F439268

General Info

Members Datasets Scaffolds Average Seq Length
418 216 416 207

Family's Representative Sequence

Representative Sequence 3300006038|Ga0075365_10015020|Ga0075365_100150201
Length 235
Sequence MGPGLVPLARFACKRRRDDGRDDPMSRLKHGMRLVVASHNAGKVREINELVAPHGLAAVSAAELGLPEPEETGATFAANAALKAVAAAQASGLPALSDDSGLEVEALDGAPGITSARWAGEAKDFAMAMRRVVDEVRACGGWSDLDDMGPRADFMCALCLAWPDGATQLFEGKVYGHLVWPPRGSNGFGYDPMFVADGHTLTFGEMEPDAKHAISHRARAFALFARACLGDGAAG

Samples

Sample ID Description Type Environment
1 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
2 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
49 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
50 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
51 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
52 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
53 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
79 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
107 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
111 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
112 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
113 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
114 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
115 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
116 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
117 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
118 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
119 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
120 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
121 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
122 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
123 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
124 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
125 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
126 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
127 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
128 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
129 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
130 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
131 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
132 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
133 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
134 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
135 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
136 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
137 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
138 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
139 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
140 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
141 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
142 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
143 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
144 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
145 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
146 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
147 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
148 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
149 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
150 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
151 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
152 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
153 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
154 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
155 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
156 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
157 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
158 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
159 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
160 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
161 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
162 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
163 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
164 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
165 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
181 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
