F439310

General Info

Members Datasets Scaffolds Average Seq Length
418 226 836 229

Family's Representative Sequence

Representative Sequence 3300014326|Ga0157380_10102217|Ga0157380_101022172
Length 233
Sequence MVPMDRREFLTQFGAAGVAAWAQVRPRRPKANEFVFARLRYDSGDWDYNPKVAGNILDSVMQYTTIPVYPEEIVITADSPELASFPFVFMTGHKLVRFSEREREGLVRFVDQGGLLFSDDCNHDVNGLYAKSFEDEMRRAFPATPLAKIPASHPLYRSFFTFDGPPQTSHELNGWGDDMVHDYLRAIDRRGRLGVIYSNKDYGCEWDYDWRNKRFRKDDNTRFAVNLVVYCMT

Samples

Sample ID Description Type Environment
1 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
57 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
58 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
61 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
62 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
98 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
151 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
155 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
156 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
157 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
158 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
159 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
160 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
161 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
162 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
163 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
164 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
165 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
166 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
167 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
168 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
169 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
170 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
171 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
172 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
173 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
174 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
175 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
176 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
177 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
178 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
179 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
180 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
181 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
182 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
183 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
184 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
185 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
186 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
187 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
188 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
189 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
190 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
191 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
192 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
193 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
194 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
195 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
196 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
197 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
198 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
199 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
207 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
208 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
209 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
210 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
211 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
212 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
213 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
214 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
215 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
216 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
217 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
218 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
219 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
220 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
221 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
222 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
223 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
224 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
