F439301

General Info

Members Datasets Scaffolds Average Seq Length
418 215 836 115

Family's Representative Sequence

Representative Sequence 3300010375|Ga0105239_10916456|Ga0105239_109164562
Length 137
Sequence VKIGEQPSFPHFSANFDIHFERMNQSTITIDVVLDNDKVPEQINWRASDSTADTAQKSRAMMLSFWDSADKTAMRIDLWTKDMMVDEMADFFYQTYMTMADTFNRATRNAELVNDMKEFAKDFYKKFRDQQLAENKA

Samples

Sample ID Description Type Environment
1 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
50 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
51 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
68 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
82 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
129 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
130 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
131 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
132 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
133 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
134 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
135 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
136 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
137 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
138 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
139 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
140 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
141 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
142 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
143 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
144 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
145 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
146 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
147 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
148 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
149 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
150 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
151 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
152 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
153 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
154 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
155 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
156 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
157 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
158 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
159 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
160 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
161 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
162 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
163 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
164 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
165 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
166 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
167 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
168 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
169 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
179 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
180 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
181 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
182 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
183 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
184 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
185 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
186 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
187 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
190 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
191 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
192 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
193 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
194 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
195 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
196 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
197 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
198 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
199 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
200 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
201 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
202 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
203 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
204 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
205 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
206 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
207 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
