 3300025923 Bacteria 1608
249 Ga0207694_10000001 3300025924 Bacteria 4078485
250 Ga0207650_10000870 3300025925 Bacteria 22893
251 Ga0207659_10069811 3300025926 Bacteria 2560
252 Ga0207687_10000003 3300025927 Bacteria 875159
253 Ga0207687_10000242 3300025927 Bacteria 37275
254 Ga0207687_10101982 3300025927 Bacteria 2113
255 Ga0207700_10095252 3300025928 Bacteria 2361
256 Ga0207644_10000241 3300025931 Bacteria 37521
257 Ga0207644_10093874 3300025931 Bacteria 2241
258 Ga0207706_10042957 3300025933 Unclassified 4006
259 Ga0207706_10099066 3300025933 Unclassified 2564
260 Ga0207686_10012379 3300025934 Bacteria 4691
261 Ga0207670_10016260 3300025936 Bacteria 4467
262 Ga0207670_10132765 3300025936 Bacteria 1826
263 Ga0207665_10069338 3300025939 Bacteria 2404
264 Ga0207665_10078442 3300025939 Bacteria 2269
265 Ga0207665_10210910 3300025939 Bacteria 1419
266 Ga0207691_10014435 3300025940 Bacteria 7533
267 Ga0207711_10212957 3300025941 Bacteria 1765
268 Ga0207689_10028890 3300025942 Bacteria 4636
269 Ga0207689_10033569 3300025942 Bacteria 4264
270 Ga0207661_10000001 3300025944 Bacteria 937688
271 Ga0207661_10183080 3300025944 Bacteria 1831
272 Ga0207661_10204039 3300025944 Bacteria 1739
273 Ga0207679_10041906 3300025945 Bacteria 3286
274 Ga0207679_10306172 3300025945 Bacteria 1371
275 Ga0207668_10152693 3300025972 Bacteria 1790
276 Ga0207640_10001929 3300025981 Bacteria 11167
277 Ga0207640_10088975 3300025981 Bacteria 2133
278 Ga0207640_10339604 3300025981 Bacteria 1202
279 Ga0207658_10050653 3300025986 Bacteria 3057
280 Ga0207658_10062105 3300025986 Unclassified 2795
281 Ga0207658_10305945 3300025986 Bacteria 1371
282 Ga0207677_10000035 3300026023 Bacteria 117469
283 Ga0207677_10000258 3300026023 Bacteria 40707
284 Ga0207703_10000046 3300026035 Bacteria 154474
285 Ga0207703_10206115 3300026035 Bacteria 1750
286 Ga0207703_10325835 3300026035 Bacteria 1408
287 Ga0207639_10002069 3300026041 Bacteria 13526
288 Ga0207639_10116127 3300026041 Bacteria 2190
289 Ga0207678_10013367 3300026067 Bacteria 7204
290 Ga0207702_10027800 3300026078 Bacteria 4699
291 Ga0207641_10002304 3300026088 Bacteria 17751
292 Ga0207641_10165226 3300026088 Bacteria 2015
293 Ga0207641_10180561 3300026088 Bacteria 1933
294 Ga0207648_10166265 3300026089 Unclassified 1949
295 Ga0207676_10000052 3300026095 Bacteria 129811
296 Ga0207676_10281288 3300026095 Bacteria 1511
297 Ga0207676_10388118 3300026095 Unclassified 1301
298 Ga0207683_10208060 3300026121 Unclassified 1780
299 Ga0207698_10115707 3300026142 Bacteria 2258
300 Ga0209998_10021626 3300027717 Bacteria 1382
301 Ga0207428_10000669 3300027907 Bacteria 40037
302 Ga0268266_10001048 3300028379 Bacteria 34678
303 Ga0268266_10075964 3300028379 Bacteria 2919
304 Ga0268265_10087280 3300028380 Unclassified 2482
305 Ga0268264_10065780 3300028381 Bacteria 3055
306 Ga0268264_10086630 3300028381 Bacteria 2691
307 Ga0265338_10011527 3300028800 Bacteria 10197
308 Ga0265338_10012322 3300028800 Bacteria 9755
309 Ga0265338_10032862 3300028800 Bacteria 5050
310 Ga0307511_10004063 3300030521 Bacteria 14959
311 Ga0265760_10000786 3300031090 Bacteria 9128
312 Ga0265760_10031669 3300031090 Bacteria 1560
313 Ga0265320_10091660 3300031240 Bacteria 1407
314 Ga0265325_10010816 3300031241 Bacteria 5263
315 Ga0265339_10062171 3300031249 Bacteria 2008
316 Ga0316576_10008422 3300031727 Bacteria 6576
317 Ga0316578_10004590 3300031728 Bacteria 6544
318 Ga0307406_10086220 3300031901 Bacteria 2102
319 Ga0307407_10109146 3300031903 Bacteria 1734
320 Ga0307416_100046719 3300032002 Bacteria 3420
321 Ga0316583_10008483 3300032133 Bacteria 3707
322 Ga0373923_0116712 3300035111 Bacteria 1189
323 Ga0373932_0000779 3300035112 Bacteria 9453
324 Ga0373954_0044867 3300035118 Bacteria 2064
325 Ga0373956_0058553 3300035119 Bacteria 1742
326 Ga0373943_0112939 3300035170 Bacteria 1435
327 Ga0373935_0006372 3300035692 Bacteria 7040
328 Ga0373935_0202523 3300035692 Bacteria 1372
329 Ga0373933_0040655 3300035724 Bacteria 2741
330 Ga0373947_0021304 3300035725 Bacteria 3751
331 Ga0373937_0017249 3300036401 Bacteria 6428
332 Ga0316582_0212731 3300036647 Bacteria 1321
333 Ga0316584_0014253 3300036712 Bacteria 5655