225 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
226 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.59
Nodule 0
Rhizoplane 2.63
Rhizosphere 93.3
Stem 0
Stem Tuber 0
Unclassified 3.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157380_10102217 3300014326 Bacteria 2390
2 Ga0065712_10182109 3300005290 Bacteria 1187
3 Ga0065712_10214803 3300005290 Bacteria 1060
4 Ga0065715_10040149 3300005293 Bacteria 1460
5 Ga0065715_10104500 3300005293 Bacteria 2957
6 Ga0065715_10434393 3300005293 Bacteria 843
7 Ga0065707_10031302 3300005295 Bacteria 1291
8 Ga0070683_100157664 3300005329 Bacteria 2153
9 Ga0070690_100066619 3300005330 Bacteria 2331
10 Ga0070690_100270513 3300005330 Bacteria 1208
11 Ga0070677_10136746 3300005333 Bacteria 1125
12 Ga0070666_10017285 3300005335 Bacteria 4622
13 Ga0070680_100763195 3300005336 Bacteria 833
14 Ga0070682_100250742 3300005337 Bacteria 1276
15 Ga0068868_100058030 3300005338 Bacteria 3059
16 Ga0070660_100003029 3300005339 Bacteria 11568
17 Ga0070660_100108846 3300005339 Bacteria 2203
18 Ga0070689_100043680 3300005340 Bacteria 3445
19 Ga0070689_100109796 3300005340 Bacteria 2192
20 Ga0070689_100216645 3300005340 Bacteria 1569
21 Ga0070691_10004777 3300005341 Bacteria 6164
22 Ga0070691_10033294 3300005341 Bacteria 2425
23 Ga0070692_10073416 3300005345 Bacteria 1828
24 Ga0070668_100132520 3300005347 Bacteria 2001
25 Ga0070668_100231502 3300005347 Bacteria 1528
26 Ga0070669_100003976 3300005353 Bacteria 10697
27 Ga0070669_100064920 3300005353 Bacteria 2688
28 Ga0070669_100246262 3300005353 Bacteria 1422
29 Ga0070675_100000646 3300005354 Bacteria 24086
30 Ga0070675_100081901 3300005354 Bacteria 2692
31 Ga0070675_100294424 3300005354 Bacteria 1429
32 Ga0070675_100346506 3300005354 Bacteria 1317
33 Ga0070671_100024952 3300005355 Bacteria 4899
34 Ga0070671_100034945 3300005355 Bacteria 4162
35 Ga0070674_100291316 3300005356 Bacteria 1298
36 Ga0070673_100109235 3300005364 Bacteria 2291
37 Ga0070688_100051331 3300005365 Bacteria 2572
38 Ga0070688_100162608 3300005365 Bacteria 1535
39 Ga0070667_100012313 3300005367 Bacteria 7076
40 Ga0070714_100014765 3300005435 Bacteria 6276
41 Ga0070713_100099423 3300005436 Bacteria 2517
42 Ga0070705_100010012 3300005440 Bacteria 4733
43 Ga0070700_100011240 3300005441 Bacteria 4957
44 Ga0070700_100036198 3300005441 Bacteria 2992
45 Ga0070694_100006820 3300005444 Bacteria 6936
46 Ga0070694_100104529 3300005444 Bacteria 2008
47 Ga0070708_100248962 3300005445 Bacteria 1669
48 Ga0070678_100059947 3300005456 Bacteria 2799
49 Ga0068867_100017168 3300005459 Bacteria 5142
50 Ga0068867_100042554 3300005459 Bacteria 3323
51 Ga0068867_100083507 3300005459 Bacteria 2411
52 Ga0068867_100098998 3300005459 Bacteria 2224
53 Ga0068867_100545283 3300005459 Unclassified 1004
54 Ga0070706_100114029 3300005467 Bacteria 2516
55 Ga0070706_101069943 3300005467 Bacteria 743
56 Ga0070707_100099068 3300005468 Bacteria 2824
57 Ga0070707_100224765 3300005468 Bacteria 1828
58 Ga0070707_100350952 3300005468 Bacteria 1433
59 Ga0070707_100499019 3300005468 Bacteria 1179
60 Ga0070698_100099361 3300005471 Bacteria 2883
61 Ga0070699_100042882 3300005518 Bacteria 3916
62 Ga0070699_100180948 3300005518 Bacteria 1871
63 Ga0070679_100119391 3300005530 Bacteria 2622
64 Ga0070697_100447675 3300005536 Bacteria 1125
65 Ga0070697_100683495 3300005536 Bacteria 905
66 Ga0070672_100170931 3300005543 Bacteria 1807
67 Ga0070686_100076447 3300005544 Bacteria 2205
68 Ga0070686_100088239 3300005544 Bacteria 2069
69 Ga0070686_100291301 3300005544 Bacteria 1208
70 Ga0070686_100295562 3300005544 Bacteria 1199
71 Ga0070686_100351370 3300005544 Bacteria 1108
72 Ga0070695_100002747 3300005545 Bacteria 10206
73 Ga0070695_100010637 3300005545 Bacteria 5499
74 Ga0070695_100128846 3300005545 Bacteria 1741
75 Ga0070696_100011794 3300005546 Bacteria 5856
76 Ga0070696_100028451 3300005546 Bacteria 3814
77 Ga0070665_100003987 3300005548 Bacteria 15568
78 Ga0070665_100013227 3300005548 Bacteria 8314
79 Ga0070704_100001732 3300005549 Bacteria 11908
80 Ga0070704_100007654 3300005549 Bacteria 6440
81 Ga0070704_100020478 3300005549 Bacteria 4266
82 Ga0068854_100106567 3300005578 Bacteria 2109
83 Ga0068854_100255346 3300005578 Bacteria 1401
84 Ga0070702_100075127 3300005615 Bacteria 2007
85 Ga0070702_100207624 3300005615 Unclassified 1301
86 Ga0068852_100090822 3300005616 Bacteria 2732
87 Ga0068859_100029841 3300005617 Bacteria 5471
88 Ga0068859_100056389 3300005617 Bacteria 3954
89 Ga0068864_100009399 3300005618 Bacteria 8066
90 Ga0068864_100120480 3300005618 Bacteria 2346
91 Ga0068864_100216253 3300005618 Bacteria 1767