208 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
209 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
210 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
211 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
212 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
213 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
214 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
215 2738541278 Niastella sp. CF465 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.76
Metatranscriptomes 0
Isolates 0.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.42
Nodule 0
Rhizoplane 1.91
Rhizosphere 87.08
Stem 0
Stem Tuber 0
Unclassified 18.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105239_10916456 3300010375 Bacteria 1006
2 rootH2_10054043 3300003320 Bacteria 2186
3 rootH2_10162556 3300003320 Bacteria 2021
4 rootL2_10011714 3300003322 Bacteria 7320
5 Ga0070658_10237869 3300005327 Unclassified 1543
6 Ga0070676_10551085 3300005328 Bacteria 825
7 Ga0070683_100061333 3300005329 Unclassified 3497
8 Ga0070683_100091702 3300005329 Unclassified 2853
9 Ga0070683_100848828 3300005329 Bacteria 876
10 Ga0070670_100018095 3300005331 Bacteria 6049
11 Ga0070670_100034177 3300005331 Unclassified 4376
12 Ga0070670_100105804 3300005331 Bacteria 2424
13 Ga0070670_100265437 3300005331 Bacteria 1497
14 Ga0068869_101561452 3300005334 Bacteria 587
15 Ga0070666_10184484 3300005335 Unclassified 1464
16 Ga0070682_101463947 3300005337 Unclassified 586
17 Ga0068868_100006802 3300005338 Bacteria 8119
18 Ga0068868_100096153 3300005338 Unclassified 2392
19 Ga0068868_100196670 3300005338 Bacteria 1679
20 Ga0070660_100254501 3300005339 Unclassified 1433
21 Ga0070660_100448400 3300005339 Bacteria 1070
22 Ga0070660_101267920 3300005339 Bacteria 625
23 Ga0070660_101440073 3300005339 Bacteria 585
24 Ga0070689_102217670 3300005340 Bacteria 503
25 Ga0070691_10016281 3300005341 Unclassified 3416
26 Ga0070661_100110501 3300005344 Bacteria 2052
27 Ga0070661_100130071 3300005344 Unclassified 1890
28 Ga0070661_100323257 3300005344 Bacteria 1205
29 Ga0070668_100074427 3300005347 Unclassified 2649
30 Ga0070669_101251996 3300005353 Bacteria 642
31 Ga0070675_100093896 3300005354 Bacteria 2516
32 Ga0070675_100496106 3300005354 Unclassified 1100
33 Ga0070671_100027643 3300005355 Bacteria 4671
34 Ga0070671_100320559 3300005355 Bacteria 1321
35 Ga0070674_100009791 3300005356 Bacteria 5762
36 Ga0070674_100309001 3300005356 Unclassified 1263
37 Ga0070673_100085692 3300005364 Bacteria 2565
38 Ga0070673_100168198 3300005364 Unclassified 1870
39 Ga0070673_100364019 3300005364 Bacteria 1286
40 Ga0070673_102166455 3300005364 Bacteria 528
41 Ga0070659_100007387 3300005366 Bacteria 7983
42 Ga0070659_101135716 3300005366 Bacteria 689
43 Ga0070667_100005421 3300005367 Bacteria 10659
44 Ga0070667_101075207 3300005367 Unclassified 752
45 Ga0070667_101957450 3300005367 Bacteria 552
46 Ga0070678_100327467 3300005456 Unclassified 1310
47 Ga0070678_100354077 3300005456 Bacteria 1263
48 Ga0070681_10414979 3300005458 Unclassified 1258
49 Ga0068867_100673897 3300005459 Bacteria 910
50 Ga0068867_100736051 3300005459 Unclassified 873
51 Ga0070685_10347723 3300005466 Bacteria 1013
52 Ga0070698_100176872 3300005471 Bacteria 2073
53 Ga0070684_100025672 3300005535 Bacteria 4956
54 Ga0070684_100038020 3300005535 Bacteria 4132
55 Ga0070684_101775044 3300005535 Unclassified 582
56 Ga0068853_100079204 3300005539 Bacteria 2873
57 Ga0068853_100362238 3300005539 Bacteria 1351
58 Ga0068853_100431589 3300005539 Bacteria 1237
59 Ga0068853_101809620 3300005539 Bacteria 592
60 Ga0070672_100298465 3300005543 Unclassified 1365
61 Ga0070672_100576475 3300005543 Unclassified 979
62 Ga0070672_101005453 3300005543 Unclassified 739
63 Ga0070686_100332643 3300005544 Bacteria 1136
64 Ga0070665_100547651 3300005548 Bacteria 1169
65 Ga0070665_100753836 3300005548 Bacteria 986
66 Ga0070665_101004988 3300005548 Bacteria 846
67 Ga0068855_100007632 3300005563 Bacteria 13082
68 Ga0068855_100150344 3300005563 Bacteria 2648
69 Ga0068855_100273402 3300005563 Bacteria 1878
70 Ga0068855_100282355 3300005563 Bacteria 1843
71 Ga0068855_100388946 3300005563 Bacteria 1530
72 Ga0070664_100004753 3300005564 Bacteria 10893
73 Ga0068857_100003287 3300005577 Bacteria 13434
74 Ga0068857_100061056 3300005577 Bacteria 3349
75 Ga0068857_102245781 3300005577 Bacteria 536
76 Ga0068854_100099309 3300005578 Bacteria 2180
77 Ga0068854_100168012 3300005578 Bacteria 1704
78 Ga0068856_100010180 3300005614 Bacteria 9141
79 Ga0068856_100125476 3300005614 Bacteria 2570
80 Ga0068856_100541877 3300005614 Bacteria 1185
81 Ga0070702_101103889 3300005615 Unclassified 634