182 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
183 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
184 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
185 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
186 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
187 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
188 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
189 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
190 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
191 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
192 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
193 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
194 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
195 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
197 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
198 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
199 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
200 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
201 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
202 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
203 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
204 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
205 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
206 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
207 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
208 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
209 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
210 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
211 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
212 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
213 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
214 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
215 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
216 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.52
Metatranscriptomes 0
Isolates 0.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.83
Nodule 0
Rhizoplane 8.13
Rhizosphere 87.32
Stem 0
Stem Tuber 0
Unclassified 0.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25404J52841_10021865 3300003659 Bacteria 1384
2 Ga0070658_10011434 3300005327 Bacteria 7119
3 Ga0070676_10575905 3300005328 Bacteria 809
4 Ga0070680_100004984 3300005336 Bacteria 10006
5 Ga0070680_100715220 3300005336 Bacteria 862
6 Ga0070660_100253839 3300005339 Bacteria 1434
7 Ga0070689_100139620 3300005340 Bacteria 1948
8 Ga0070691_10008579 3300005341 Bacteria 4680
9 Ga0070691_10014693 3300005341 Bacteria 3593
10 Ga0070692_10062805 3300005345 Bacteria 1961
11 Ga0070668_100105307 3300005347 Bacteria 2240
12 Ga0070668_100220394 3300005347 Bacteria 1564
13 Ga0070668_100421155 3300005347 Bacteria 1143
14 Ga0070668_100599011 3300005347 Bacteria 964
15 Ga0070674_100590503 3300005356 Bacteria 937
16 Ga0070673_100252484 3300005364 Bacteria 1538
17 Ga0070688_100365260 3300005365 Bacteria 1060
18 Ga0070667_100454057 3300005367 Bacteria 1171
19 Ga0070667_100665361 3300005367 Bacteria 962
20 Ga0070703_10010251 3300005406 Bacteria 2642
21 Ga0070709_10773895 3300005434 Bacteria 751
22 Ga0070714_100414102 3300005435 Bacteria 1276
23 Ga0070701_10002436 3300005438 Bacteria 7177
24 Ga0070705_100000119 3300005440 Bacteria 45310
25 Ga0070700_100314166 3300005441 Bacteria 1148
26 Ga0070700_100443330 3300005441 Bacteria 986
27 Ga0070700_100586841 3300005441 Bacteria 871
28 Ga0070694_100003531 3300005444 Bacteria 9350
29 Ga0070694_100109618 3300005444 Bacteria 1965
30 Ga0070694_100378665 3300005444 Bacteria 1103
31 Ga0070708_100031974 3300005445 Bacteria 4560
32 Ga0070663_100004331 3300005455 Bacteria 8321
33 Ga0070663_100158309 3300005455 Bacteria 1742
34 Ga0070662_100315240 3300005457 Bacteria 1274
35 Ga0070662_100870056 3300005457 Bacteria 768
36 Ga0070681_10038900 3300005458 Bacteria 4769
37 Ga0070706_100149561 3300005467 Bacteria 2180
38 Ga0070699_100002098 3300005518 Bacteria 18046
39 Ga0070679_100073981 3300005530 Bacteria 3398
40 Ga0070679_100150005 3300005530 Bacteria 2308
41 Ga0070684_100020796 3300005535 Bacteria 5446
42 Ga0070697_100073469 3300005536 Bacteria 2808