92 Ga0068861_100011212 3300005719 Bacteria 6223
93 Ga0068863_100004770 3300005841 Bacteria 13360
94 Ga0068863_100111680 3300005841 Bacteria 2603
95 Ga0068863_100170297 3300005841 Bacteria 2089
96 Ga0068858_100027499 3300005842 Bacteria 5283
97 Ga0068858_100142917 3300005842 Unclassified 2247
98 Ga0068860_100076502 3300005843 Bacteria 3183
99 Ga0068860_100238222 3300005843 Bacteria 1769
100 Ga0068860_100312550 3300005843 Unclassified 1541
101 Ga0068862_100026665 3300005844 Bacteria 4858
102 Ga0068862_100105587 3300005844 Bacteria 2468
103 Ga0068862_100892092 3300005844 Bacteria 874
104 Ga0081455_10042181 3300005937 Bacteria 4005
105 Ga0081539_10011740 3300005985 Bacteria 6868
106 Ga0075365_10020314 3300006038 Bacteria 4116
107 Ga0075365_10231678 3300006038 Bacteria 1297
108 Ga0075368_10016384 3300006042 Bacteria 2762
109 Ga0075364_10021239 3300006051 Bacteria 4090
110 Ga0075364_10216319 3300006051 Bacteria 1299
111 Ga0075364_10255967 3300006051 Bacteria 1190
112 Ga0070716_100246521 3300006173 Bacteria 1214
113 Ga0075362_10001416 3300006177 Bacteria 7642
114 Ga0075367_10020663 3300006178 Bacteria 3671
115 Ga0075366_10002439 3300006195 Bacteria 9523
116 Ga0075366_10226222 3300006195 Bacteria 1140
117 Ga0097621_100003280 3300006237 Bacteria 11128
118 Ga0068871_100001665 3300006358 Bacteria 14939
119 Ga0075428_100024046 3300006844 Bacteria 6743
120 Ga0075430_100025751 3300006846 Bacteria 5005
121 Ga0075431_100001520 3300006847 Bacteria 21495
122 Ga0075431_100157580 3300006847 Bacteria 2336
123 Ga0075433_10002028 3300006852 Bacteria 15277
124 Ga0075433_10161628 3300006852 Bacteria 1993
125 Ga0075433_10545289 3300006852 Bacteria 1020
126 Ga0075434_100365532 3300006871 Bacteria 1464
127 Ga0075434_100389435 3300006871 Bacteria 1415
128 Ga0075434_100642394 3300006871 Bacteria 1079
129 Ga0075429_100170190 3300006880 Bacteria 1908
130 Ga0075429_100417679 3300006880 Bacteria 1175
131 Ga0068865_100002139 3300006881 Bacteria 11664
132 Ga0068865_100107871 3300006881 Bacteria 2049
133 Ga0068865_100306656 3300006881 Bacteria 1272
134 Ga0075436_100043098 3300006914 Bacteria 3111
135 Ga0075436_100245625 3300006914 Bacteria 1274
136 Ga0075436_100364227 3300006914 Bacteria 1043
137 Ga0097620_100029840 3300006931 Bacteria 5471
138 Ga0097620_100056378 3300006931 Bacteria 3954
139 Ga0097620_100551063 3300006931 Bacteria 1247
140 Ga0075435_100000528 3300007076 Bacteria 23354
141 Ga0075435_100023759 3300007076 Bacteria 4747
142 Ga0075435_100064648 3300007076 Bacteria 2973
143 Ga0075435_100100722 3300007076 Bacteria 2393
144 Ga0075435_100349766 3300007076 Bacteria 1267
145 Ga0075435_100392426 3300007076 Bacteria 1193
146 Ga0105240_10544534 3300009093 Bacteria 1285
147 Ga0111539_10004903 3300009094 Bacteria 17422
148 Ga0111539_10028884 3300009094 Bacteria 6762
149 Ga0111539_10050158 3300009094 Bacteria 4972
150 Ga0111539_10081056 3300009094 Bacteria 3817
151 Ga0111539_10091352 3300009094 Bacteria 3577
152 Ga0111539_11162642 3300009094 Bacteria 896
153 Ga0111539_11460246 3300009094 Bacteria 793
154 Ga0105245_10084399 3300009098 Bacteria 2910
155 Ga0105245_10564383 3300009098 Bacteria 1161
156 Ga0114129_10001650 3300009147 Bacteria 30339
157 Ga0114129_10005421 3300009147 Bacteria 18016
158 Ga0114129_10024000 3300009147 Bacteria 8643
159 Ga0114129_10026269 3300009147 Bacteria 8247
160 Ga0114129_10041322 3300009147 Bacteria 6499
161 Ga0114129_10044215 3300009147 Bacteria 6265
162 Ga0114129_10060403 3300009147 Bacteria 5300
163 Ga0114129_10100985 3300009147 Bacteria 3992
164 Ga0114129_10561693 3300009147 Bacteria 1483
165 Ga0105243_10122268 3300009148 Unclassified 2196
166 Ga0105243_10197723 3300009148 Bacteria 1761
167 Ga0105243_10891593 3300009148 Bacteria 884
168 Ga0105242_10009659 3300009176 Bacteria 7393
169 Ga0105242_10019016 3300009176 Bacteria 5381
170 Ga0105242_10117283 3300009176 Bacteria 2279
171 Ga0105248_10033567 3300009177 Bacteria 5733
172 Ga0105248_10046875 3300009177 Bacteria 4846
173 Ga0105248_10054654 3300009177 Bacteria 4478
174 Ga0105248_10199127 3300009177 Bacteria 2256
175 Ga0105248_10355806 3300009177 Bacteria 1649
176 Ga0105237_10306172 3300009545 Bacteria 1592
177 Ga0105238_10082325 3300009551 Bacteria 3208
178 Ga0105238_10171711 3300009551 Bacteria 2144
179 Ga0105238_10605780 3300009551 Bacteria 1103
180 Ga0105238_11172990 3300009551 Bacteria 792
181 Ga0105249_10227086 3300009553 Bacteria 1840
182 Ga0105249_10287830 3300009553 Bacteria 1643
183 Ga0105239_10123529 3300010375 Bacteria 2876
184 Ga0105246_10063844 3300011119 Unclassified 2570
185 Ga0157374_10035182 3300013296 Bacteria 4581