82 Ga0068852_100003106 3300005616 Bacteria 11561
83 Ga0068852_100070772 3300005616 Bacteria 3061
84 Ga0068852_100104879 3300005616 Bacteria 2560
85 Ga0068852_100349934 3300005616 Unclassified 1442
86 Ga0068852_100402929 3300005616 Bacteria 1346
87 Ga0068852_101069858 3300005616 Bacteria 826
88 Ga0068852_101673011 3300005616 Bacteria 659
89 Ga0068859_100056651 3300005617 Bacteria 3946
90 Ga0068859_100404398 3300005617 Bacteria 1461
91 Ga0068859_100435052 3300005617 Bacteria 1408
92 Ga0068864_100200521 3300005618 Bacteria 1833
93 Ga0068864_100280544 3300005618 Bacteria 1555
94 Ga0068864_101018327 3300005618 Bacteria 822
95 Ga0068864_101887808 3300005618 Bacteria 603
96 Ga0068861_100254433 3300005719 Bacteria 1500
97 Ga0068861_101385781 3300005719 Bacteria 686
98 Ga0068851_10157382 3300005834 Bacteria 1246
99 Ga0068851_10225853 3300005834 Bacteria 1054
100 Ga0068851_10271856 3300005834 Bacteria 967
101 Ga0068851_10429988 3300005834 Bacteria 781
102 Ga0068870_10450600 3300005840 Bacteria 848
103 Ga0068863_100084722 3300005841 Bacteria 3004
104 Ga0068863_100326132 3300005841 Bacteria 1492
105 Ga0068863_100329104 3300005841 Bacteria 1485
106 Ga0068863_100533881 3300005841 Bacteria 1157
107 Ga0068860_100001513 3300005843 Bacteria 25039
108 Ga0068860_100005172 3300005843 Bacteria 13262
109 Ga0068860_100259847 3300005843 Unclassified 1692
110 Ga0068860_100374219 3300005843 Unclassified 1405
111 Ga0068862_100512332 3300005844 Bacteria 1140
112 Ga0068862_100642491 3300005844 Unclassified 1023
113 Ga0068862_102272411 3300005844 Unclassified 554
114 Ga0070715_10674969 3300006163 Bacteria 614
115 Ga0070716_101535186 3300006173 Unclassified 545
116 Ga0075366_10041791 3300006195 Bacteria 2714
117 Ga0075366_10111475 3300006195 Bacteria 1646
118 Ga0075366_10123985 3300006195 Bacteria 1558
119 Ga0097621_100000710 3300006237 Bacteria 23372
120 Ga0097621_100387088 3300006237 Bacteria 1250
121 Ga0097621_100528273 3300006237 Bacteria 1072
122 Ga0075370_10418050 3300006353 Bacteria 805
123 Ga0068871_100000044 3300006358 Bacteria 67105
124 Ga0068871_100259036 3300006358 Bacteria 1517
125 Ga0068871_100269662 3300006358 Bacteria 1487
126 Ga0068865_100176273 3300006881 Unclassified 1643
127 Ga0068865_100335529 3300006881 Bacteria 1220
128 Ga0097620_100056649 3300006931 Bacteria 3946
129 Ga0097620_100404453 3300006931 Bacteria 1461
130 Ga0097620_100435048 3300006931 Bacteria 1408
131 Ga0105240_10000800 3300009093 Bacteria 56989
132 Ga0105240_10001677 3300009093 Bacteria 37580
133 Ga0105240_10024009 3300009093 Bacteria 8053
134 Ga0105240_10078823 3300009093 Bacteria 4055
135 Ga0105240_10148981 3300009093 Bacteria 2789
136 Ga0105240_10163707 3300009093 Bacteria 2640
137 Ga0105240_10792535 3300009093 Bacteria 1027
138 Ga0105240_11399056 3300009093 Unclassified 735
139 Ga0111539_10756876 3300009094 Bacteria 1131
140 Ga0114129_10011078 3300009147 Bacteria 12846
141 Ga0105241_10001809 3300009174 Bacteria 16223
142 Ga0105241_10157791 3300009174 Bacteria 1862
143 Ga0105241_10192480 3300009174 Bacteria 1699
144 Ga0105241_10435508 3300009174 Unclassified 1157
145 Ga0105242_10051933 3300009176 Bacteria 3343
146 Ga0105242_10090338 3300009176 Bacteria 2576
147 Ga0105242_11259415 3300009176 Unclassified 761
148 Ga0105242_13306745 3300009176 Bacteria 501
149 Ga0105248_10045826 3300009177 Bacteria 4902
150 Ga0105248_12681388 3300009177 Bacteria 568
151 Ga0105237_10007421 3300009545 Bacteria 12004
152 Ga0105237_10013737 3300009545 Bacteria 8481
153 Ga0105237_10030381 3300009545 Bacteria 5488
154 Ga0105237_10044557 3300009545 Bacteria 4468
155 Ga0105237_10641282 3300009545 Bacteria 1069
156 Ga0105237_11023265 3300009545 Bacteria 833
157 Ga0105238_10000592 3300009551 Bacteria 38095
158 Ga0105238_10244747 3300009551 Bacteria 1771
159 Ga0105249_10567706 3300009553 Bacteria 1187
160 Ga0105249_10844410 3300009553 Bacteria 981
161 Ga0105239_10000992 3300010375 Bacteria 39769
162 Ga0105239_10014948 3300010375 Bacteria 8603
163 Ga0105239_10016055 3300010375 Bacteria 8287
164 Ga0105239_10076740 3300010375 Unclassified 3676
165 Ga0105239_12072669 3300010375 Unclassified 661
166 Ga0105246_10483677 3300011119 Bacteria 1048
167 Ga0105246_10963406 3300011119 Bacteria 770
168 Ga0157373_10536014 3300013100 Bacteria 848
169 Ga0157373_10752975 3300013100 Bacteria 716
170 Ga0157373_11401999 3300013100 Bacteria 531
171 Ga0157371_10012205 3300013102 Bacteria 6577
172 Ga0157371_10046499 3300013102 Bacteria 3087
173 Ga0157371_10155229 3300013102 Bacteria 1633
174 Ga0157371_10751291 3300013102 Bacteria 732
175 Ga0157370_10007122 3300013104 Bacteria 12201
176 Ga0157370_10363111 3300013104 Bacteria 1334