334 Ga0316584_0165757 3300036712 Bacteria 1641
335 Ga0373925_0122484 3300037068 Bacteria 2020
336 Ga0395899_0124647 3300037312 Bacteria 1843
337 Ga0395900_0015317 3300037418 Bacteria 7816
338 Ga0395900_0352045 3300037418 Bacteria 1446
339 Ga0395898_0012348 3300037466 Bacteria 8834
340 Ga0395905_0005136 3300037471 Bacteria 13434
341 Ga0395905_0013999 3300037471 Bacteria 7674
342 Ga0395905_0018078 3300037471 Bacteria 6692
343 Ga0395905_0102537 3300037471 Bacteria 2686
344 Ga0395901_0069351 3300038443 Bacteria 3672
345 Ga0395901_0177958 3300038443 Bacteria 2231
346 Ga0395901_0194066 3300038443 Bacteria 2129
347 Ga0395901_0428916 3300038443 Bacteria 1355
348 Ga0436365_0120716 3300039437 Bacteria 90169
349 Ga0436365_0941626 3300039437 Bacteria 19200
350 Ga0436360_1116729 3300039438 Bacteria 1500
351 Ga0436362_0077551 3300039453 Bacteria 3770
352 Ga0451577_0025986 3300042876 Bacteria 5306
353 Ga0451577_0077801 3300042876 Bacteria 2958
354 Ga0451577_0228485 3300042876 Bacteria 1682
355 Ga0453684_0006686 3300044712 Bacteria 21754
356 Ga0466967_0221900 3300045976 Bacteria 1796
357 Ga0495651_0055496 3300046462 Bacteria 3044
358 Ga0495653_0106612 3300046463 Bacteria 2021
359 Ga0495580_0000271 3300046472 Bacteria 41618
360 Ga0495582_0004525 3300046473 Bacteria 7811
361 Ga0495664_0013294 3300046477 Bacteria 4669
362 Ga0495664_0101657 3300046477 Bacteria 1732
363 Ga0495618_0035298 3300046514 Bacteria 3139
364 Ga0495628_0010446 3300046516 Bacteria 7885
365 Ga0495630_0084857 3300046517 Bacteria 2391
366 Ga0495665_0046814 3300046531 Unclassified 2296
367 Ga0495665_0105777 3300046531 Bacteria 1477
368 Ga0495586_0070315 3300046535 Bacteria 1911
369 Ga0495587_0008462 3300046536 Bacteria 6613
370 Ga0495645_0003457 3300046543 Bacteria 10717
371 Ga0495645_0090390 3300046543 Bacteria 2188
372 Ga0495667_0099432 3300046559 Unclassified 1883
373 Ga0495656_0071393 3300046615 Bacteria 1543
374 Ga0495668_0001833 3300046616 Bacteria 19216
375 Ga0495634_0023752 3300046642 Bacteria 4308
376 Ga0495635_0064712 3300046663 Bacteria 2510
377 Ga0495599_0020475 3300046678 Bacteria 4119
378 Ga0495623_0014728 3300046679 Bacteria 5056
379 Ga0495646_0013553 3300046680 Bacteria 5183
380 Ga0495669_0054445 3300046684 Bacteria 1801
381 Ga0495613_0135112 3300046689 Unclassified 1765
382 Ga0495613_0166884 3300046689 Bacteria 1564
383 Ga0495600_0117284 3300046809 Unclassified 1732
384 Ga0495604_0023589 3300047317 Bacteria 4908
385 Ga0495604_0103739 3300047317 Unclassified 2085
386 Ga0495674_0275649 3300047319 Bacteria 1379
387 Ga0495675_0016001 3300047444 Bacteria 4742
388 Ga0495679_007551 3300047446 Bacteria 4517
389 Ga0495684_0005356 3300047471 Bacteria 9991
390 Ga0495602_0199472 3300048088 Bacteria 1528
391 Ga0496103_0054754 3300048906 Bacteria 2473
392 Ga0496105_0085329 3300048908 Bacteria 2609
393 Ga0496105_0208235 3300048908 Bacteria 1595
394 Ga0496106_0047658 3300048909 Bacteria 3226
395 Ga0496107_0061378 3300048910 Bacteria 2722
396 Ga0496107_0139817 3300048910 Bacteria 1790
397 Ga0496108_0104681 3300048911 Bacteria 2415
398 Ga0496108_0121708 3300048911 Bacteria 2239
399 Ga0496109_0022802 3300048912 Bacteria 5548
400 Ga0496110_0451921 3300048913 Bacteria 1171
401 Ga0496112_0081418 3300048915 Bacteria 3202
402 Ga0496114_0098871 3300048917 Bacteria 2488
403 Ga0496114_0151273 3300048917 Bacteria 2013
404 Ga0496115_0091198 3300048918 Bacteria 2490
405 Ga0496115_0179222 3300048918 Bacteria 1752
406 nmdc:mga05p37_170811_c1 3300050507 Bacteria 2651
407 nmdc:mga05p37_40983_c1 3300050507 Bacteria 5686
408 nmdc:mga06r32_12217_c1 3300050510 Bacteria 7745
409 nmdc:mga08y16_226653_c1 3300050511 Bacteria 1934
410 nmdc:mga08y16_393_c1 3300050511 Bacteria 40037
411 nmdc:mga0n895_20472_c1 3300050512 Bacteria 6170
412 nmdc:mga0n895_272054_c1 3300050512 Bacteria 1718
413 nmdc:mga0n895_90046_c1 3300050512 Bacteria 3069
414 nmdc:mga0rr50_223605_c1 3300050513 Bacteria 1555
415 nmdc:mga0rr50_24376_c1 3300050513 Bacteria 4189
416 nmdc:mga0rr50_312312_c1 3300050513 Bacteria 1317
417 nmdc:mga0rr50_43059_c1 3300050513 Bacteria 3301
418 Ga0495595_0121568 3300053084 Bacteria 1272
419 Ga0495619_0208432 3300053085 Bacteria 1353