186 Ga0157378_10164923 3300013297 Bacteria 2075
187 Ga0163162_10341835 3300013306 Unclassified 1629
188 Ga0163162_10685312 3300013306 Bacteria 1147
189 Ga0157375_10199142 3300013308 Bacteria 2158
190 Ga0157375_10494172 3300013308 Bacteria 1388
191 Ga0163163_10677276 3300014325 Bacteria 1095
192 Ga0157380_10037155 3300014326 Bacteria 3772
193 Ga0157380_10102175 3300014326 Bacteria 2390
194 Ga0157380_10767371 3300014326 Bacteria 978
195 Ga0157377_10214658 3300014745 Bacteria 1229
196 Ga0157377_10358942 3300014745 Bacteria 980
197 Ga0157379_10018728 3300014968 Bacteria 6105
198 Ga0157379_10366853 3300014968 Bacteria 1320
199 Ga0157376_10143585 3300014969 Bacteria 2144
200 Ga0157376_10235123 3300014969 Bacteria 1704
201 Ga0182007_10042007 3300015262 Bacteria 1523
202 Ga0163161_10430561 3300017792 Bacteria 1063
203 Ga0213876_10167784 3300021384 Bacteria 1168
204 Ga0207697_10017721 3300025315 Bacteria 2926
205 Ga0207697_10191693 3300025315 Bacteria 898
206 Ga0207656_10118144 3300025321 Bacteria 1232
207 Ga0207682_10272335 3300025893 Bacteria 791
208 Ga0207642_10014727 3300025899 Bacteria 2895
209 Ga0207710_10007160 3300025900 Bacteria 4732
210 Ga0207688_10117995 3300025901 Bacteria 1546
211 Ga0207685_10072538 3300025905 Bacteria 1400
212 Ga0207699_10219042 3300025906 Bacteria 1298
213 Ga0207645_10005233 3300025907 Bacteria 9455
214 Ga0207645_10007416 3300025907 Bacteria 7751
215 Ga0207705_10328240 3300025909 Bacteria 1176
216 Ga0207684_10316553 3300025910 Bacteria 1345
217 Ga0207654_10380803 3300025911 Bacteria 977
218 Ga0207695_10120687 3300025913 Bacteria 2590
219 Ga0207662_10027406 3300025918 Bacteria 3288
220 Ga0207662_10079939 3300025918 Bacteria 1993
221 Ga0207662_10117283 3300025918 Bacteria 1666
222 Ga0207662_10244425 3300025918 Bacteria 1176
223 Ga0207662_10295671 3300025918 Bacteria 1075
224 Ga0207662_10385230 3300025918 Unclassified 948
225 Ga0207657_10009107 3300025919 Bacteria 10014
226 Ga0207657_10159392 3300025919 Bacteria 1833
227 Ga0207652_10079352 3300025921 Bacteria 2867
228 Ga0207646_10142582 3300025922 Bacteria 2158
229 Ga0207681_10013424 3300025923 Bacteria 5071
230 Ga0207681_10093297 3300025923 Bacteria 2154
231 Ga0207681_10109379 3300025923 Bacteria 2008
232 Ga0207681_10187926 3300025923 Bacteria 1578
233 Ga0207681_10545008 3300025923 Bacteria 954
234 Ga0207681_10633965 3300025923 Bacteria 885
235 Ga0207694_10225625 3300025924 Bacteria 1529
236 Ga0207694_10678418 3300025924 Bacteria 869
237 Ga0207650_10075760 3300025925 Bacteria 2540
238 Ga0207650_10213643 3300025925 Bacteria 1550
239 Ga0207650_10635949 3300025925 Bacteria 899
240 Ga0207659_10000495 3300025926 Bacteria 23739
241 Ga0207659_10127157 3300025926 Bacteria 1962
242 Ga0207659_10259180 3300025926 Bacteria 1414
243 Ga0207700_10076404 3300025928 Bacteria 2599
244 Ga0207664_10156906 3300025929 Bacteria 1938
245 Ga0207644_10032177 3300025931 Bacteria 3657
246 Ga0207644_10315345 3300025931 Bacteria 1263
247 Ga0207644_10659022 3300025931 Bacteria 871
248 Ga0207706_10086783 3300025933 Bacteria 2751
249 Ga0207706_10120080 3300025933 Bacteria 2311
250 Ga0207686_10136152 3300025934 Bacteria 1691
251 Ga0207709_10020844 3300025935 Bacteria 3703
252 Ga0207709_10141356 3300025935 Unclassified 1655
253 Ga0207709_10333021 3300025935 Bacteria 1140
254 Ga0207670_10029732 3300025936 Bacteria 3483
255 Ga0207670_10039527 3300025936 Bacteria 3090
256 Ga0207669_10178949 3300025937 Bacteria 1518
257 Ga0207704_10135998 3300025938 Bacteria 1711
258 Ga0207665_10026989 3300025939 Bacteria 3793
259 Ga0207691_10061362 3300025940 Bacteria 3415
260 Ga0207691_10086277 3300025940 Unclassified 2816
261 Ga0207711_10056870 3300025941 Bacteria 3362
262 Ga0207711_10057510 3300025941 Bacteria 3343
263 Ga0207711_10156931 3300025941 Bacteria 2057
264 Ga0207711_10366353 3300025941 Bacteria 1336
265 Ga0207689_10030921 3300025942 Bacteria 4460
266 Ga0207689_10063151 3300025942 Bacteria 3046
267 Ga0207689_10315983 3300025942 Bacteria 1296
268 Ga0207651_10133364 3300025960 Bacteria 1905
269 Ga0207712_10754418 3300025961 Bacteria 853
270 Ga0207668_10143994 3300025972 Bacteria 1836
271 Ga0207668_10983374 3300025972 Bacteria 754
272 Ga0207640_10097692 3300025981 Bacteria 2051
273 Ga0207640_10488588 3300025981 Bacteria 1023
274 Ga0207658_10038138 3300025986 Bacteria 3459
275 Ga0207658_11171677 3300025986 Bacteria 702
276 Ga0207677_10026629 3300026023 Bacteria 3631
277 Ga0207677_10170566 3300026023 Bacteria 1701
278 Ga0207703_10194796 3300026035 Bacteria 1797
279 Ga0207703_10272324 3300026035 Bacteria 1534
280 Ga0207703_10293195 3300026035 Bacteria 1481