177 Ga0157370_10676775 3300013104 Bacteria 942
178 Ga0157369_10041671 3300013105 Bacteria 5011
179 Ga0157369_10098698 3300013105 Bacteria 3113
180 Ga0157369_10120236 3300013105 Unclassified 2787
181 Ga0157369_10173372 3300013105 Bacteria 2272
182 Ga0157369_11772752 3300013105 Bacteria 627
183 Ga0157374_10655238 3300013296 Bacteria 1062
184 Ga0157378_10021088 3300013297 Bacteria 5732
185 Ga0157378_10037120 3300013297 Bacteria 4315
186 Ga0157378_10250684 3300013297 Bacteria 1695
187 Ga0157378_10664017 3300013297 Bacteria 1059
188 Ga0157378_10863970 3300013297 Bacteria 933
189 Ga0157378_10988553 3300013297 Bacteria 875
190 Ga0163162_10000154 3300013306 Bacteria 63581
191 Ga0163162_12045124 3300013306 Unclassified 657
192 Ga0157372_10002332 3300013307 Bacteria 20561
193 Ga0157372_10003396 3300013307 Bacteria 17186
194 Ga0157372_10171958 3300013307 Bacteria 2507
195 Ga0157372_10177457 3300013307 Unclassified 2466
196 Ga0157372_10314014 3300013307 Bacteria 1824
197 Ga0157372_10331885 3300013307 Bacteria 1771
198 Ga0157372_10491661 3300013307 Unclassified 1431
199 Ga0157372_10660719 3300013307 Unclassified 1217
200 Ga0157372_11074529 3300013307 Unclassified 931
201 Ga0157375_10000850 3300013308 Bacteria 26585
202 Ga0157375_10306792 3300013308 Bacteria 1751
203 Ga0157375_13064124 3300013308 Bacteria 558
204 Ga0163163_10169497 3300014325 Bacteria 2229
205 Ga0163163_10309195 3300014325 Bacteria 1633
206 Ga0157377_10721647 3300014745 Bacteria 726
207 Ga0157379_10445187 3300014968 Bacteria 1195
208 Ga0157376_10002615 3300014969 Bacteria 12238
209 Ga0163161_10127346 3300017792 Unclassified 1918
210 Ga0207426_1000104 3300025302 Bacteria 249464
211 Ga0207697_10090915 3300025315 Bacteria 1293
212 Ga0207656_10090875 3300025321 Bacteria 1385
213 Ga0207656_10176200 3300025321 Bacteria 1024
214 Ga0207682_10052170 3300025893 Bacteria 1695
215 Ga0207647_10000636 3300025904 Bacteria 27349
216 Ga0207647_10011588 3300025904 Bacteria 6175
217 Ga0207684_11210533 3300025910 Bacteria 625
218 Ga0207654_10000945 3300025911 Bacteria 15957
219 Ga0207654_10104804 3300025911 Bacteria 1749
220 Ga0207654_10189214 3300025911 Bacteria 1348
221 Ga0207654_10379105 3300025911 Unclassified 979
222 Ga0207707_10818664 3300025912 Bacteria 775
223 Ga0207695_10004265 3300025913 Bacteria 19632
224 Ga0207695_10140366 3300025913 Bacteria 2365
225 Ga0207695_10229311 3300025913 Bacteria 1762
226 Ga0207671_10006174 3300025914 Bacteria 10765
227 Ga0207671_10006450 3300025914 Bacteria 10444
228 Ga0207671_10012497 3300025914 Bacteria 6820
229 Ga0207657_10467440 3300025919 Unclassified 989
230 Ga0207657_10576844 3300025919 Unclassified 878
231 Ga0207649_10070227 3300025920 Unclassified 2233
232 Ga0207649_10215798 3300025920 Bacteria 1364
233 Ga0207681_10294267 3300025923 Bacteria 1283
234 Ga0207694_10011375 3300025924 Bacteria 6717
235 Ga0207694_10129699 3300025924 Bacteria 2020
236 Ga0207694_11409537 3300025924 Bacteria 589
237 Ga0207650_10045601 3300025925 Bacteria 3225
238 Ga0207650_10059698 3300025925 Unclassified 2844
239 Ga0207650_10101602 3300025925 Bacteria 2214
240 Ga0207650_10343220 3300025925 Bacteria 1227
241 Ga0207659_10112663 3300025926 Unclassified 2071
242 Ga0207659_10480144 3300025926 Bacteria 1050
243 Ga0207644_10001410 3300025931 Bacteria 15486
244 Ga0207644_10200916 3300025931 Unclassified 1572
245 Ga0207644_11853375 3300025931 Bacteria 504
246 Ga0207690_10064440 3300025932 Bacteria 2502
247 Ga0207690_11236458 3300025932 Unclassified 624
248 Ga0207686_10426356 3300025934 Bacteria 1016
249 Ga0207686_10469334 3300025934 Unclassified 971
250 Ga0207669_10079912 3300025937 Bacteria 2089
251 Ga0207669_10489396 3300025937 Unclassified 982
252 Ga0207704_10027744 3300025938 Bacteria 3130
253 Ga0207691_10046685 3300025940 Bacteria 3978
254 Ga0207691_10196408 3300025940 Unclassified 1758
255 Ga0207711_11398257 3300025941 Unclassified 642
256 Ga0207689_10012780 3300025942 Bacteria 7173
257 Ga0207661_10095786 3300025944 Bacteria 2482
258 Ga0207661_10915187 3300025944 Unclassified 808
259 Ga0207679_10020334 3300025945 Bacteria 4479
260 Ga0207679_11105357 3300025945 Bacteria 727
261 Ga0207667_10000098 3300025949 Bacteria 140051
262 Ga0207667_10124769 3300025949 Bacteria 2652
263 Ga0207667_10139201 3300025949 Bacteria 2499
264 Ga0207651_10678968 3300025960 Unclassified 906
265 Ga0207651_11395930 3300025960 Bacteria 630
266 Ga0207712_10124381 3300025961 Bacteria 1956
267 Ga0207668_10078181 3300025972 Unclassified 2388
268 Ga0207640_10133722 3300025981 Bacteria 1797
269 Ga0207640_11309293 3300025981 Bacteria 647
270 Ga0207640_11437257 3300025981 Bacteria 618
271 Ga0207640_11806209 3300025981 Bacteria 553