43 Ga0068853_100669932 3300005539 Bacteria 988
44 Ga0070686_100066624 3300005544 Bacteria 2343
45 Ga0070695_100000607 3300005545 Bacteria 19017
46 Ga0070695_100016385 3300005545 Bacteria 4484
47 Ga0070696_100000979 3300005546 Bacteria 18536
48 Ga0070693_100010021 3300005547 Bacteria 4729
49 Ga0070665_100001946 3300005548 Bacteria 23263
50 Ga0070704_100002441 3300005549 Bacteria 10428
51 Ga0068855_100283974 3300005563 Bacteria 1837
52 Ga0068855_100333991 3300005563 Bacteria 1672
53 Ga0068857_100005876 3300005577 Bacteria 10474
54 Ga0068854_100219346 3300005578 Bacteria 1504
55 Ga0070702_100039354 3300005615 Bacteria 2638
56 Ga0068859_100005860 3300005617 Bacteria 12470
57 Ga0068859_100287730 3300005617 Bacteria 1736
58 Ga0068859_100834327 3300005617 Bacteria 1008
59 Ga0068861_100067071 3300005719 Bacteria 2768
60 Ga0068861_100095372 3300005719 Bacteria 2356
61 Ga0068861_100446277 3300005719 Bacteria 1158
62 Ga0068858_100194749 3300005842 Bacteria 1915
63 Ga0068858_100324371 3300005842 Bacteria 1472
64 Ga0068860_100001501 3300005843 Bacteria 25173
65 Ga0068862_100003132 3300005844 Bacteria 14381
66 Ga0068862_100043481 3300005844 Bacteria 3830
67 Ga0081455_10000017 3300005937 Bacteria 174550
68 Ga0081540_1000059 3300005983 Bacteria 120226
69 Ga0075365_10015020 3300006038 Bacteria 4672
70 Ga0075368_10012178 3300006042 Bacteria 3141
71 Ga0075363_100001050 3300006048 Bacteria 9971
72 Ga0075363_100068636 3300006048 Bacteria 1922
73 Ga0070715_10169331 3300006163 Bacteria 1086
74 Ga0075367_10001270 3300006178 Bacteria 10658
75 Ga0075367_10007982 3300006178 Bacteria 5456
76 Ga0097621_100053334 3300006237 Bacteria 3296
77 Ga0068871_100245014 3300006358 Bacteria 1560
78 Ga0075428_100006310 3300006844 Bacteria 13181
79 Ga0075428_100134925 3300006844 Bacteria 2684
80 Ga0075428_100148396 3300006844 Bacteria 2548
81 Ga0075428_100215055 3300006844 Bacteria 2077
82 Ga0075428_100257988 3300006844 Bacteria 1878
83 Ga0075428_100694420 3300006844 Bacteria 1084
84 Ga0075430_100063113 3300006846 Bacteria 3112
85 Ga0075430_100071673 3300006846 Bacteria 2906
86 Ga0075430_100181898 3300006846 Bacteria 1748
87 Ga0075431_100000736 3300006847 Bacteria 28248
88 Ga0075431_100002411 3300006847 Bacteria 17990
89 Ga0075431_100051733 3300006847 Bacteria 4235
90 Ga0075431_100087540 3300006847 Bacteria 3214
91 Ga0075431_100165764 3300006847 Bacteria 2271
92 Ga0075431_100258653 3300006847 Bacteria 1767
93 Ga0075433_10002019 3300006852 Bacteria 15301
94 Ga0075433_10353753 3300006852 Bacteria 1298
95 Ga0075434_100002448 3300006871 Bacteria 16339
96 Ga0075429_100171477 3300006880 Bacteria 1900
97 Ga0075436_100171053 3300006914 Bacteria 1534
98 Ga0097620_100005860 3300006931 Bacteria 12470
99 Ga0097620_100287723 3300006931 Bacteria 1736
100 Ga0097620_100834339 3300006931 Bacteria 1008
101 Ga0075435_100047066 3300007076 Bacteria 3462
102 Ga0075435_100468477 3300007076 Bacteria 1087
103 Ga0105240_10042782 3300009093 Bacteria 5770
104 Ga0105240_10131438 3300009093 Bacteria 3002
105 Ga0105240_10235392 3300009093 Bacteria 2125
106 Ga0105240_10266296 3300009093 Bacteria 1975
107 Ga0111539_10065251 3300009094 Bacteria 4303
108 Ga0111539_10113621 3300009094 Bacteria 3176
109 Ga0111539_10319012 3300009094 Bacteria 1808
110 Ga0111539_10485333 3300009094 Bacteria 1439
111 Ga0114129_10047596 3300009147 Bacteria 6025
112 Ga0114129_10125554 3300009147 Bacteria 3528
113 Ga0114129_10273427 3300009147 Bacteria 2260
114 Ga0114129_10320934 3300009147 Bacteria 2059
115 Ga0105243_10047782 3300009148 Bacteria 3371
116 Ga0105246_10082605 3300011119 Bacteria 2293
117 Ga0105246_10154815 3300011119 Bacteria 1740
118 Ga0157370_10027880 3300013104 Bacteria 5564
119 Ga0157370_10541210 3300013104 Bacteria 1068
120 Ga0157369_10348260 3300013105 Bacteria 1539
121 Ga0157369_10549939 3300013105 Bacteria 1193
122 Ga0157378_10662093 3300013297 Bacteria 1061
123 Ga0157378_11018638 3300013297 Bacteria 863
124 Ga0157375_10138794 3300013308 Bacteria 2556
125 Ga0163163_10124859 3300014325 Bacteria 2611
126 Ga0163163_10497751 3300014325 Bacteria 1281
127 Ga0157380_10067047 3300014326 Bacteria 2889
128 Ga0157380_10603927 3300014326 Bacteria 1086
129 Ga0157379_10319705 3300014968 Bacteria 1417
130 Ga0157379_10327011 3300014968 Bacteria 1400