281 Ga0207639_10569934 3300026041 Bacteria 1041
282 Ga0207678_10089276 3300026067 Bacteria 2635
283 Ga0207708_10016967 3300026075 Bacteria 5482
284 Ga0207708_10048338 3300026075 Bacteria 3238
285 Ga0207702_10591952 3300026078 Bacteria 1088
286 Ga0207641_10001068 3300026088 Bacteria 27583
287 Ga0207641_10016888 3300026088 Bacteria 5977
288 Ga0207641_10115142 3300026088 Bacteria 2390
289 Ga0207641_10159232 3300026088 Bacteria 2051
290 Ga0207648_10013498 3300026089 Bacteria 7598
291 Ga0207648_10020600 3300026089 Bacteria 5936
292 Ga0207648_10058711 3300026089 Bacteria 3355
293 Ga0207648_10125732 3300026089 Bacteria 2255
294 Ga0207676_10447392 3300026095 Bacteria 1217
295 Ga0207674_10711952 3300026116 Bacteria 969
296 Ga0207675_100001265 3300026118 Bacteria 25256
297 Ga0207675_100435452 3300026118 Bacteria 1297
298 Ga0207683_10027895 3300026121 Bacteria 4880
299 Ga0207698_10412390 3300026142 Bacteria 1294
300 Ga0207428_10035086 3300027907 Bacteria 4103
301 Ga0207428_10124401 3300027907 Bacteria 1976
302 Ga0207428_10150458 3300027907 Bacteria 1772
303 Ga0268266_10012158 3300028379 Bacteria 7448
304 Ga0268266_10054383 3300028379 Bacteria 3439
305 Ga0268265_10016745 3300028380 Bacteria 5044
306 Ga0268265_10145267 3300028380 Bacteria 1992
307 Ga0268265_10529949 3300028380 Bacteria 1115
308 Ga0268264_10381888 3300028381 Unclassified 1349
309 Ga0307408_100041306 3300031548 Bacteria 3270
310 Ga0307408_100071413 3300031548 Bacteria 2567
311 Ga0307408_100299987 3300031548 Bacteria 1345
312 Ga0307410_10270539 3300031852 Bacteria 1329
313 Ga0307407_10158204 3300031903 Bacteria 1480
314 Ga0307412_10544090 3300031911 Bacteria 974
315 Ga0307416_100820618 3300032002 Bacteria 1027
316 Ga0307416_101512795 3300032002 Bacteria 777
317 Ga0307411_10166166 3300032005 Bacteria 1659
318 Ga0373958_0044306 3300034819 Bacteria 920
319 Ga0373938_0000823 3300034957 Bacteria 5016
320 Ga0373928_0000665 3300035084 Bacteria 6756
321 Ga0373929_0002374 3300035085 Bacteria 3463
322 Ga0373929_0031744 3300035085 Bacteria 1133
323 Ga0373940_0000039 3300035088 Bacteria 14131
324 Ga0373949_0001162 3300035090 Bacteria 7856
325 Ga0373951_0002100 3300035091 Bacteria 5107
326 Ga0373952_0000679 3300035092 Bacteria 6038
327 Ga0373932_0000279 3300035112 Bacteria 15366
328 Ga0373939_0000940 3300035114 Bacteria 7249
329 Ga0373960_0001226 3300035121 Bacteria 5615
330 Ga0373942_0000750 3300035207 Bacteria 8943
331 Ga0373961_0002991 3300035241 Bacteria 4263
332 Ga0373924_0021623 3300035410 Bacteria 2510
333 Ga0373931_0001453 3300035691 Bacteria 10179
334 Ga0373937_0159982 3300036401 Bacteria 2111
335 Ga0373937_0686524 3300036401 Bacteria 970
336 Ga0373925_0128760 3300037068 Bacteria 1972
337 Ga0436365_1120631 3300039437 Bacteria 2939
338 Ga0439436_0041259 3300041404 Bacteria 1321
339 Ga0439461_0049381 3300041410 Bacteria 930
340 Ga0439433_0006026 3300041999 Bacteria 2606
341 Ga0439446_0025214 3300042156 Bacteria 1699
342 Ga0451576_0002751 3300045051 Bacteria 25497
343 Ga0495594_0066613 3300046499 Bacteria 1998
344 Ga0495628_0439214 3300046516 Bacteria 949
345 Ga0495586_0030285 3300046535 Bacteria 2896
346 Ga0495586_0209911 3300046535 Bacteria 1105
347 Ga0495645_0008546 3300046543 Bacteria 7151
348 Ga0495634_0078311 3300046642 Bacteria 2166
349 Ga0495658_0197990 3300046683 Bacteria 1251
350 Ga0495676_0225454 3300047321 Bacteria 1290
351 Ga0495684_0056333 3300047471 Bacteria 2997
352 Ga0496105_0263650 3300048908 Bacteria 1393
353 Ga0496106_0254715 3300048909 Bacteria 1404
354 Ga0496108_0020799 3300048911 Bacteria 5395
355 Ga0496109_0308135 3300048912 Bacteria 1494
356 Ga0496110_0215039 3300048913 Bacteria 1748
357 Ga0496110_0269746 3300048913 Unclassified 1549
358 Ga0496112_0018904 3300048915 Bacteria 6492
359 Ga0496112_0241752 3300048915 Unclassified 1758
360 Ga0496112_0353360 3300048915 Bacteria 1412
361 Ga0496113_0105561 3300048916 Bacteria 2187
362 Ga0496114_0232208 3300048917 Bacteria 1621
363 Ga0501036_0191568 3300049572 Bacteria 1720
364 Ga0501036_0383600 3300049572 Bacteria 1173
365 Ga0501039_0071378 3300049575 Bacteria 2698
366 Ga0501040_0191454 3300049576 Bacteria 1451
367 Ga0501040_0317416 3300049576 Bacteria 1114
368 Ga0501041_0503738 3300049577 Bacteria 770
369 Ga0501042_0556452 3300049578 Bacteria 834
370 Ga0501046_0325206 3300049580 Bacteria 1120
371 Ga0501048_0048145 3300049582 Bacteria 3041
372 Ga0501048_0234518 3300049582 Bacteria 1302
373 Ga0501071_0033853 3300049587 Bacteria 3632
374 Ga0501072_0039747 3300049588 Bacteria 3693
375 Ga0501076_0010360 3300049592 Bacteria 6914
376 Ga0501076_0026436 3300049592 Bacteria 4497