272 Ga0207658_10012330 3300025986 Bacteria 5835
273 Ga0207658_10216927 3300025986 Bacteria 1607
274 Ga0207658_11131922 3300025986 Unclassified 715
275 Ga0207677_10005458 3300026023 Bacteria 6903
276 Ga0207677_10056150 3300026023 Unclassified 2696
277 Ga0207677_10601889 3300026023 Bacteria 965
278 Ga0207677_10797464 3300026023 Bacteria 845
279 Ga0207703_10329927 3300026035 Bacteria 1399
280 Ga0207639_10113638 3300026041 Bacteria 2212
281 Ga0207639_10281097 3300026041 Bacteria 1464
282 Ga0207678_10662494 3300026067 Bacteria 917
283 Ga0207702_10019965 3300026078 Bacteria 5550
284 Ga0207702_10621643 3300026078 Bacteria 1061
285 Ga0207641_10033372 3300026088 Bacteria 4277
286 Ga0207641_10147633 3300026088 Bacteria 2127
287 Ga0207641_10664937 3300026088 Bacteria 1024
288 Ga0207648_10101478 3300026089 Bacteria 2522
289 Ga0207648_10200117 3300026089 Unclassified 1771
290 Ga0207676_10123085 3300026095 Bacteria 2191
291 Ga0207676_10370458 3300026095 Bacteria 1330
292 Ga0207676_10917454 3300026095 Bacteria 860
293 Ga0207676_11476393 3300026095 Bacteria 677
294 Ga0207674_10006579 3300026116 Bacteria 13661
295 Ga0207674_10998086 3300026116 Bacteria 806
296 Ga0207675_100002881 3300026118 Bacteria 16915
297 Ga0207675_100265461 3300026118 Bacteria 1665
298 Ga0207675_100813507 3300026118 Bacteria 948
299 Ga0207675_100956670 3300026118 Unclassified 874
300 Ga0207675_101416661 3300026118 Bacteria 716
301 Ga0207683_10019655 3300026121 Bacteria 5772
302 Ga0207683_10470878 3300026121 Bacteria 1159
303 Ga0207698_10004400 3300026142 Bacteria 8582
304 Ga0207698_10138102 3300026142 Bacteria 2095
305 Ga0207698_10425572 3300026142 Bacteria 1275
306 Ga0207698_11355126 3300026142 Bacteria 726
307 Ga0207698_11903549 3300026142 Bacteria 609
308 Ga0207698_11986492 3300026142 Bacteria 596
309 Ga0268266_10000048 3300028379 Bacteria 310336
310 Ga0268265_10012001 3300028380 Bacteria 5863
311 Ga0268265_10750841 3300028380 Bacteria 947
312 Ga0268264_10003381 3300028381 Bacteria 13781
313 Ga0268264_10004165 3300028381 Bacteria 12358
314 Ga0268264_10119830 3300028381 Bacteria 2318
315 Ga0268264_10216149 3300028381 Unclassified 1762
316 Ga0307517_10001481 3300028786 Bacteria 39285
317 Ga0307517_10260656 3300028786 Bacteria 1007
318 Ga0307515_10000059 3300028794 Bacteria 257520
319 Ga0265338_10110397 3300028800 Bacteria 2217
320 Ga0307511_10000076 3300030521 Bacteria 82520
321 Ga0265327_10013842 3300031251 Bacteria 5327
322 Ga0265327_10478744 3300031251 Bacteria 537
323 Ga0265316_10755319 3300031344 Bacteria 684
324 Ga0307513_10281505 3300031456 Bacteria 1440
325 Ga0307509_10073627 3300031507 Unclassified 3556
326 Ga0307508_10048978 3300031616 Bacteria 3764
327 Ga0307516_10003288 3300031730 Bacteria 20916
328 Ga0307516_10336569 3300031730 Bacteria 1177
329 Ga0307409_101649313 3300031995 Unclassified 670
330 Ga0307414_10945457 3300032004 Unclassified 792
331 Ga0307507_10314567 3300033179 Bacteria 948
332 Ga0373935_0421372 3300035692 Bacteria 961
333 Ga0373927_0111853 3300035695 Bacteria 1780
334 Ga0373925_1127398 3300037068 Bacteria 645
335 Ga0395900_0136340 3300037418 Bacteria 2515
336 Ga0395898_0795852 3300037466 Bacteria 886
337 Ga0395905_0673713 3300037471 Bacteria 937
338 Ga0451800_1594361 3300041459 Unclassified 528
339 Ga0451807_0985891 3300041486 Bacteria 521
340 Ga0451849_1473220 3300041505 Bacteria 918
341 Ga0439448_0230733 3300042005 Bacteria 652
342 Ga0439462_0075028 3300042015 Bacteria 920
343 Ga0466969_0142521 3300044656 Bacteria 1107
344 Ga0466966_0434940 3300044684 Bacteria 789
345 Ga0466961_0083797 3300044693 Bacteria 2017
346 Ga0466971_0390980 3300044719 Bacteria 677
347 Ga0451576_0631273 3300045051 Bacteria 1126
348 Ga0495638_0020262 3300046460 Bacteria 4394
349 Ga0495638_0034009 3300046460 Unclassified 3256
350 Ga0495648_0001246 3300046524 Bacteria 25445
351 Ga0495668_0250821 3300046616 Bacteria 969
352 Ga0495625_0016203 3300046660 Bacteria 5872
353 Ga0495625_0255530 3300046660 Bacteria 1136
354 Ga0495649_0530352 3300046694 Bacteria 584
355 Ga0495683_0421314 3300047323 Unclassified 552
356 Ga0496100_0509008 3300048903 Unclassified 928
357 Ga0496101_0165193 3300048904 Unclassified 1699
358 Ga0496104_0248451 3300048907 Bacteria 1692
359 Ga0496104_1721749 3300048907 Bacteria 529
360 Ga0496105_0460363 3300048908 Bacteria 1003
361 Ga0496114_1691674 3300048917 Bacteria 521
362 Ga0495682_0250241 3300049460 Unclassified 627
363 Ga0501034_0021380 3300049571 Bacteria 6596
364 Ga0501034_0023872 3300049571 Bacteria 6226
365 Ga0501036_0001790 3300049572 Bacteria 16682
366 Ga0501037_0036973 3300049573 Bacteria 3598
367 Ga0501038_0010410 3300049574 Bacteria 8503
368 Ga0501039_0005375 3300049575 Bacteria 9683