131 Ga0157379_10780274 3300014968 Bacteria 901
132 Ga0157379_11172076 3300014968 Bacteria 738
133 Ga0157376_10010729 3300014969 Bacteria 6719
134 Ga0163161_10035309 3300017792 Bacteria 3578
135 Ga0207653_10002425 3300025885 Bacteria 5929
136 Ga0207642_10129433 3300025899 Bacteria 1315
137 Ga0207685_10192603 3300025905 Bacteria 953
138 Ga0207699_10730064 3300025906 Bacteria 726
139 Ga0207705_10014909 3300025909 Bacteria 5590
140 Ga0207707_10007435 3300025912 Bacteria 9543
141 Ga0207695_10053130 3300025913 Bacteria 4239
142 Ga0207695_10117376 3300025913 Bacteria 2634
143 Ga0207695_10127135 3300025913 Bacteria 2510
144 Ga0207695_10222926 3300025913 Bacteria 1792
145 Ga0207660_10003076 3300025917 Bacteria 10904
146 Ga0207657_10036998 3300025919 Bacteria 4364
147 Ga0207652_10213245 3300025921 Bacteria 1739
148 Ga0207652_10248265 3300025921 Bacteria 1605
149 Ga0207652_10387233 3300025921 Bacteria 1262
150 Ga0207681_10435912 3300025923 Bacteria 1064
151 Ga0207700_10216766 3300025928 Bacteria 1620
152 Ga0207670_10399344 3300025936 Bacteria 1099
153 Ga0207679_10629838 3300025945 Bacteria 969
154 Ga0207667_10116424 3300025949 Bacteria 2754
155 Ga0207667_10190236 3300025949 Bacteria 2106
156 Ga0207667_10288061 3300025949 Bacteria 1678
157 Ga0207712_10086685 3300025961 Bacteria 2294
158 Ga0207668_10044569 3300025972 Bacteria 3019
159 Ga0207668_10110312 3300025972 Bacteria 2063
160 Ga0207668_10197321 3300025972 Bacteria 1600
161 Ga0207668_10518283 3300025972 Bacteria 1028
162 Ga0207668_10671781 3300025972 Bacteria 908
163 Ga0207640_10398919 3300025981 Bacteria 1120
164 Ga0207658_10367431 3300025986 Bacteria 1257
165 Ga0207703_10337404 3300026035 Bacteria 1384
166 Ga0207639_10610040 3300026041 Bacteria 1007
167 Ga0207639_11314203 3300026041 Bacteria 679
168 Ga0207678_10009991 3300026067 Bacteria 8327
169 Ga0207708_10000550 3300026075 Bacteria 28982
170 Ga0207708_10033276 3300026075 Bacteria 3916
171 Ga0207708_10071522 3300026075 Bacteria 2657
172 Ga0207648_10052179 3300026089 Bacteria 3575
173 Ga0207674_10007279 3300026116 Bacteria 12900
174 Ga0207675_100028110 3300026118 Bacteria 5236
175 Ga0207675_100113945 3300026118 Bacteria 2553
176 Ga0207675_100140579 3300026118 Bacteria 2293
177 Ga0207675_100452858 3300026118 Bacteria 1272
178 Ga0207675_100866457 3300026118 Bacteria 919
179 Ga0207683_10418838 3300026121 Bacteria 1233
180 Ga0209813_10131948 3300027866 Bacteria 880
181 Ga0268266_10000847 3300028379 Bacteria 39858
182 Ga0268266_10756255 3300028379 Bacteria 938
183 Ga0268265_10002565 3300028380 Bacteria 13578
184 Ga0268265_10081538 3300028380 Bacteria 2555
185 Ga0268264_10010971 3300028381 Bacteria 7482
186 Ga0268264_11016333 3300028381 Bacteria 836
187 Ga0265338_10004163 3300028800 Bacteria 19762
188 Ga0265330_10034889 3300031235 Bacteria 2246
189 Ga0265330_10037051 3300031235 Bacteria 2172
190 Ga0265340_10001383 3300031247 Bacteria 13894
191 Ga0265340_10003608 3300031247 Bacteria 8704
192 Ga0265340_10005883 3300031247 Bacteria 6780
193 Ga0265340_10257093 3300031247 Bacteria 778
194 Ga0265339_10079841 3300031249 Bacteria 1730
195 Ga0265331_10050492 3300031250 Bacteria 1995
196 Ga0265316_10010377 3300031344 Bacteria 8494
197 Ga0265313_10005153 3300031595 Bacteria 9712
198 Ga0265314_10077663 3300031711 Bacteria 2202
199 Ga0265314_10078037 3300031711 Bacteria 2194
200 Ga0265314_10106472 3300031711 Bacteria 1791
201 Ga0265314_10180725 3300031711 Bacteria 1264
202 Ga0265342_10002116 3300031712 Bacteria 17515
203 Ga0265342_10030572 3300031712 Bacteria 3336
204 Ga0265342_10178464 3300031712 Bacteria 1164
205 Ga0307409_100529140 3300031995 Bacteria 1153
206 Ga0373958_0059477 3300034819 Bacteria 825
207 Ga0373938_0022074 3300034957 Bacteria 1297
208 Ga0373929_0013887 3300035085 Bacteria 1550
209 Ga0373929_0024358 3300035085 Bacteria 1250
210 Ga0373952_0024168 3300035092 Bacteria 1303
211 Ga0373952_0030450 3300035092 Bacteria 1195
212 Ga0373939_0024483 3300035114 Bacteria 1682
213 Ga0373939_0041606 3300035114 Bacteria 1385
214 Ga0373941_0001936 3300035115 Bacteria 4486
215 Ga0373960_0163651 3300035121 Bacteria 767
216 Ga0373961_0009577 3300035241 Bacteria 2372
217 Ga0373961_0046615 3300035241 Bacteria 1271
218 Ga0373962_0020519 3300035242 Bacteria 1736
219 Ga0373931_0001487 3300035691 Bacteria 10084