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025939 Ga0207665_10210910 Ga0207665_102109102 297
2 3300035170 Ga0373943_0112939 Ga0373943_0112939_502_1419 303
3 3300009176 Ga0105242_10004508 Ga0105242_1000450810 310
4 3300025934 Ga0207686_10012379 Ga0207686_100123795 310
5 3300005334 Ga0068869_100171726 Ga0068869_1001717261 311
6 3300006871 Ga0075434_100280583 Ga0075434_1002805832 311
7 3300050512 nmdc:mga0n895_272054_c1 nmdc:mga0n895_272054_c1_461_1474 311
8 3300014326 Ga0157380_10023497 Ga0157380_100234977 312
9 3300046616 Ga0495668_0001833 Ga0495668_0001833_2132_3151 315
10 3300013308 Ga0157375_10196666 Ga0157375_101966662 319
11 3300014325 Ga0163163_10203473 Ga0163163_102034732 321
12 3300026035 Ga0207703_10325835 Ga0207703_103258351 321
13 3300031901 Ga0307406_10086220 Ga0307406_100862203 321
14 3300005355 Ga0070671_100126158 Ga0070671_1001261583 322
15 3300005616 Ga0068852_100214038 Ga0068852_1002140383 322
16 3300025945 Ga0207679_10041906 Ga0207679_100419061 322
17 3300026095 Ga0207676_10281288 Ga0207676_102812882 322
18 3300026142 Ga0207698_10115707 Ga0207698_101157072 322
19 3300005468 Ga0070707_100099186 Ga0070707_1000991863 323
20 3300005539 Ga0068853_100002024 Ga0068853_10000202413 323
21 3300025922 Ga0207646_10100820 Ga0207646_101008201 323
22 3300026041 Ga0207639_10002069 Ga0207639_100020699 323
23 3300031903 Ga0307407_10109146 Ga0307407_101091461 324
24 3300005435 Ga0070714_100117581 Ga0070714_1001175812 325
25 3300035111 Ga0373923_0116712 Ga0373923_0116712_10_987 325
26 3300005468 Ga0070707_100000044 Ga0070707_10000004426 326
27 3300005536 Ga0070697_100000011 Ga0070697_100000011119 326
28 3300025922 Ga0207646_10000155 Ga0207646_1000015526 326
29 3300046684 Ga0495669_0054445 Ga0495669_0054445_717_1778 328
30 3300035692 Ga0373935_0006372 Ga0373935_0006372_4288_5310 329
31 3300037068 Ga0373925_0122484 Ga0373925_0122484_785_1807 329
32 3300025972 Ga0207668_10152693 Ga0207668_101526932 332
33 3300006175 Ga0070712_100063565 Ga0070712_1000635652 333
34 3300025315 Ga0207697_10023308 Ga0207697_100233083 333
35 3300025915 Ga0207693_10049081 Ga0207693_100490814 333
36 3300046517 Ga0495630_0084857 Ga0495630_0084857_1044_2045 333
37 3300005434 Ga0070709_10046377 Ga0070709_100463773 334
38 3300006028 Ga0070717_10020031 Ga0070717_100200312 334
39 3300025906 Ga0207699_10043635 Ga0207699_100436352 334
40 3300025915 Ga0207693_10034999 Ga0207693_100349991 334
41 3300025933 Ga0207706_10099066 Ga0207706_100990663 334
42 3300048918 Ga0496115_0179222 Ga0496115_0179222_103_1119 334
43 3300005353 Ga0070669_100143214 Ga0070669_1001432141 335
44 3300014326 Ga0157380_10100893 Ga0157380_101008932 335
45 3300025923 Ga0207681_10180490 Ga0207681_101804901 335
46 3300046531 Ga0495665_0105777 Ga0495665_0105777_189_1196 335
47 3300005445 Ga0070708_100025662 Ga0070708_1000256624 336
48 3300005467 Ga0070706_100164865 Ga0070706_1001648652 336
49 3300005468 Ga0070707_100040797 Ga0070707_1000407974 336
50 3300005536 Ga0070697_100007971 Ga0070697_1000079712 336
51 3300025910 Ga0207684_10054670 Ga0207684_100546702 336
52 3300025922 Ga0207646_10094187 Ga0207646_100941872 336
53 3300005335 Ga0070666_10009405 Ga0070666_100094054 337
54 3300005367 Ga0070667_100176206 Ga0070667_1001762061 337
55 3300005440 Ga0070705_100050199 Ga0070705_1000501992 337
56 3300005445 Ga0070708_100220936 Ga0070708_1002209362 337
57 3300005467 Ga0070706_100232348 Ga0070706_1002323481 337
58 3300005468 Ga0070707_100025781 Ga0070707_1000257814 337
59 3300005518 Ga0070699_100287687 Ga0070699_1002876871 337
60 3300006175 Ga0070712_100021909 Ga0070712_1000219092 337
61 3300009093 Ga0105240_10556916 Ga0105240_105569161 337
62 3300009098 Ga0105245_10186069 Ga0105245_101860692 337
63 3300009098 Ga0105245_10269543 Ga0105245_102695432 337
64 3300009147 Ga0114129_10084328 Ga0114129_100843282 337
65 3300009147 Ga0114129_10254449 Ga0114129_102544492 337
66 3300009177 Ga0105248_10106298 Ga0105248_101062982 337
67 3300010375 Ga0105239_10228339 Ga0105239_102283393 337
68 3300013296 Ga0157374_10052381 Ga0157374_100523813 337
69 3300014325 Ga0163163_10201625 Ga0163163_102016252 337
70 3300014969 Ga0157376_10203700 Ga0157376_102037001 337
71 3300025899 Ga0207642_10023903 Ga0207642_100239032 337
72 3300025903 Ga0207680_10016487 Ga0207680_100164872 337
73 3300025910 Ga0207684_10007107 Ga0207684_1000710710 337
74 3300025922 Ga0207646_10044905 Ga0207646_100449053 337
75 3300025927 Ga0207687_10101982 Ga0207687_101019822 337
76 3300025928 Ga0207700_10095252 Ga0207700_100952523 337
77 3300025939 Ga0207665_10069338 Ga0207665_100693382 337
78 3300025986 Ga0207658_10050653 Ga0207658_100506532 337
79 3300025986 Ga0207658_10305945 Ga0207658_103059451 337
80 3300028379 Ga0268266_10075964 Ga0268266_100759642 337
81 3300031727 Ga0316576_10008422 Ga0316576_100084223 337
82 3300031728 Ga0316578_10004590 Ga0316578_100045902 337
83 3300035724 Ga0373933_0040655 Ga0373933_0040655_1479_2492 337
84 3300035725 Ga0373947_0021304 Ga0373947_0021304_2443_3456 337
85 3300036401 Ga0373937_0017249 Ga0373937_0017249_4440_5453 337
86 3300036647 Ga0316582_0212731 Ga0316582_0212731_174_1187 337