369 Ga0501042_0841634 3300049578 Bacteria 668
370 Ga0501046_0002298 3300049580 Bacteria 18017
371 Ga0501047_0007344 3300049581 Bacteria 10361
372 Ga0501047_0332757 3300049581 Bacteria 1357
373 Ga0501048_0591913 3300049582 Bacteria 796
374 Ga0501067_0168499 3300049583 Bacteria 1220
375 Ga0501068_0432515 3300049584 Bacteria 850
376 Ga0501070_0005280 3300049586 Bacteria 11020
377 Ga0501073_0001470 3300049589 Bacteria 17454
378 Ga0501074_0000494 3300049590 Bacteria 24088
379 Ga0501077_0617132 3300049593 Bacteria 697
380 Ga0501079_0157832 3300049741 Bacteria 1768
381 Ga0501080_1006826 3300049742 Bacteria 722
382 Ga0501083_0012987 3300049744 Bacteria 5819
383 Ga0501035_0002001 3300049822 Bacteria 20361
384 Ga0501044_0007592 3300049823 Bacteria 11921
385 Ga0501044_0074210 3300049823 Bacteria 3457
386 Ga0501044_0422303 3300049823 Bacteria 1243
387 Ga0501044_0812391 3300049823 Unclassified 814
388 Ga0501045_0015342 3300049824 Bacteria 5440
389 nmdc:mga0k408_127893_c1 3300050493 Bacteria 1507
390 nmdc:mga0k408_91218_c1 3300050493 Bacteria 1790
391 nmdc:mga07m45_391083_c1 3300050496 Bacteria 807
392 nmdc:mga05p37_1790_c1 3300050507 Bacteria 11844
393 nmdc:mga08y16_178033_c1 3300050511 Bacteria 2208
394 Ga0500578_0036846 3300053086 Bacteria 3141
395 Ga0500644_0025763 3300053088 Unclassified 1814
396 Ga0500646_0072262 3300053090 Unclassified 1037
397 Ga0500583_0008346 3300053092 Bacteria 3711
398 Ga0500641_0221298 3300053096 Bacteria 803
399 Ga0500562_136135 3300053108 Bacteria 670
400 Ga0500593_198663 3300053117 Bacteria 726
401 Ga0500642_0012650 3300053130 Unclassified 3071
402 Ga0500559_0014490 3300053136 Bacteria 3332
403 Ga0500568_0020773 3300053139 Bacteria 2836
404 Ga0500568_0198960 3300053139 Bacteria 734
405 Ga0500573_0069925 3300053140 Bacteria 2003
406 Ga0500577_0217437 3300053142 Bacteria 827
407 Ga0500589_004793 3300053147 Bacteria 5159
408 Ga0500604_0014866 3300053151 Bacteria 2124
409 Ga0500604_0310403 3300053151 Bacteria 547
410 Ga0500619_042196 3300053154 Bacteria 1446
411 Ga0500622_0007299 3300053156 Bacteria 6292
412 Ga0500639_064732 3300053163 Bacteria 1877
413 Ga0500636_0073705 3300053177 Bacteria 1977
414 Ga0500637_0498942 3300053178 Unclassified 604
415 Ga0500637_0505214 3300053178 Bacteria 598
416 Ga0500587_009850 3300053739 Bacteria 1217
417 Ga0501082_0022160 3300060353 Bacteria 5475
418 2738725590 2738541278 Bacteria 9755573
419 Ga0105239_10916456
420 rootH2_10054043
421 rootH2_10162556
422 rootL2_10011714
423 Ga0070658_10237869
424 Ga0070676_10551085
425 Ga0070683_100061333
426 Ga0070683_100091702
427 Ga0070683_100848828
428 Ga0070670_100018095
429 Ga0070670_100034177
430 Ga0070670_100105804
431 Ga0070670_100265437
432 Ga0068869_101561452
433 Ga0070666_10184484
434 Ga0070682_101463947
435 Ga0068868_100006802
436 Ga0068868_100096153
437 Ga0068868_100196670
438 Ga0070660_100254501
439 Ga0070660_100448400
440 Ga0070660_101267920
441 Ga0070660_101440073
442 Ga0070689_102217670
443 Ga0070691_10016281
444 Ga0070661_100110501
445 Ga0070661_100130071
446 Ga0070661_100323257
447 Ga0070668_100074427
448 Ga0070669_101251996
449 Ga0070675_100093896
450 Ga0070675_100496106
451 Ga0070671_100027643
452 Ga0070671_100320559
453 Ga0070674_100009791
454 Ga0070674_100309001
455 Ga0070673_100085692
456 Ga0070673_100168198
457 Ga0070673_100364019
458 Ga0070673_102166455
459 Ga0070659_100007387
460 Ga0070659_101135716
461 Ga0070667_100005421
462 Ga0070667_101075207
463 Ga0070667_101957450
464 Ga0070678_100327467
465 Ga0070678_100354077
466 Ga0070681_10414979
467 Ga0068867_100673897
468 Ga0068867_100736051
469 Ga0070685_10347723
470 Ga0070698_100176872
471 Ga0070684_100025672
472 Ga0070684_100038020
473 Ga0070684_101775044
474 Ga0068853_100079204
475 Ga0068853_100362238
476 Ga0068853_100431589
477 Ga0068853_101809620
478 Ga0070672_100298465
479 Ga0070672_100576475
480 Ga0070672_101005453
481 Ga0070686_100332643
482 Ga0070665_100547651
483 Ga0070665_100753836
484 Ga0070665_101004988
485 Ga0068855_100007632
486 Ga0068855_100150344
487 Ga0068855_100273402
488 Ga0068855_100282355
489 Ga0068855_100388946
490 Ga0070664_100004753
491 Ga0068857_100003287
492 Ga0068857_100061056
493 Ga0068857_102245781
494 Ga0068854_100099309
495 Ga0068854_100168012
496 Ga0068856_100010180
497 Ga0068856_100125476
498 Ga0068856_100541877
499 Ga0070702_101103889
500 Ga0068852_100003106
501 Ga0068852_100070772
502 Ga0068852_100104879
503 Ga0068852_100349934
504 Ga0068852_100402929
505 Ga0068852_101069858
506 Ga0068852_101673011
507 Ga0068859_100056651
508 Ga0068859_100404398
509 Ga0068859_100435052
510 Ga0068864_100200521
511 Ga0068864_100280544
512 Ga0068864_101018327