220 Ga0373931_0005459 3300035691 Bacteria 5884
221 Ga0373927_0149766 3300035695 Bacteria 1528
222 Ga0373947_0337712 3300035725 Bacteria 1009
223 Ga0395899_0086300 3300037312 Bacteria 2280
224 Ga0395900_0009747 3300037418 Bacteria 9838
225 Ga0395898_0015029 3300037466 Bacteria 7946
226 Ga0400483_134809 3300039062 Bacteria 1161
227 Ga0439460_0078247 3300042461 Bacteria 1034
228 Ga0451576_0004092 3300045051 Bacteria 19260
229 Ga0466967_0504101 3300045976 Bacteria 1188
230 Ga0495603_0105330 3300046455 Bacteria 1646
231 Ga0495629_0032182 3300046459 Bacteria 3714
232 Ga0495580_0006808 3300046472 Bacteria 9260
233 Ga0495582_0063727 3300046473 Bacteria 2036
234 Ga0495584_0063798 3300046491 Bacteria 1852
235 Ga0495594_0071923 3300046499 Bacteria 1924
236 Ga0495644_0182023 3300046523 Bacteria 808
237 Ga0495625_0162194 3300046660 Bacteria 1497
238 Ga0495658_0000508 3300046683 Bacteria 21407
239 Ga0495669_0337712 3300046684 Bacteria 728
240 Ga0496100_0155163 3300048903 Bacteria 1637
241 Ga0496101_0009386 3300048904 Bacteria 6430
242 Ga0496101_0046989 3300048904 Bacteria 3098
243 Ga0496102_0063237 3300048905 Bacteria 3388
244 Ga0496102_0211486 3300048905 Bacteria 1828
245 Ga0496103_0106493 3300048906 Bacteria 1778
246 Ga0496103_0190178 3300048906 Bacteria 1320
247 Ga0496104_0000631 3300048907 Bacteria 30188
248 Ga0496104_0062088 3300048907 Bacteria 3543
249 Ga0496104_0133347 3300048907 Bacteria 2386
250 Ga0496105_0054587 3300048908 Bacteria 3299
251 Ga0496105_0060164 3300048908 Bacteria 3134
252 Ga0496106_0001377 3300048909 Bacteria 18215
253 Ga0496106_0758446 3300048909 Bacteria 771
254 Ga0496107_0002330 3300048910 Bacteria 12258
255 Ga0496107_0043086 3300048910 Bacteria 3242
256 Ga0496108_0001447 3300048911 Bacteria 18763
257 Ga0496108_0157595 3300048911 Bacteria 1961
258 Ga0496108_0160319 3300048911 Bacteria 1944
259 Ga0496108_0851055 3300048911 Bacteria 785
260 Ga0496109_0036782 3300048912 Bacteria 4420
261 Ga0496109_0203057 3300048912 Bacteria 1864
262 Ga0496110_0005498 3300048913 Bacteria 9939
263 Ga0496110_0352122 3300048913 Bacteria 1341
264 Ga0496110_0466971 3300048913 Bacteria 1150
265 Ga0496111_0012936 3300048914 Bacteria 5663
266 Ga0496111_0130424 3300048914 Bacteria 1860
267 Ga0496111_0414614 3300048914 Bacteria 995
268 Ga0496112_0056950 3300048915 Bacteria 3848
269 Ga0496112_0192565 3300048915 Bacteria 2000
270 Ga0496113_0001476 3300048916 Bacteria 13123
271 Ga0496114_0003066 3300048917 Bacteria 12805
272 Ga0496115_0026274 3300048918 Bacteria 4543
273 Ga0496115_0055302 3300048918 Bacteria 3188
274 Ga0501031_0656512 3300049568 Bacteria 674
275 Ga0501032_0074747 3300049569 Bacteria 2258
276 Ga0501032_0228092 3300049569 Bacteria 1211
277 Ga0501033_0017004 3300049570 Bacteria 5498
278 Ga0501034_0040039 3300049571 Bacteria 4746
279 Ga0501034_0057093 3300049571 Bacteria 3925
280 Ga0501034_0122574 3300049571 Bacteria 2585
281 Ga0501034_0127191 3300049571 Bacteria 2533
282 Ga0501034_0193016 3300049571 Bacteria 1998
283 Ga0501034_0281774 3300049571 Bacteria 1601
284 Ga0501036_0025328 3300049572 Bacteria 5005
285 Ga0501036_0184691 3300049572 Bacteria 1755
286 Ga0501036_0323985 3300049572 Bacteria 1287
287 Ga0501037_0090614 3300049573 Bacteria 2212
288 Ga0501037_0259493 3300049573 Bacteria 1214
289 Ga0501038_0050092 3300049574 Bacteria 3610
290 Ga0501039_0020081 3300049575 Bacteria 5122
291 Ga0501039_0084309 3300049575 Bacteria 2475
292 Ga0501040_0078366 3300049576 Bacteria 2287
293 Ga0501040_0084508 3300049576 Bacteria 2202
294 Ga0501040_0131338 3300049576 Bacteria 1761
295 Ga0501041_0058666 3300049577 Bacteria 2355
296 Ga0501041_0197721 3300049577 Bacteria 1260
297 Ga0501042_0180749 3300049578 Bacteria 1522
298 Ga0501042_0255678 3300049578 Bacteria 1264
299 Ga0501043_0020905 3300049579 Bacteria 5133
300 Ga0501046_0032180 3300049580 Bacteria 4247
301 Ga0501046_0239483 3300049580 Bacteria 1338
302 Ga0501046_0294245 3300049580 Bacteria 1187
303 Ga0501047_0002217 3300049581 Bacteria 18619
304 Ga0501047_0028951 3300049581 Bacteria 5342
305 Ga0501047_0140228 3300049581 Bacteria 2296
306 Ga0501048_0055255 3300049582 Bacteria 2819
307 Ga0501048_0433652 3300049582 Bacteria 940
308 Ga0501067_0000181 3300049583 Bacteria 35717
309 Ga0501067_0003609 3300049583 Bacteria 8526