87 3300036712 Ga0316584_0014253 Ga0316584_0014253_4336_5373 337
88 3300036712 Ga0316584_0165757 Ga0316584_0165757_380_1393 337
89 3300046477 Ga0495664_0101657 Ga0495664_0101657_523_1536 337
90 3300046514 Ga0495618_0035298 Ga0495618_0035298_960_1973 337
91 3300046535 Ga0495586_0070315 Ga0495586_0070315_412_1425 337
92 3300046642 Ga0495634_0023752 Ga0495634_0023752_2441_3454 337
93 3300046663 Ga0495635_0064712 Ga0495635_0064712_1226_2239 337
94 3300046679 Ga0495623_0014728 Ga0495623_0014728_2263_3276 337
95 3300046680 Ga0495646_0013553 Ga0495646_0013553_1536_2549 337
96 3300046689 Ga0495613_0166884 Ga0495613_0166884_97_1110 337
97 3300047317 Ga0495604_0023589 Ga0495604_0023589_1242_2255 337
98 3300047471 Ga0495684_0005356 Ga0495684_0005356_3870_4883 337
99 3300048906 Ga0496103_0054754 Ga0496103_0054754_1144_2160 337
100 3300048908 Ga0496105_0208235 Ga0496105_0208235_92_1108 337
101 3300048910 Ga0496107_0061378 Ga0496107_0061378_832_1947 337
102 3300048911 Ga0496108_0104681 Ga0496108_0104681_864_1880 337
103 3300048912 Ga0496109_0022802 Ga0496109_0022802_251_1264 337
104 3300048913 Ga0496110_0451921 Ga0496110_0451921_81_1097 337
105 3300048917 Ga0496114_0098871 Ga0496114_0098871_714_1829 337
106 3300048918 Ga0496115_0091198 Ga0496115_0091198_959_1972 337
107 3300050512 nmdc:mga0n895_90046_c1 nmdc:mga0n895_90046_c1_386_1420 337
108 3300053085 Ga0495619_0208432 Ga0495619_0208432_190_1203 337
109 3300005355 Ga0070671_100000518 Ga0070671_10000051813 338
110 3300005445 Ga0070708_100053928 Ga0070708_1000539283 338
111 3300005467 Ga0070706_100222386 Ga0070706_1002223862 338
112 3300005468 Ga0070707_100007459 Ga0070707_1000074596 338
113 3300005468 Ga0070707_100010968 Ga0070707_1000109688 338
114 3300005468 Ga0070707_100177479 Ga0070707_1001774792 338
115 3300005468 Ga0070707_100379868 Ga0070707_1003798682 338
116 3300005471 Ga0070698_100000832 Ga0070698_10000083218 338
117 3300005471 Ga0070698_100003689 Ga0070698_1000036892 338
118 3300005518 Ga0070699_100000427 Ga0070699_10000042725 338
119 3300005518 Ga0070699_100061631 Ga0070699_1000616314 338
120 3300005536 Ga0070697_100138910 Ga0070697_1001389102 338
121 3300005536 Ga0070697_100267188 Ga0070697_1002671881 338
122 3300005548 Ga0070665_100002223 Ga0070665_10000222318 338
123 3300005841 Ga0068863_100033483 Ga0068863_1000334833 338
124 3300005842 Ga0068858_100207383 Ga0068858_1002073831 338
125 3300005983 Ga0081540_1025518 Ga0081540_10255181 338
126 3300006028 Ga0070717_10097939 Ga0070717_100979393 338
127 3300006237 Ga0097621_100002089 Ga0097621_1000020899 338
128 3300006358 Ga0068871_100019157 Ga0068871_1000191573 338
129 3300006871 Ga0075434_100037167 Ga0075434_1000371673 338
130 3300007076 Ga0075435_100052238 Ga0075435_1000522383 338
131 3300009148 Ga0105243_10488792 Ga0105243_104887921 338
132 3300013296 Ga0157374_10179224 Ga0157374_101792242 338
133 3300013297 Ga0157378_10012303 Ga0157378_100123033 338
134 3300013308 Ga0157375_10086848 Ga0157375_100868481 338
135 3300014326 Ga0157380_10099021 Ga0157380_100990212 338
136 3300014968 Ga0157379_10021814 Ga0157379_100218143 338
137 3300014969 Ga0157376_10000004 Ga0157376_10000004174 338
138 3300025910 Ga0207684_10000263 Ga0207684_100002633 338
139 3300025910 Ga0207684_10043684 Ga0207684_100436842 338
140 3300025910 Ga0207684_10142956 Ga0207684_101429562 338
141 3300025922 Ga0207646_10000012 Ga0207646_1000001271 338
142 3300025922 Ga0207646_10003412 Ga0207646_100034129 338
143 3300025922 Ga0207646_10006120 Ga0207646_1000612011 338
144 3300025931 Ga0207644_10000241 Ga0207644_100002414 338
145 3300025939 Ga0207665_10078442 Ga0207665_100784422 338
146 3300026088 Ga0207641_10002304 Ga0207641_1000230411 338
147 3300026088 Ga0207641_10180561 Ga0207641_101805612 338
148 3300027717 Ga0209998_10021626 Ga0209998_100216261 338
149 3300028379 Ga0268266_10001048 Ga0268266_1000104811 338
150 3300028381 Ga0268264_10086630 Ga0268264_100866303 338
151 3300028800 Ga0265338_10011527 Ga0265338_100115273 338
152 3300028800 Ga0265338_10032862 Ga0265338_100328625 338
153 3300031090 Ga0265760_10031669 Ga0265760_100316692 338
154 3300031240 Ga0265320_10091660 Ga0265320_100916602 338
155 3300031241 Ga0265325_10010816 Ga0265325_100108164 338
156 3300042876 Ga0451577_0025986 Ga0451577_0025986_1550_2578 338
157 3300042876 Ga0451577_0228485 Ga0451577_0228485_624_1652 338
158 3300044712 Ga0453684_0006686 Ga0453684_0006686_345_1373 338
159 3300046472 Ga0495580_0000271 Ga0495580_0000271_2128_3156 338
160 3300046473 Ga0495582_0004525 Ga0495582_0004525_2263_3291 338
161 3300050511 nmdc:mga08y16_226653_c1 nmdc:mga08y16_226653_c1_614_1660 338
162 3300050512 nmdc:mga0n895_20472_c1 nmdc:mga0n895_20472_c1_1253_2281 338
163 3300050513 nmdc:mga0rr50_223605_c1 nmdc:mga0rr50_223605_c1_467_1495 338
164 3300050513 nmdc:mga0rr50_312312_c1 nmdc:mga0rr50_312312_c1_276_1304 338
165 3300050513 nmdc:mga0rr50_43059_c1 nmdc:mga0rr50_43059_c1_870_1898 338
166 3300005334 Ga0068869_100027841 Ga0068869_1000278413 339
167 3300005459 Ga0068867_100043724 Ga0068867_1000437243 339