513 Ga0068864_101887808
514 Ga0068861_100254433
515 Ga0068861_101385781
516 Ga0068851_10157382
517 Ga0068851_10225853
518 Ga0068851_10271856
519 Ga0068851_10429988
520 Ga0068870_10450600
521 Ga0068863_100084722
522 Ga0068863_100326132
523 Ga0068863_100329104
524 Ga0068863_100533881
525 Ga0068860_100001513
526 Ga0068860_100005172
527 Ga0068860_100259847
528 Ga0068860_100374219
529 Ga0068862_100512332
530 Ga0068862_100642491
531 Ga0068862_102272411
532 Ga0070715_10674969
533 Ga0070716_101535186
534 Ga0075366_10041791
535 Ga0075366_10111475
536 Ga0075366_10123985
537 Ga0097621_100000710
538 Ga0097621_100387088
539 Ga0097621_100528273
540 Ga0075370_10418050
541 Ga0068871_100000044
542 Ga0068871_100259036
543 Ga0068871_100269662
544 Ga0068865_100176273
545 Ga0068865_100335529
546 Ga0097620_100056649
547 Ga0097620_100404453
548 Ga0097620_100435048
549 Ga0105240_10000800
550 Ga0105240_10001677
551 Ga0105240_10024009
552 Ga0105240_10078823
553 Ga0105240_10148981
554 Ga0105240_10163707
555 Ga0105240_10792535
556 Ga0105240_11399056
557 Ga0111539_10756876
558 Ga0114129_10011078
559 Ga0105241_10001809
560 Ga0105241_10157791
561 Ga0105241_10192480
562 Ga0105241_10435508
563 Ga0105242_10051933
564 Ga0105242_10090338
565 Ga0105242_11259415
566 Ga0105242_13306745
567 Ga0105248_10045826
568 Ga0105248_12681388
569 Ga0105237_10007421
570 Ga0105237_10013737
571 Ga0105237_10030381
572 Ga0105237_10044557
573 Ga0105237_10641282
574 Ga0105237_11023265
575 Ga0105238_10000592
576 Ga0105238_10244747
577 Ga0105249_10567706
578 Ga0105249_10844410
579 Ga0105239_10000992
580 Ga0105239_10014948
581 Ga0105239_10016055
582 Ga0105239_10076740
583 Ga0105239_12072669
584 Ga0105246_10483677
585 Ga0105246_10963406
586 Ga0157373_10536014
587 Ga0157373_10752975
588 Ga0157373_11401999
589 Ga0157371_10012205
590 Ga0157371_10046499
591 Ga0157371_10155229
592 Ga0157371_10751291
593 Ga0157370_10007122
594 Ga0157370_10363111
595 Ga0157370_10676775
596 Ga0157369_10041671
597 Ga0157369_10098698
598 Ga0157369_10120236
599 Ga0157369_10173372
600 Ga0157369_11772752
601 Ga0157374_10655238
602 Ga0157378_10021088
603 Ga0157378_10037120
604 Ga0157378_10250684
605 Ga0157378_10664017
606 Ga0157378_10863970
607 Ga0157378_10988553
608 Ga0163162_10000154
609 Ga0163162_12045124
610 Ga0157372_10002332
611 Ga0157372_10003396
612 Ga0157372_10171958
613 Ga0157372_10177457
614 Ga0157372_10314014
615 Ga0157372_10331885
616 Ga0157372_10491661
617 Ga0157372_10660719
618 Ga0157372_11074529
619 Ga0157375_10000850
620 Ga0157375_10306792
621 Ga0157375_13064124
622 Ga0163163_10169497
623 Ga0163163_10309195
624 Ga0157377_10721647
625 Ga0157379_10445187
626 Ga0157376_10002615
627 Ga0163161_10127346
628 Ga0207426_1000104
629 Ga0207697_10090915
630 Ga0207656_10090875
631 Ga0207656_10176200
632 Ga0207682_10052170
633 Ga0207647_10000636
634 Ga0207647_10011588
635 Ga0207684_11210533
636 Ga0207654_10000945
637 Ga0207654_10104804
638 Ga0207654_10189214
639 Ga0207654_10379105
640 Ga0207707_10818664
641 Ga0207695_10004265
642 Ga0207695_10140366
643 Ga0207695_10229311
644 Ga0207671_10006174
645 Ga0207671_10006450
646 Ga0207671_10012497
647 Ga0207657_10467440
648 Ga0207657_10576844
649 Ga0207649_10070227
650 Ga0207649_10215798
651 Ga0207681_10294267
652 Ga0207694_10011375
653 Ga0207694_10129699
654 Ga0207694_11409537
655 Ga0207650_10045601
656 Ga0207650_10059698
657 Ga0207650_10101602
658 Ga0207650_10343220
659 Ga0207659_10112663
660 Ga0207659_10480144
661 Ga0207644_10001410
662 Ga0207644_10200916
663 Ga0207644_11853375
664 Ga0207690_10064440
665 Ga0207690_11236458
666 Ga0207686_10426356
667 Ga0207686_10469334
668 Ga0207669_10079912
669 Ga0207669_10489396
670 Ga0207704_10027744
671 Ga0207691_10046685
672 Ga0207691_10196408
673 Ga0207711_11398257
674 Ga0207689_10012780
675 Ga0207661_10095786
676 Ga0207661_10915187
677 Ga0207679_10020334
678 Ga0207679_11105357
679 Ga0207667_10000098
680 Ga0207667_10124769
681 Ga0207667_10139201
682 Ga0207651_10678968
683 Ga0207651_11395930
684 Ga0207712_10124381
685 Ga0207668_10078181
686 Ga0207640_10133722
687 Ga0207640_11309293
688 Ga0207640_11437257
689 Ga0207640_11806209
690 Ga0207658_10012330
691 Ga0207658_10216927
692 Ga0207658_11131922
693 Ga0207677_10005458
694 Ga0207677_10056150
695 Ga0207677_10601889
696 Ga0207677_10797464
697 Ga0207703_10329927
698 Ga0207639_10113638
699 Ga0207639_10281097
700 Ga0207678_10662494
701 Ga0207702_10019965
702 Ga0207702_10621643
703 Ga0207641_10033372
704 Ga0207641_10147633
705 Ga0207641_10664937
706 Ga0207648_10101478
707 Ga0207648_10200117
708 Ga0207676_10123085
709 Ga0207676_10370458
710 Ga0207676_10917454
711 Ga0207676_11476393
712 Ga0207674_10006579