310 Ga0501067_0005837 3300049583 Bacteria 6827
311 Ga0501067_0055853 3300049583 Bacteria 2188
312 Ga0501067_0062414 3300049583 Bacteria 2063
313 Ga0501067_0251091 3300049583 Bacteria 984
314 Ga0501068_0357146 3300049584 Bacteria 940
315 Ga0501069_0078819 3300049585 Bacteria 1853
316 Ga0501069_0098922 3300049585 Bacteria 1655
317 Ga0501070_0016276 3300049586 Bacteria 6249
318 Ga0501070_0053090 3300049586 Bacteria 3363
319 Ga0501070_0137348 3300049586 Bacteria 2018
320 Ga0501070_0427439 3300049586 Bacteria 1069
321 Ga0501070_0441584 3300049586 Bacteria 1050
322 Ga0501071_0099576 3300049587 Bacteria 2142
323 Ga0501072_0011727 3300049588 Bacteria 6696
324 Ga0501072_0033114 3300049588 Bacteria 4049
325 Ga0501073_0004754 3300049589 Bacteria 10195
326 Ga0501073_0020963 3300049589 Bacteria 4715
327 Ga0501073_0045949 3300049589 Bacteria 3074
328 Ga0501073_0060093 3300049589 Bacteria 2652
329 Ga0501073_0073060 3300049589 Bacteria 2388
330 Ga0501073_0099133 3300049589 Bacteria 2023
331 Ga0501073_0462141 3300049589 Bacteria 877
332 Ga0501074_0030882 3300049590 Bacteria 3882
333 Ga0501074_0096962 3300049590 Bacteria 2111
334 Ga0501074_0117202 3300049590 Bacteria 1905
335 Ga0501074_0154735 3300049590 Bacteria 1638
336 Ga0501074_0288075 3300049590 Bacteria 1167
337 Ga0501075_0102807 3300049591 Bacteria 2170
338 Ga0501075_0107940 3300049591 Bacteria 2116
339 Ga0501075_0118743 3300049591 Bacteria 2011
340 Ga0501076_0062416 3300049592 Bacteria 2967
341 Ga0501077_0022855 3300049593 Bacteria 3963
342 Ga0501077_0272120 3300049593 Bacteria 1078
343 Ga0501079_0020926 3300049741 Bacteria 5002
344 Ga0501079_0044753 3300049741 Bacteria 3416
345 Ga0501079_0085688 3300049741 Bacteria 2438
346 Ga0501079_0116914 3300049741 Bacteria 2073
347 Ga0501079_0299987 3300049741 Bacteria 1257
348 Ga0501080_0031899 3300049742 Bacteria 4910
349 Ga0501080_0113816 3300049742 Bacteria 2508
350 Ga0501080_0119183 3300049742 Bacteria 2446
351 Ga0501080_0164159 3300049742 Bacteria 2050
352 Ga0501080_0844828 3300049742 Bacteria 801
353 Ga0501081_0047893 3300049743 Bacteria 2941
354 Ga0501081_0085530 3300049743 Bacteria 2213
355 Ga0501083_0001570 3300049744 Bacteria 15597
356 Ga0501083_0031349 3300049744 Bacteria 3649
357 Ga0501083_0053356 3300049744 Bacteria 2714
358 Ga0501083_0100564 3300049744 Bacteria 1906
359 Ga0501035_0004027 3300049822 Bacteria 14016
360 Ga0501035_0044235 3300049822 Bacteria 4010
361 Ga0501044_0014583 3300049823 Bacteria 8476
362 Ga0501044_0049225 3300049823 Bacteria 4350
363 Ga0501044_0212073 3300049823 Bacteria 1890
364 Ga0501044_0336323 3300049823 Bacteria 1431
365 Ga0501044_0844307 3300049823 Bacteria 793
366 Ga0501044_1024632 3300049823 Bacteria 697
367 nmdc:mga03n38_34413_c1 3300050490 Bacteria 2164
368 nmdc:mga03n38_69159_c1 3300050490 Bacteria 1629
369 nmdc:mga00v17_96632_c1 3300050491 Bacteria 1861
370 nmdc:mga0yw44_29967_c1 3300050492 Bacteria 3147
371 nmdc:mga0yw44_64775_c1 3300050492 Bacteria 2250
372 nmdc:mga06z11_3052_c2 3300050494 Bacteria 6145
373 nmdc:mga04h51_17519_c1 3300050495 Bacteria 2096
374 nmdc:mga04h51_37007_c1 3300050495 Bacteria 1574
375 nmdc:mga05p37_270415_c1 3300050507 Bacteria 2031
376 nmdc:mga05p37_289249_c1 3300050507 Bacteria 1951
377 nmdc:mga09592_126533_c1 3300050508 Bacteria 2197
378 nmdc:mga09592_53115_c1 3300050508 Bacteria 3421
379 nmdc:mga0qj67_13338_c1 3300050509 Bacteria 6202
380 nmdc:mga0qj67_259428_c1 3300050509 Bacteria 1410
381 nmdc:mga0qj67_37200_c1 3300050509 Bacteria 3812
382 nmdc:mga06r32_1698_c1 3300050510 Bacteria 19847
383 nmdc:mga06r32_18858_c1 3300050510 Bacteria 6324
384 nmdc:mga06r32_357392_c1 3300050510 Bacteria 1445
385 nmdc:mga06r32_36968_c1 3300050510 Bacteria 4619
386 nmdc:mga06r32_480777_c1 3300050510 Bacteria 1220
387 nmdc:mga08y16_156060_c1 3300050511 Bacteria 2372
388 nmdc:mga08y16_389239_c1 3300050511 Bacteria 1428
389 nmdc:mga0n895_47419_c1 3300050512 Bacteria 4201
390 nmdc:mga0rr50_39758_c1 3300050513 Bacteria 3414
391 nmdc:mga08x19_153944_c1 3300050514 Bacteria 1558
392 nmdc:mga0a205_1678_c1 3300050515 Bacteria 19104
393 nmdc:mga0a205_330401_c1 3300050515 Bacteria 1394
394 Ga0495619_0426960 3300053085 Bacteria 914
395 Ga0500611_046423 3300053727 Bacteria 977
396 Ga0501084_0001715 3300054114 Bacteria 17404