168 3300006028 Ga0070717_10000278 Ga0070717_100002788 339
169 3300009147 Ga0114129_10126608 Ga0114129_101266082 339
170 3300013102 Ga0157371_10144170 Ga0157371_101441702 339
171 3300014969 Ga0157376_10048459 Ga0157376_100484592 339
172 3300032002 Ga0307416_100046719 Ga0307416_1000467193 339
173 3300048908 Ga0496105_0085329 Ga0496105_0085329_1199_2290 339
174 3300048911 Ga0496108_0121708 Ga0496108_0121708_283_1374 339
175 3300048917 Ga0496114_0151273 Ga0496114_0151273_437_1528 339
176 3300005290 Ga0065712_10080998 Ga0065712_100809983 340
177 3300005536 Ga0070697_100356449 Ga0070697_1003564491 340
178 3300013105 Ga0157369_10000139 Ga0157369_1000013944 340
179 3300025915 Ga0207693_10004539 Ga0207693_100045393 340
180 3300046463 Ga0495653_0106612 Ga0495653_0106612_668_1735 340
181 3300005329 Ga0070683_100076559 Ga0070683_1000765593 341
182 3300005330 Ga0070690_100139671 Ga0070690_1001396711 341
183 3300005337 Ga0070682_100342504 Ga0070682_1003425041 341
184 3300005340 Ga0070689_100189931 Ga0070689_1001899312 341
185 3300005340 Ga0070689_100191481 Ga0070689_1001914811 341
186 3300005355 Ga0070671_100199689 Ga0070671_1001996891 341
187 3300005365 Ga0070688_100061527 Ga0070688_1000615272 341
188 3300005436 Ga0070713_100058284 Ga0070713_1000582844 341
189 3300005436 Ga0070713_100134236 Ga0070713_1001342361 341
190 3300005455 Ga0070663_100062955 Ga0070663_1000629553 341
191 3300005457 Ga0070662_100106672 Ga0070662_1001066722 341
192 3300005535 Ga0070684_100034801 Ga0070684_1000348013 341
193 3300005539 Ga0068853_100172901 Ga0068853_1001729012 341
194 3300005543 Ga0070672_100101132 Ga0070672_1001011323 341
195 3300005548 Ga0070665_100068090 Ga0070665_1000680902 341
196 3300005842 Ga0068858_100342248 Ga0068858_1003422481 341
197 3300005937 Ga0081455_10056273 Ga0081455_100562732 341
198 3300005985 Ga0081539_10017643 Ga0081539_100176435 341
199 3300006871 Ga0075434_100392607 Ga0075434_1003926071 341
200 3300009098 Ga0105245_10000024 Ga0105245_10000024127 341
201 3300013308 Ga0157375_10000793 Ga0157375_1000079310 341
202 3300014325 Ga0163163_10102808 Ga0163163_101028081 341
203 3300025271 Ga0207666_1000841 Ga0207666_10008414 341
204 3300025315 Ga0207697_10011859 Ga0207697_100118594 341
205 3300025915 Ga0207693_10054624 Ga0207693_100546244 341
206 3300025916 Ga0207663_10036530 Ga0207663_100365303 341
207 3300025927 Ga0207687_10000003 Ga0207687_10000003127 341
208 3300025933 Ga0207706_10042957 Ga0207706_100429573 341
209 3300025944 Ga0207661_10204039 Ga0207661_102040392 341
210 3300026067 Ga0207678_10013367 Ga0207678_100133672 341
211 3300026121 Ga0207683_10208060 Ga0207683_102080602 341
212 3300035118 Ga0373954_0044867 Ga0373954_0044867_588_1613 341
213 3300035119 Ga0373956_0058553 Ga0373956_0058553_684_1709 341
214 3300037471 Ga0395905_0013999 Ga0395905_0013999_3929_4969 341
215 3300045976 Ga0466967_0221900 Ga0466967_0221900_718_1785 341
216 3300046462 Ga0495651_0055496 Ga0495651_0055496_77_1102 341
217 3300046516 Ga0495628_0010446 Ga0495628_0010446_4525_5550 341
218 3300046531 Ga0495665_0046814 Ga0495665_0046814_373_1419 341
219 3300046536 Ga0495587_0008462 Ga0495587_0008462_3259_4284 341
220 3300046543 Ga0495645_0003457 Ga0495645_0003457_6974_7999 341
221 3300046559 Ga0495667_0099432 Ga0495667_0099432_298_1344 341
222 3300046678 Ga0495599_0020475 Ga0495599_0020475_152_1177 341
223 3300046689 Ga0495613_0135112 Ga0495613_0135112_10_1056 341
224 3300046809 Ga0495600_0117284 Ga0495600_0117284_85_1131 341
225 3300047317 Ga0495604_0103739 Ga0495604_0103739_148_1194 341
226 3300048088 Ga0495602_0199472 Ga0495602_0199472_34_1110 341
227 3300053084 Ga0495595_0121568 Ga0495595_0121568_40_1065 341
228 3300032133 Ga0316583_10008483 Ga0316583_100084833 342
229 3300035112 Ga0373932_0000779 Ga0373932_0000779_4553_5581 342
230 3300005289 Ga0065704_10131577 Ga0065704_101315772 343
231 3300005290 Ga0065712_10085064 Ga0065712_100850643 343
232 3300005290 Ga0065712_10100898 Ga0065712_101008982 343
233 3300005293 Ga0065715_10001742 Ga0065715_100017426 343
234 3300005329 Ga0070683_100027635 Ga0070683_1000276353 343
235 3300005335 Ga0070666_10007060 Ga0070666_100070603 343
236 3300005336 Ga0070680_100030939 Ga0070680_1000309393 343
237 3300005344 Ga0070661_100056777 Ga0070661_1000567772 343
238 3300005347 Ga0070668_100106987 Ga0070668_1001069872 343
239 3300005365 Ga0070688_100121443 Ga0070688_1001214432 343
240 3300005367 Ga0070667_100183783 Ga0070667_1001837831 343
241 3300005456 Ga0070678_100018153 Ga0070678_1000181535 343
242 3300005466 Ga0070685_10027410 Ga0070685_100274103 343
243 3300005530 Ga0070679_100062659 Ga0070679_1000626594 343
244 3300005535 Ga0070684_100003182 Ga0070684_1000031829 343
245 3300005535 Ga0070684_100005720 Ga0070684_1000057203 343
246 3300005549 Ga0070704_100010864 Ga0070704_1000108643 343
247 3300005564 Ga0070664_100095106 Ga0070664_1000951063 343
248 3300005614 Ga0068856_100073568 Ga0068856_1000735682 343
249 3300005617 Ga0068859_100033159 Ga0068859_1000331596 343
250 3300005617 Ga0068859_100062197 Ga0068859_1000621972 343
251 3300005618 Ga0068864_100004135 Ga0068864_10000413510 343