377 Ga0501077_0214175 3300049593 Bacteria 1224
378 Ga0501079_0166668 3300049741 Bacteria 1718
379 Ga0501045_0011255 3300049824 Bacteria 6279
380 Ga0501045_0062380 3300049824 Bacteria 2735
381 nmdc:mga00v17_18335_c1 3300050491 Bacteria 3973
382 nmdc:mga00v17_257472_c1 3300050491 Bacteria 1132
383 nmdc:mga0yw44_22096_c1 3300050492 Bacteria 3561
384 nmdc:mga0k408_205751_c1 3300050493 Bacteria 1175
385 nmdc:mga0k408_8080_c1 3300050493 Bacteria 5640
386 nmdc:mga05p37_10221_c1 3300050507 Bacteria 11145
387 nmdc:mga05p37_112019_c1 3300050507 Bacteria 3355
388 nmdc:mga05p37_133787_c1 3300050507 Bacteria 3042
389 nmdc:mga05p37_138905_c1 3300050507 Bacteria 2978
390 nmdc:mga05p37_43495_c1 3300050507 Bacteria 5526
391 nmdc:mga05p37_45780_c1 3300050507 Bacteria 5380
392 nmdc:mga05p37_581042_c1 3300050507 Bacteria 1269
393 nmdc:mga05p37_79572_c1 3300050507 Bacteria 4036
394 nmdc:mga09592_157163_c1 3300050508 Bacteria 1963
395 nmdc:mga09592_236278_c1 3300050508 Bacteria 1583
396 nmdc:mga09592_698945_c1 3300050508 Bacteria 863
397 nmdc:mga0qj67_25181_c1 3300050509 Bacteria 4595
398 nmdc:mga0qj67_290741_c1 3300050509 Bacteria 1324
399 nmdc:mga06r32_126301_c1 3300050510 Bacteria 2527
400 nmdc:mga06r32_53236_c1 3300050510 Bacteria 3877
401 nmdc:mga08y16_11752_c1 3300050511 Bacteria 9197
402 nmdc:mga08y16_530110_c1 3300050511 Bacteria 1194
403 nmdc:mga08y16_6292_c1 3300050511 Bacteria 12450
404 nmdc:mga08y16_69543_c1 3300050511 Bacteria 3670
405 nmdc:mga0rr50_12014_c1 3300050513 Bacteria 5575
406 nmdc:mga0rr50_14271_c1 3300050513 Bacteria 5205
407 nmdc:mga0rr50_303894_c1 3300050513 Bacteria 1335
408 nmdc:mga0rr50_38547_c1 3300050513 Bacteria 1962
409 nmdc:mga08x19_555504_c1 3300050514 Bacteria 812
410 nmdc:mga08x19_63086_c1 3300050514 Bacteria 2404
411 nmdc:mga08x19_90544_c2 3300050514 Bacteria 1185
412 nmdc:mga0a205_4415_c1 3300050515 Bacteria 12621
413 nmdc:mga0a205_759010_c1 3300050515 Bacteria 818
414 nmdc:mga0a205_89486_c1 3300050515 Bacteria 2975
415 Ga0495595_0036785 3300053084 Bacteria 2223
416 Ga0495619_0322808 3300053085 Bacteria 1069
417 Ga0501084_0031707 3300054114 Bacteria 4419
418 Ga0530510_0038045 3300061734 Bacteria 3472
419 Ga0157380_10102217
420 Ga0065712_10182109
421 Ga0065712_10214803
422 Ga0065715_10040149
423 Ga0065715_10104500
424 Ga0065715_10434393
425 Ga0065707_10031302
426 Ga0070683_100157664
427 Ga0070690_100066619
428 Ga0070690_100270513
429 Ga0070677_10136746
430 Ga0070666_10017285
431 Ga0070680_100763195
432 Ga0070682_100250742
433 Ga0068868_100058030
434 Ga0070660_100003029
435 Ga0070660_100108846
436 Ga0070689_100043680
437 Ga0070689_100109796
438 Ga0070689_100216645
439 Ga0070691_10004777
440 Ga0070691_10033294
441 Ga0070692_10073416
442 Ga0070668_100132520
443 Ga0070668_100231502
444 Ga0070669_100003976
445 Ga0070669_100064920
446 Ga0070669_100246262
447 Ga0070675_100000646
448 Ga0070675_100081901
449 Ga0070675_100294424
450 Ga0070675_100346506
451 Ga0070671_100024952
452 Ga0070671_100034945
453 Ga0070674_100291316
454 Ga0070673_100109235
455 Ga0070688_100051331
456 Ga0070688_100162608
457 Ga0070667_100012313
458 Ga0070714_100014765
459 Ga0070713_100099423
460 Ga0070705_100010012
461 Ga0070700_100011240
462 Ga0070700_100036198
463 Ga0070694_100006820
464 Ga0070694_100104529
465 Ga0070708_100248962
466 Ga0070678_100059947
467 Ga0068867_100017168
468 Ga0068867_100042554
469 Ga0068867_100083507
470 Ga0068867_100098998
471 Ga0068867_100545283
472 Ga0070706_100114029
473 Ga0070706_101069943
474 Ga0070707_100099068
475 Ga0070707_100224765
476 Ga0070707_100350952
477 Ga0070707_100499019
478 Ga0070698_100099361
479 Ga0070699_100042882
480 Ga0070699_100180948
481 Ga0070679_100119391
482 Ga0070697_100447675
483 Ga0070697_100683495
484 Ga0070672_100170931
485 Ga0070686_100076447
486 Ga0070686_100088239
487 Ga0070686_100291301
488 Ga0070686_100295562
489 Ga0070686_100351370
490 Ga0070695_100002747
491 Ga0070695_100010637
492 Ga0070695_100128846
493 Ga0070696_100011794
494 Ga0070696_100028451
495 Ga0070665_100003987
496 Ga0070665_100013227
497 Ga0070704_100001732
498 Ga0070704_100007654
499 Ga0070704_100020478
500 Ga0068854_100106567
501 Ga0068854_100255346
502 Ga0070702_100075127
503 Ga0070702_100207624
504 Ga0068852_100090822
505 Ga0068859_100029841
506 Ga0068859_100056389
507 Ga0068864_100009399
508 Ga0068864_100120480
509 Ga0068864_100216253
510 Ga0068861_100011212
511 Ga0068863_100004770
512 Ga0068863_100111680
513 Ga0068863_100170297
514 Ga0068858_100027499
515 Ga0068858_100142917
516 Ga0068860_100076502
517 Ga0068860_100238222
518 Ga0068860_100312550
519 Ga0068862_100026665
520 Ga0068862_100105587