713 Ga0207674_10998086
714 Ga0207675_100002881
715 Ga0207675_100265461
716 Ga0207675_100813507
717 Ga0207675_100956670
718 Ga0207675_101416661
719 Ga0207683_10019655
720 Ga0207683_10470878
721 Ga0207698_10004400
722 Ga0207698_10138102
723 Ga0207698_10425572
724 Ga0207698_11355126
725 Ga0207698_11903549
726 Ga0207698_11986492
727 Ga0268266_10000048
728 Ga0268265_10012001
729 Ga0268265_10750841
730 Ga0268264_10003381
731 Ga0268264_10004165
732 Ga0268264_10119830
733 Ga0268264_10216149
734 Ga0307517_10001481
735 Ga0307517_10260656
736 Ga0307515_10000059
737 Ga0265338_10110397
738 Ga0307511_10000076
739 Ga0265327_10013842
740 Ga0265327_10478744
741 Ga0265316_10755319
742 Ga0307513_10281505
743 Ga0307509_10073627
744 Ga0307508_10048978
745 Ga0307516_10003288
746 Ga0307516_10336569
747 Ga0307409_101649313
748 Ga0307414_10945457
749 Ga0307507_10314567
750 Ga0373935_0421372
751 Ga0373927_0111853
752 Ga0373925_1127398
753 Ga0395900_0136340
754 Ga0395898_0795852
755 Ga0395905_0673713
756 Ga0451800_1594361
757 Ga0451807_0985891
758 Ga0451849_1473220
759 Ga0439448_0230733
760 Ga0439462_0075028
761 Ga0466969_0142521
762 Ga0466966_0434940
763 Ga0466961_0083797
764 Ga0466971_0390980
765 Ga0451576_0631273
766 Ga0495638_0020262
767 Ga0495638_0034009
768 Ga0495648_0001246
769 Ga0495668_0250821
770 Ga0495625_0016203
771 Ga0495625_0255530
772 Ga0495649_0530352
773 Ga0495683_0421314
774 Ga0496100_0509008
775 Ga0496101_0165193
776 Ga0496104_0248451
777 Ga0496104_1721749
778 Ga0496105_0460363
779 Ga0496114_1691674
780 Ga0495682_0250241
781 Ga0501034_0021380
782 Ga0501034_0023872
783 Ga0501036_0001790
784 Ga0501037_0036973
785 Ga0501038_0010410
786 Ga0501039_0005375
787 Ga0501042_0841634
788 Ga0501046_0002298
789 Ga0501047_0007344
790 Ga0501047_0332757
791 Ga0501048_0591913
792 Ga0501067_0168499
793 Ga0501068_0432515
794 Ga0501070_0005280
795 Ga0501073_0001470
796 Ga0501074_0000494
797 Ga0501077_0617132
798 Ga0501079_0157832
799 Ga0501080_1006826
800 Ga0501083_0012987
801 Ga0501035_0002001
802 Ga0501044_0007592
803 Ga0501044_0074210
804 Ga0501044_0422303
805 Ga0501044_0812391
806 Ga0501045_0015342
807 nmdc:mga0k408_127893_c1
808 nmdc:mga0k408_91218_c1
809 nmdc:mga07m45_391083_c1
810 nmdc:mga05p37_1790_c1
811 nmdc:mga08y16_178033_c1
812 Ga0500578_0036846
813 Ga0500644_0025763
814 Ga0500646_0072262
815 Ga0500583_0008346
816 Ga0500641_0221298
817 Ga0500562_136135
818 Ga0500593_198663
819 Ga0500642_0012650
820 Ga0500559_0014490
821 Ga0500568_0020773
822 Ga0500568_0198960
823 Ga0500573_0069925
824 Ga0500577_0217437
825 Ga0500589_004793
826 Ga0500604_0014866
827 Ga0500604_0310403
828 Ga0500619_042196
829 Ga0500622_0007299
830 Ga0500639_064732
831 Ga0500636_0073705
832 Ga0500637_0498942
833 Ga0500637_0505214
834 Ga0500587_009850
835 Ga0501082_0022160
836 2738725590

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19937

GldC-like

Gliding motility-associated protein GldC-like

40

129

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
5fmn-assembly1.cif.gz_B the nickel-responsive transcriptional regulator inrs 0.9125 63 102
3eup-assembly1.cif.gz_B the crystal structure of the transcriptional regulator, tetr family from cytophaga hutchinsonii 0.8284 59 103
4biz-assembly1.cif.gz_F crystal structure of cpxahdc (orthorhombic form 2) 0.7003 63 107
5d7y-assembly1.cif.gz_A crystal structure of hepatitis b virus t=4 capsid in complex with the allosteric modulator hap18 0.6688 64 98
4whn-assembly2.cif.gz_D structure of toxin-activating acyltransferase (taat) 0.6636 38 87
ID Description Score Start End Superfamily
5fmnB00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Metal-sensitive repressor, helix protomer 0.9125 63 102 1.20.58.1000
5fmnA00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Metal-sensitive repressor, helix protomer 0.8723 63 102 1.20.58.1000
3eupB00 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;Tetracycline Repressor, domain 2 0.8284 59 103 1.10.357.10
af_A0A1D6LJ19_355_434_1.10.287.130 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Signal transduction histidine kinase, dimerisation/phosphotransfer (DHp) domain 0.8081 64 103 1.10.287.130
af_P15081_4_110_3.90.1010.10 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.8027 3 35 3.90.1010.10
ID Description Score Start End GO Terms
AF-A0A562SK96-F1-model_v4 Gliding motility-associated protein GldC 0.9932 1 114
AF-A0A1J5SLV4-F1-model_v4 Gliding motility protein GldC 0.9873 39 113
AF-A0A3C0IV31-F1-model_v4 Gliding motility protein GldC 0.9856 39 113
AF-A0A562SK96-F1-model_v4 Gliding motility-associated protein GldC 0.9846 1 114
AF-A0A522T0M8-F1-model_v4 Gliding motility protein GldC 0.9845 1 109

Map