252 3300005841 Ga0068863_100178797 Ga0068863_1001787971 343
253 3300005841 Ga0068863_100184262 Ga0068863_1001842622 343
254 3300005843 Ga0068860_100099504 Ga0068860_1000995043 343
255 3300005843 Ga0068860_100137193 Ga0068860_1001371932 343
256 3300005844 Ga0068862_100067728 Ga0068862_1000677283 343
257 3300005937 Ga0081455_10000382 Ga0081455_1000038215 343
258 3300005937 Ga0081455_10162927 Ga0081455_101629271 343
259 3300006237 Ga0097621_100142084 Ga0097621_1001420842 343
260 3300006847 Ga0075431_100015431 Ga0075431_1000154312 343
261 3300006931 Ga0097620_100033162 Ga0097620_1000331626 343
262 3300006931 Ga0097620_100062197 Ga0097620_1000621972 343
263 3300009176 Ga0105242_10099220 Ga0105242_100992203 343
264 3300009553 Ga0105249_10024683 Ga0105249_100246835 343
265 3300013306 Ga0163162_10169440 Ga0163162_101694403 343
266 3300013306 Ga0163162_10200394 Ga0163162_102003942 343
267 3300014325 Ga0163163_10144280 Ga0163163_101442803 343
268 3300025315 Ga0207697_10004321 Ga0207697_100043217 343
269 3300025315 Ga0207697_10006019 Ga0207697_100060195 343
270 3300025315 Ga0207697_10006598 Ga0207697_100065982 343
271 3300025901 Ga0207688_10097964 Ga0207688_100979642 343
272 3300025903 Ga0207680_10012532 Ga0207680_100125323 343
273 3300025909 Ga0207705_10205222 Ga0207705_102052221 343
274 3300025912 Ga0207707_10158779 Ga0207707_101587792 343
275 3300025920 Ga0207649_10015800 Ga0207649_100158005 343
276 3300025921 Ga0207652_10050965 Ga0207652_100509654 343
277 3300025926 Ga0207659_10069811 Ga0207659_100698111 343
278 3300025931 Ga0207644_10093874 Ga0207644_100938742 343
279 3300025941 Ga0207711_10212957 Ga0207711_102129572 343
280 3300025942 Ga0207689_10033569 Ga0207689_100335694 343
281 3300025944 Ga0207661_10183080 Ga0207661_101830801 343
282 3300025945 Ga0207679_10306172 Ga0207679_103061721 343
283 3300025981 Ga0207640_10339604 Ga0207640_103396041 343
284 3300025986 Ga0207658_10062105 Ga0207658_100621052 343
285 3300026078 Ga0207702_10027800 Ga0207702_100278002 343
286 3300026088 Ga0207641_10165226 Ga0207641_101652262 343
287 3300026089 Ga0207648_10166265 Ga0207648_101662652 343
288 3300026095 Ga0207676_10388118 Ga0207676_103881181 343
289 3300028380 Ga0268265_10087280 Ga0268265_100872802 343
290 3300028381 Ga0268264_10065780 Ga0268264_100657803 343
291 3300035692 Ga0373935_0202523 Ga0373935_0202523_78_1205 343
292 3300046615 Ga0495656_0071393 Ga0495656_0071393_316_1368 343
293 3300048909 Ga0496106_0047658 Ga0496106_0047658_1772_2899 343
294 3300048910 Ga0496107_0139817 Ga0496107_0139817_34_1161 343
295 3300050510 nmdc:mga06r32_12217_c1 nmdc:mga06r32_12217_c1_6477_7508 343
296 3300005329 Ga0070683_100000040 Ga0070683_10000004025 344
297 3300005329 Ga0070683_100195795 Ga0070683_1001957952 344
298 3300005333 Ga0070677_10037467 Ga0070677_100374672 344
299 3300005337 Ga0070682_100000014 Ga0070682_10000001466 344
300 3300005338 Ga0068868_100004739 Ga0068868_1000047395 344
301 3300005338 Ga0068868_100033859 Ga0068868_1000338594 344
302 3300005340 Ga0070689_100025206 Ga0070689_1000252062 344
303 3300005445 Ga0070708_100410519 Ga0070708_1004105191 344
304 3300005467 Ga0070706_100067476 Ga0070706_1000674762 344
305 3300005467 Ga0070706_100084864 Ga0070706_1000848642 344
306 3300005467 Ga0070706_100298436 Ga0070706_1002984361 344
307 3300005468 Ga0070707_100034011 Ga0070707_1000340112 344
308 3300005471 Ga0070698_100054554 Ga0070698_1000545542 344
309 3300005471 Ga0070698_100231221 Ga0070698_1002312212 344
310 3300005535 Ga0070684_100277497 Ga0070684_1002774971 344
311 3300005536 Ga0070697_100160821 Ga0070697_1001608212 344
312 3300005543 Ga0070672_100007328 Ga0070672_1000073286 344
313 3300005544 Ga0070686_100155954 Ga0070686_1001559542 344
314 3300005578 Ga0068854_100006027 Ga0068854_1000060273 344
315 3300005615 Ga0070702_100240729 Ga0070702_1002407291 344
316 3300005618 Ga0068864_100000589 Ga0068864_1000005895 344
317 3300005842 Ga0068858_100000243 Ga0068858_10000024348 344
318 3300007076 Ga0075435_100009353 Ga0075435_1000093535 344
319 3300009094 Ga0111539_10000837 Ga0111539_100008376 344
320 3300009098 Ga0105245_10000893 Ga0105245_100008933 344
321 3300009147 Ga0114129_10339681 Ga0114129_103396812 344
322 3300013297 Ga0157378_10007219 Ga0157378_100072197 344
323 3300013308 Ga0157375_10000001 Ga0157375_1000000198 344
324 3300014326 Ga0157380_10051380 Ga0157380_100513802 344
325 3300014745 Ga0157377_10001410 Ga0157377_100014105 344
326 3300014968 Ga0157379_10273316 Ga0157379_102733161 344
327 3300025910 Ga0207684_10043063 Ga0207684_100430632 344
328 3300025918 Ga0207662_10021025 Ga0207662_100210254 344
329 3300025927 Ga0207687_10000242 Ga0207687_1000024225 344
330 3300025936 Ga0207670_10016260 Ga0207670_100162602 344
331 3300025936 Ga0207670_10132765 Ga0207670_101327652 344
332 3300025940 Ga0207691_10014435 Ga0207691_100144356 344
333 3300025944 Ga0207661_10000001 Ga0207661_10000001697 344
334 3300025981 Ga0207640_10001929 Ga0207640_100019295 344
335 3300026023 Ga0207677_10000035 Ga0207677_1000003597 344
336 3300026035 Ga0207703_10000046 Ga0207703_1000004656 344
337 3300026035 Ga0207703_10206115 Ga0207703_102061152 344