397 Ga0501084_0010432 3300054114 Bacteria 7682
398 Ga0501084_0051806 3300054114 Bacteria 3435
399 Ga0501084_0052180 3300054114 Bacteria 3422
400 Ga0501084_0056393 3300054114 Bacteria 3287
401 Ga0501084_0117600 3300054114 Bacteria 2235
402 Ga0501084_0142518 3300054114 Bacteria 2018
403 Ga0501084_0333559 3300054114 Bacteria 1281
404 Ga0501084_0594538 3300054114 Bacteria 935
405 Ga0501082_0013815 3300060353 Bacteria 6944
406 Ga0501082_0023545 3300060353 Bacteria 5312
407 Ga0501082_0028223 3300060353 Bacteria 4836
408 Ga0501082_0041818 3300060353 Bacteria 3952
409 Ga0501082_0050413 3300060353 Bacteria 3590
410 Ga0501082_0081925 3300060353 Bacteria 2784
411 Ga0501082_0122932 3300060353 Bacteria 2250
412 Ga0501082_0231982 3300060353 Bacteria 1606
413 Ga0501082_0459889 3300060353 Bacteria 1112
414 Ga0530510_0078048 3300061734 Bacteria 2407
415 Ga0530510_0142470 3300061734 Bacteria 1767
416 Ga0530510_0416673 3300061734 Bacteria 1014

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006844 Ga0075428_100134925 Ga0075428_1001349251 180
2 3300006846 Ga0075430_100063113 Ga0075430_1000631135 180
3 3300006847 Ga0075431_100051733 Ga0075431_1000517335 180
4 3300009147 Ga0114129_10273427 Ga0114129_102734272 180
5 3300050508 nmdc:mga09592_126533_c1 nmdc:mga09592_126533_c1_266_895 180
6 3300050509 nmdc:mga0qj67_13338_c1 nmdc:mga0qj67_13338_c1_1722_2351 180
7 3300006844 Ga0075428_100148396 Ga0075428_1001483962 181
8 3300006846 Ga0075430_100071673 Ga0075430_1000716732 181
9 3300006847 Ga0075431_100165764 Ga0075431_1001657642 181
10 3300006880 Ga0075429_100171477 Ga0075429_1001714773 181
11 3300050507 nmdc:mga05p37_270415_c1 nmdc:mga05p37_270415_c1_460_1101 181
12 3300050508 nmdc:mga09592_53115_c1 nmdc:mga09592_53115_c1_1543_2184 181
13 3300050509 nmdc:mga0qj67_37200_c1 nmdc:mga0qj67_37200_c1_1747_2388 181
14 3300050510 nmdc:mga06r32_36968_c1 nmdc:mga06r32_36968_c1_1203_1844 181
15 3300048909 Ga0496106_0758446 Ga0496106_0758446_179_751 182
16 3300049823 Ga0501044_0336323 Ga0501044_0336323_855_1421 188
17 3300005535 Ga0070684_100020796 Ga0070684_1000207962 189
18 3300009093 Ga0105240_10131438 Ga0105240_101314383 189
19 3300013104 Ga0157370_10541210 Ga0157370_105412101 189
20 3300013105 Ga0157369_10549939 Ga0157369_105499392 189
21 3300025913 Ga0207695_10117376 Ga0207695_101173763 189
22 3300025949 Ga0207667_10288061 Ga0207667_102880612 189
23 3300046459 Ga0495629_0032182 Ga0495629_0032182_1526_2104 189
24 3300005336 Ga0070680_100004984 Ga0070680_1000049846 192
25 3300005341 Ga0070691_10008579 Ga0070691_100085793 192
26 3300005345 Ga0070692_10062805 Ga0070692_100628051 192
27 3300005367 Ga0070667_100665361 Ga0070667_1006653611 192
28 3300005406 Ga0070703_10010251 Ga0070703_100102512 192
29 3300005438 Ga0070701_10002436 Ga0070701_100024363 192
30 3300005440 Ga0070705_100000119 Ga0070705_10000011936 192
31 3300005444 Ga0070694_100003531 Ga0070694_1000035316 192
32 3300005445 Ga0070708_100031974 Ga0070708_1000319743 192
33 3300005455 Ga0070663_100004331 Ga0070663_1000043316 192
34 3300005458 Ga0070681_10038900 Ga0070681_100389003 192
35 3300005467 Ga0070706_100149561 Ga0070706_1001495611 192
36 3300005518 Ga0070699_100002098 Ga0070699_1000020988 192
37 3300005530 Ga0070679_100073981 Ga0070679_1000739812 192
38 3300005536 Ga0070697_100073469 Ga0070697_1000734692 192
39 3300005539 Ga0068853_100669932 Ga0068853_1006699321 192
40 3300005545 Ga0070695_100000607 Ga0070695_1000006078 192
41 3300005546 Ga0070696_100000979 Ga0070696_10000097913 192
42 3300005547 Ga0070693_100010021 Ga0070693_1000100214 192
43 3300005549 Ga0070704_100002441 Ga0070704_1000024416 192
44 3300005577 Ga0068857_100005876 Ga0068857_1000058766 192
45 3300005615 Ga0070702_100039354 Ga0070702_1000393542 192
46 3300005617 Ga0068859_100005860 Ga0068859_1000058608 192
47 3300005719 Ga0068861_100067071 Ga0068861_1000670712 192
48 3300005843 Ga0068860_100001501 Ga0068860_10000150113 192
49 3300005844 Ga0068862_100003132 Ga0068862_10000313213 192
50 3300006931 Ga0097620_100005860 Ga0097620_1000058608 192
51 3300007076 Ga0075435_100468477 Ga0075435_1004684772 192
52 3300011119 Ga0105246_10154815 Ga0105246_101548152 192
53 3300025885 Ga0207653_10002425 Ga0207653_100024256 192
54 3300025912 Ga0207707_10007435 Ga0207707_100074359 192