521 Ga0068862_100892092
522 Ga0081455_10042181
523 Ga0081539_10011740
524 Ga0075365_10020314
525 Ga0075365_10231678
526 Ga0075368_10016384
527 Ga0075364_10021239
528 Ga0075364_10216319
529 Ga0075364_10255967
530 Ga0070716_100246521
531 Ga0075362_10001416
532 Ga0075367_10020663
533 Ga0075366_10002439
534 Ga0075366_10226222
535 Ga0097621_100003280
536 Ga0068871_100001665
537 Ga0075428_100024046
538 Ga0075430_100025751
539 Ga0075431_100001520
540 Ga0075431_100157580
541 Ga0075433_10002028
542 Ga0075433_10161628
543 Ga0075433_10545289
544 Ga0075434_100365532
545 Ga0075434_100389435
546 Ga0075434_100642394
547 Ga0075429_100170190
548 Ga0075429_100417679
549 Ga0068865_100002139
550 Ga0068865_100107871
551 Ga0068865_100306656
552 Ga0075436_100043098
553 Ga0075436_100245625
554 Ga0075436_100364227
555 Ga0097620_100029840
556 Ga0097620_100056378
557 Ga0097620_100551063
558 Ga0075435_100000528
559 Ga0075435_100023759
560 Ga0075435_100064648
561 Ga0075435_100100722
562 Ga0075435_100349766
563 Ga0075435_100392426
564 Ga0105240_10544534
565 Ga0111539_10004903
566 Ga0111539_10028884
567 Ga0111539_10050158
568 Ga0111539_10081056
569 Ga0111539_10091352
570 Ga0111539_11162642
571 Ga0111539_11460246
572 Ga0105245_10084399
573 Ga0105245_10564383
574 Ga0114129_10001650
575 Ga0114129_10005421
576 Ga0114129_10024000
577 Ga0114129_10026269
578 Ga0114129_10041322
579 Ga0114129_10044215
580 Ga0114129_10060403
581 Ga0114129_10100985
582 Ga0114129_10561693
583 Ga0105243_10122268
584 Ga0105243_10197723
585 Ga0105243_10891593
586 Ga0105242_10009659
587 Ga0105242_10019016
588 Ga0105242_10117283
589 Ga0105248_10033567
590 Ga0105248_10046875
591 Ga0105248_10054654
592 Ga0105248_10199127
593 Ga0105248_10355806
594 Ga0105237_10306172
595 Ga0105238_10082325
596 Ga0105238_10171711
597 Ga0105238_10605780
598 Ga0105238_11172990
599 Ga0105249_10227086
600 Ga0105249_10287830
601 Ga0105239_10123529
602 Ga0105246_10063844
603 Ga0157374_10035182
604 Ga0157378_10164923
605 Ga0163162_10341835
606 Ga0163162_10685312
607 Ga0157375_10199142
608 Ga0157375_10494172
609 Ga0163163_10677276
610 Ga0157380_10037155
611 Ga0157380_10102175
612 Ga0157380_10767371
613 Ga0157377_10214658
614 Ga0157377_10358942
615 Ga0157379_10018728
616 Ga0157379_10366853
617 Ga0157376_10143585
618 Ga0157376_10235123
619 Ga0182007_10042007
620 Ga0163161_10430561
621 Ga0213876_10167784
622 Ga0207697_10017721
623 Ga0207697_10191693
624 Ga0207656_10118144
625 Ga0207682_10272335
626 Ga0207642_10014727
627 Ga0207710_10007160
628 Ga0207688_10117995
629 Ga0207685_10072538
630 Ga0207699_10219042
631 Ga0207645_10005233
632 Ga0207645_10007416
633 Ga0207705_10328240
634 Ga0207684_10316553
635 Ga0207654_10380803
636 Ga0207695_10120687
637 Ga0207662_10027406
638 Ga0207662_10079939
639 Ga0207662_10117283
640 Ga0207662_10244425
641 Ga0207662_10295671
642 Ga0207662_10385230
643 Ga0207657_10009107
644 Ga0207657_10159392
645 Ga0207652_10079352
646 Ga0207646_10142582
647 Ga0207681_10013424
648 Ga0207681_10093297
649 Ga0207681_10109379
650 Ga0207681_10187926
651 Ga0207681_10545008
652 Ga0207681_10633965
653 Ga0207694_10225625
654 Ga0207694_10678418
655 Ga0207650_10075760
656 Ga0207650_10213643
657 Ga0207650_10635949
658 Ga0207659_10000495
659 Ga0207659_10127157
660 Ga0207659_10259180
661 Ga0207700_10076404
662 Ga0207664_10156906
663 Ga0207644_10032177
664 Ga0207644_10315345
665 Ga0207644_10659022
666 Ga0207706_10086783
667 Ga0207706_10120080
668 Ga0207686_10136152
669 Ga0207709_10020844
670 Ga0207709_10141356
671 Ga0207709_10333021
672 Ga0207670_10029732
673 Ga0207670_10039527
674 Ga0207669_10178949
675 Ga0207704_10135998
676 Ga0207665_10026989
677 Ga0207691_10061362
678 Ga0207691_10086277
679 Ga0207711_10056870
680 Ga0207711_10057510
681 Ga0207711_10156931
682 Ga0207711_10366353
683 Ga0207689_10030921
684 Ga0207689_10063151
685 Ga0207689_10315983
686 Ga0207651_10133364
687 Ga0207712_10754418
688 Ga0207668_10143994
689 Ga0207668_10983374
690 Ga0207640_10097692
691 Ga0207640_10488588
692 Ga0207658_10038138
693 Ga0207658_11171677
694 Ga0207677_10026629
695 Ga0207677_10170566
696 Ga0207703_10194796
697 Ga0207703_10272324
698 Ga0207703_10293195
699 Ga0207639_10569934
700 Ga0207678_10089276
701 Ga0207708_10016967
702 Ga0207708_10048338
703 Ga0207702_10591952
704 Ga0207641_10001068
705 Ga0207641_10016888
706 Ga0207641_10115142
707 Ga0207641_10159232
708 Ga0207648_10013498
709 Ga0207648_10020600
710 Ga0207648_10058711
711 Ga0207648_10125732
712 Ga0207676_10447392
713 Ga0207674_10711952
714 Ga0207675_100001265
715 Ga0207675_100435452
716 Ga0207683_10027895
717 Ga0207698_10412390