338 3300026095 Ga0207676_10000052 Ga0207676_100000525 344
339 3300027907 Ga0207428_10000669 Ga0207428_100006696 344
340 3300037471 Ga0395905_0005136 Ga0395905_0005136_4360_5412 344
341 3300042876 Ga0451577_0077801 Ga0451577_0077801_743_1777 344
342 3300050507 nmdc:mga05p37_170811_c1 nmdc:mga05p37_170811_c1_1453_2487 344
343 3300050511 nmdc:mga08y16_393_c1 nmdc:mga08y16_393_c1_5575_6609 344
344 3300050513 nmdc:mga0rr50_24376_c1 nmdc:mga0rr50_24376_c1_1624_2661 344
345 3300005290 Ga0065712_10087869 Ga0065712_100878693 345
346 3300005331 Ga0070670_100001093 Ga0070670_1000010932 345
347 3300005334 Ga0068869_100019293 Ga0068869_1000192933 345
348 3300005338 Ga0068868_100000018 Ga0068868_10000001824 345
349 3300005466 Ga0070685_10011423 Ga0070685_100114233 345
350 3300005530 Ga0070679_100112520 Ga0070679_1001125203 345
351 3300005578 Ga0068854_100017776 Ga0068854_1000177762 345
352 3300005937 Ga0081455_10040923 Ga0081455_100409233 345
353 3300006028 Ga0070717_10002165 Ga0070717_100021656 345
354 3300009551 Ga0105238_10000001 Ga0105238_10000001677 345
355 3300013296 Ga0157374_10000012 Ga0157374_10000012243 345
356 3300013296 Ga0157374_10321716 Ga0157374_103217162 345
357 3300013297 Ga0157378_10000393 Ga0157378_1000039327 345
358 3300013297 Ga0157378_10001059 Ga0157378_1000105913 345
359 3300013308 Ga0157375_10000008 Ga0157375_10000008299 345
360 3300014745 Ga0157377_10000002 Ga0157377_10000002198 345
361 3300014969 Ga0157376_10000024 Ga0157376_1000002429 345
362 3300021358 Ga0213873_10010298 Ga0213873_100102982 345
363 3300021384 Ga0213876_10000012 Ga0213876_1000001211 345
364 3300021384 Ga0213876_10012261 Ga0213876_100122613 345
365 3300025290 Ga0207673_1000316 Ga0207673_10003164 345
366 3300025924 Ga0207694_10000001 Ga0207694_100000011717 345
367 3300025925 Ga0207650_10000870 Ga0207650_1000087016 345
368 3300025942 Ga0207689_10028890 Ga0207689_100288902 345
369 3300025981 Ga0207640_10088975 Ga0207640_100889752 345
370 3300026023 Ga0207677_10000258 Ga0207677_1000025821 345
371 3300026041 Ga0207639_10116127 Ga0207639_101161272 345
372 3300037471 Ga0395905_0018078 Ga0395905_0018078_2998_4053 345
373 3300037471 Ga0395905_0102537 Ga0395905_0102537_1177_2232 345
374 3300038443 Ga0395901_0177958 Ga0395901_0177958_1012_2067 345
375 3300039437 Ga0436365_0120716 Ga0436365_0120716_5029_6066 345
376 3300039437 Ga0436365_0941626 Ga0436365_0941626_15002_16039 345
377 3300039453 Ga0436362_0077551 Ga0436362_0077551_2035_3072 345
378 3300046477 Ga0495664_0013294 Ga0495664_0013294_1741_2799 345
379 3300046543 Ga0495645_0090390 Ga0495645_0090390_914_1972 345
380 3300047444 Ga0495675_0016001 Ga0495675_0016001_795_1853 345
381 3300047446 Ga0495679_007551 Ga0495679_007551_59_1096 345
382 3300048915 Ga0496112_0081418 Ga0496112_0081418_1902_2957 345
383 3300005563 Ga0068855_100237105 Ga0068855_1002371052 346
384 3300009093 Ga0105240_10150827 Ga0105240_101508272 346
385 3300009174 Ga0105241_10178712 Ga0105241_101787122 346
386 3300013104 Ga0157370_10168670 Ga0157370_101686702 346
387 3300025922 Ga0207646_10230247 Ga0207646_102302472 346
388 3300003911 JGI25405J52794_10003102 JGI25405J52794_100031023 347
389 3300003911 JGI25405J52794_10003410 JGI25405J52794_100034102 347
390 3300003911 JGI25405J52794_10007156 JGI25405J52794_100071562 347
391 3300005289 Ga0065704_10106064 Ga0065704_101060642 347
392 3300005290 Ga0065712_10088979 Ga0065712_100889792 347
393 3300005293 Ga0065715_10089294 Ga0065715_100892943 347
394 3300005435 Ga0070714_100377889 Ga0070714_1003778891 347
395 3300005436 Ga0070713_100009752 Ga0070713_1000097522 347
396 3300005468 Ga0070707_100006052 Ga0070707_1000060528 347
397 3300005468 Ga0070707_100123605 Ga0070707_1001236051 347
398 3300005471 Ga0070698_100020868 Ga0070698_1000208682 347
399 3300005536 Ga0070697_100220670 Ga0070697_1002206701 347
400 3300005841 Ga0068863_100121687 Ga0068863_1001216873 347
401 3300005937 Ga0081455_10002396 Ga0081455_100023968 347
402 3300005937 Ga0081455_10004372 Ga0081455_100043723 347
403 3300005983 Ga0081540_1000018 Ga0081540_100001864 347
404 3300009147 Ga0114129_10015499 Ga0114129_100154997 347
405 3300025910 Ga0207684_10156915 Ga0207684_101569152 347
406 3300028800 Ga0265338_10012322 Ga0265338_100123225 347
407 3300030521 Ga0307511_10004063 Ga0307511_100040632 347
408 3300031090 Ga0265760_10000786 Ga0265760_100007865 347
409 3300031249 Ga0265339_10062171 Ga0265339_100621712 347
410 3300037312 Ga0395899_0124647 Ga0395899_0124647_215_1258 347
411 3300037418 Ga0395900_0015317 Ga0395900_0015317_6198_7241 347
412 3300037418 Ga0395900_0352045 Ga0395900_0352045_227_1270 347
413 3300037466 Ga0395898_0012348 Ga0395898_0012348_849_1892 347
414 3300038443 Ga0395901_0069351 Ga0395901_0069351_1793_2836 347
415 3300038443 Ga0395901_0194066 Ga0395901_0194066_973_2016 347
416 3300038443 Ga0395901_0428916 Ga0395901_0428916_274_1317 347
417 3300039438 Ga0436360_1116729 Ga0436360_1116729_36_1133 347
418 3300047319 Ga0495674_0275649 Ga0495674_0275649_196_1263 347
419 3300050507 nmdc:mga05p37_40983_c1 nmdc:mga05p37_40983_c1_2586_3629 347

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF18152

DAHP_snth_FXD

DAHP synthase ferredoxin-like domain

1

67

0.99

PF00793

DAHP_synth_1

DAHP synthetase I family

79

333

0.94

PF03102

NeuB

NeuB family

133

337

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
3pg8-assembly1.cif.gz_B truncated form of 3-deoxy-d-arabino-heptulosonate 7-phosphate synthase from thermotoga maritima 0.9635 71 332
3pg8-assembly1.cif.gz_A truncated form of 3-deoxy-d-arabino-heptulosonate 7-phosphate synthase from thermotoga maritima 0.9602 71 332
1vs1-assembly1.cif.gz_B crystal structure of 3-deoxy-d-arabino-heptulosonate-7-phosphate synthase (dahp synthase) from aeropyrum pernix in complex with mn2+ and pep 0.96 80 328
4c1k-assembly1.cif.gz_E crystal structure of pyrococcus furiosus 3-deoxy-d-arabino- heptulosonate 7-phosphate synthase 0.9586 72 329
4c1l-assembly1.cif.gz_A crystal structure of pyrococcus furiosus 3-deoxy-d-arabino- heptulosonate 7-phosphate synthase i181d interface mutant 0.9581 72 329
ID Description Score Start End Superfamily
3pg8A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9599 71 332 3.20.20.70
3pg8A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9214 71 332 3.20.20.70
1fwtA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.921 95 333 3.20.20.70
1o60D00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8736 79 333 3.20.20.70
4z1aA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8692 94 332 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A645HI73-F1-model_v4 Phospho-2-dehydro-3-deoxyheptonate aldolase (EC 2.5.1.54) 0.9808 220 332 GO:0003849
GO:0009058
AF-A0A7J4K246-F1-model_v4 3-deoxy-7-phosphoheptulonate synthase (EC 2.5.1.54) 0.9804 247 332 GO:0003849
GO:0009058
AF-A0A7C5M4X6-F1-model_v4 3-deoxy-7-phosphoheptulonate synthase 0.979 204 333 GO:0009058
AF-A0A352TTM3-F1-model_v4 3-deoxy-7-phosphoheptulonate synthase 0.9785 207 333 GO:0009058
AF-A0A7C7DVZ8-F1-model_v4 3-deoxy-7-phosphoheptulonate synthase (EC 2.5.1.54) 0.9782 203 332 GO:0003849
GO:0009058

Feature Viewer

pLDDT pTM Quality
88.97 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map