718 Ga0207428_10035086
719 Ga0207428_10124401
720 Ga0207428_10150458
721 Ga0268266_10012158
722 Ga0268266_10054383
723 Ga0268265_10016745
724 Ga0268265_10145267
725 Ga0268265_10529949
726 Ga0268264_10381888
727 Ga0307408_100041306
728 Ga0307408_100071413
729 Ga0307408_100299987
730 Ga0307410_10270539
731 Ga0307407_10158204
732 Ga0307412_10544090
733 Ga0307416_100820618
734 Ga0307416_101512795
735 Ga0307411_10166166
736 Ga0373958_0044306
737 Ga0373938_0000823
738 Ga0373928_0000665
739 Ga0373929_0002374
740 Ga0373929_0031744
741 Ga0373940_0000039
742 Ga0373949_0001162
743 Ga0373951_0002100
744 Ga0373952_0000679
745 Ga0373932_0000279
746 Ga0373939_0000940
747 Ga0373960_0001226
748 Ga0373942_0000750
749 Ga0373961_0002991
750 Ga0373924_0021623
751 Ga0373931_0001453
752 Ga0373937_0159982
753 Ga0373937_0686524
754 Ga0373925_0128760
755 Ga0436365_1120631
756 Ga0439436_0041259
757 Ga0439461_0049381
758 Ga0439433_0006026
759 Ga0439446_0025214
760 Ga0451576_0002751
761 Ga0495594_0066613
762 Ga0495628_0439214
763 Ga0495586_0030285
764 Ga0495586_0209911
765 Ga0495645_0008546
766 Ga0495634_0078311
767 Ga0495658_0197990
768 Ga0495676_0225454
769 Ga0495684_0056333
770 Ga0496105_0263650
771 Ga0496106_0254715
772 Ga0496108_0020799
773 Ga0496109_0308135
774 Ga0496110_0215039
775 Ga0496110_0269746
776 Ga0496112_0018904
777 Ga0496112_0241752
778 Ga0496112_0353360
779 Ga0496113_0105561
780 Ga0496114_0232208
781 Ga0501036_0191568
782 Ga0501036_0383600
783 Ga0501039_0071378
784 Ga0501040_0191454
785 Ga0501040_0317416
786 Ga0501041_0503738
787 Ga0501042_0556452
788 Ga0501046_0325206
789 Ga0501048_0048145
790 Ga0501048_0234518
791 Ga0501071_0033853
792 Ga0501072_0039747
793 Ga0501076_0010360
794 Ga0501076_0026436
795 Ga0501077_0214175
796 Ga0501079_0166668
797 Ga0501045_0011255
798 Ga0501045_0062380
799 nmdc:mga00v17_18335_c1
800 nmdc:mga00v17_257472_c1
801 nmdc:mga0yw44_22096_c1
802 nmdc:mga0k408_205751_c1
803 nmdc:mga0k408_8080_c1
804 nmdc:mga05p37_10221_c1
805 nmdc:mga05p37_112019_c1
806 nmdc:mga05p37_133787_c1
807 nmdc:mga05p37_138905_c1
808 nmdc:mga05p37_43495_c1
809 nmdc:mga05p37_45780_c1
810 nmdc:mga05p37_581042_c1
811 nmdc:mga05p37_79572_c1
812 nmdc:mga09592_157163_c1
813 nmdc:mga09592_236278_c1
814 nmdc:mga09592_698945_c1
815 nmdc:mga0qj67_25181_c1
816 nmdc:mga0qj67_290741_c1
817 nmdc:mga06r32_126301_c1
818 nmdc:mga06r32_53236_c1
819 nmdc:mga08y16_11752_c1
820 nmdc:mga08y16_530110_c1
821 nmdc:mga08y16_6292_c1
822 nmdc:mga08y16_69543_c1
823 nmdc:mga0rr50_12014_c1
824 nmdc:mga0rr50_14271_c1
825 nmdc:mga0rr50_303894_c1
826 nmdc:mga0rr50_38547_c1
827 nmdc:mga08x19_555504_c1
828 nmdc:mga08x19_63086_c1
829 nmdc:mga08x19_90544_c2
830 nmdc:mga0a205_4415_c1
831 nmdc:mga0a205_759010_c1
832 nmdc:mga0a205_89486_c1
833 Ga0495595_0036785
834 Ga0495619_0322808
835 Ga0501084_0031707
836 Ga0530510_0038045

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13709

DUF4159

Domain of unknown function (DUF4159)

35

232

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4i66-assembly1.cif.gz_A-2 crystal structure of hoch_4089 protein from haliangium ochraceum 0.8309 17 217
4i66-assembly1.cif.gz_A-2 crystal structure of hoch_4089 protein from haliangium ochraceum 0.8192 17 217
3wiv-assembly1.cif.gz_A crystal structure of pro-s324a/d356a 0.6619 68 102
7b04-assembly6.cif.gz_Q structure of nitrite oxidoreductase (nxr) from the anammox bacterium kuenenia stuttgartiensis. 0.6529 60 103
1m03-assembly1.cif.gz_A mutant streptomyces plicatus beta-hexosaminidase (d313a) in complex with product (glcnac) 0.6238 71 101
ID Description Score Start End Superfamily
4i66A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Domain of unknown function DUF4159 0.7955 17 217 3.40.50.12140
4i66A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Domain of unknown function DUF4159 0.7844 17 217 3.40.50.12140
af_Q55CF8_39_214_3.30.870.10 Alpha Beta;2-Layer Sandwich;Endonuclease; Chain A;Endonuclease Chain A 0.6919 82 106 3.30.870.10
af_Q76NM2_26_240_3.40.50.410 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain 0.6755 70 103 3.40.50.410
af_Q8RUW5_16_433_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.6679 85 185 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A6J4JE82-F1-model_v4 DUF4159 domain-containing protein 0.9352 16 189
AF-A0A519TG34-F1-model_v4 DUF4159 domain-containing protein 0.9349 16 146
AF-A0A7X4E1H4-F1-model_v4 DUF4159 domain-containing protein 0.9309 31 219
AF-A0A7X4E1H4-F1-model_v4 DUF4159 domain-containing protein 0.9261 31 219
AF-A0A4P8RGC5-F1-model_v4 Twin-arginine translocation pathway signal 0.9253 16 219

Map