55 3300025917 Ga0207660_10003076 Ga0207660_100030766 192
56 3300025921 Ga0207652_10248265 Ga0207652_102482652 192
57 3300025972 Ga0207668_10110312 Ga0207668_101103122 192
58 3300026067 Ga0207678_10009991 Ga0207678_100099915 192
59 3300026075 Ga0207708_10000550 Ga0207708_1000055012 192
60 3300026116 Ga0207674_10007279 Ga0207674_100072796 192
61 3300026118 Ga0207675_100028110 Ga0207675_1000281104 192
62 3300028380 Ga0268265_10002565 Ga0268265_1000256513 192
63 3300028381 Ga0268264_10010971 Ga0268264_100109712 192
64 3300048903 Ga0496100_0155163 Ga0496100_0155163_652_1329 192
65 3300048904 Ga0496101_0046989 Ga0496101_0046989_1573_2250 192
66 3300048905 Ga0496102_0063237 Ga0496102_0063237_2208_2885 192
67 3300048906 Ga0496103_0106493 Ga0496103_0106493_528_1205 192
68 3300048908 Ga0496105_0060164 Ga0496105_0060164_537_1214 192
69 3300048909 Ga0496106_0001377 Ga0496106_0001377_12642_13319 192
70 3300048910 Ga0496107_0002330 Ga0496107_0002330_705_1382 192
71 3300048918 Ga0496115_0026274 Ga0496115_0026274_864_1541 192
72 3300054114 Ga0501084_0594538 Ga0501084_0594538_285_887 192
73 3300049589 Ga0501073_0045949 Ga0501073_0045949_738_1319 193
74 3300049571 Ga0501034_0127191 Ga0501034_0127191_1375_1971 194
75 3300049580 Ga0501046_0294245 Ga0501046_0294245_20_616 194
76 3300049586 Ga0501070_0441584 Ga0501070_0441584_101_697 194
77 3300006844 Ga0075428_100215055 Ga0075428_1002150552 195
78 3300049589 Ga0501073_0073060 Ga0501073_0073060_1175_1762 195
79 3300049742 Ga0501080_0164159 Ga0501080_0164159_148_735 195
80 3300049744 Ga0501083_0001570 Ga0501083_0001570_5528_6115 195
81 3300049823 Ga0501044_1024632 Ga0501044_1024632_96_686 195
82 3300054114 Ga0501084_0052180 Ga0501084_0052180_975_1562 195
83 3300045051 Ga0451576_0004092 Ga0451576_0004092_2570_3181 196
84 3300049585 Ga0501069_0098922 Ga0501069_0098922_871_1464 196
85 3300049586 Ga0501070_0016276 Ga0501070_0016276_5020_5613 196
86 3300060353 Ga0501082_0122932 Ga0501082_0122932_949_1539 196
87 iso_pu_bacteria 2929199973 2929200098 196
88 iso_pu_bacteria 8055909800 8055912267 196
89 3300005441 Ga0070700_100314166 Ga0070700_1003141661 197
90 3300005719 Ga0068861_100446277 Ga0068861_1004462772 197
91 3300006042 Ga0075368_10012178 Ga0075368_100121783 197
92 3300025972 Ga0207668_10044569 Ga0207668_100445694 197
93 3300026118 Ga0207675_100140579 Ga0207675_1001405793 197
94 3300027866 Ga0209813_10131948 Ga0209813_101319481 197
95 3300049583 Ga0501067_0055853 Ga0501067_0055853_351_956 197
96 3300049590 Ga0501074_0154735 Ga0501074_0154735_988_1593 197
97 3300005435 Ga0070714_100414102 Ga0070714_1004141022 198
98 3300046472 Ga0495580_0006808 Ga0495580_0006808_7432_8037 198
99 3300046473 Ga0495582_0063727 Ga0495582_0063727_703_1308 198
100 3300046683 Ga0495658_0000508 Ga0495658_0000508_1241_1846 198
101 3300049569 Ga0501032_0074747 Ga0501032_0074747_1619_2215 198
102 3300049570 Ga0501033_0017004 Ga0501033_0017004_4181_4777 198
103 3300049571 Ga0501034_0281774 Ga0501034_0281774_846_1442 198
104 3300049573 Ga0501037_0090614 Ga0501037_0090614_1439_2035 198
105 3300049574 Ga0501038_0050092 Ga0501038_0050092_159_755 198
106 3300049575 Ga0501039_0020081 Ga0501039_0020081_3091_3693 198
107 3300049576 Ga0501040_0131338 Ga0501040_0131338_398_1000 198
108 3300049579 Ga0501043_0020905 Ga0501043_0020905_236_832 198
109 3300049580 Ga0501046_0239483 Ga0501046_0239483_372_974 198
110 3300049581 Ga0501047_0140228 Ga0501047_0140228_932_1528 198
111 3300049582 Ga0501048_0433652 Ga0501048_0433652_293_895 198
112 3300049586 Ga0501070_0053090 Ga0501070_0053090_80_676 198
113 3300049587 Ga0501071_0099576 Ga0501071_0099576_1366_1968 198
114 3300049588 Ga0501072_0033114 Ga0501072_0033114_2906_3508 198
115 3300049589 Ga0501073_0099133 Ga0501073_0099133_92_688 198
116 3300049590 Ga0501074_0117202 Ga0501074_0117202_95_697 198
117 3300049590 Ga0501074_0288075 Ga0501074_0288075_73_669 198
118 3300049591 Ga0501075_0107940 Ga0501075_0107940_1094_1696 198
119 3300049592 Ga0501076_0062416 Ga0501076_0062416_2286_2888 198
120 3300049593 Ga0501077_0022855 Ga0501077_0022855_614_1216 198
121 3300049741 Ga0501079_0020926 Ga0501079_0020926_3043_3645 198
122 3300049742 Ga0501080_0113816 Ga0501080_0113816_1448_2050 198
123 3300049744 Ga0501083_0031349 Ga0501083_0031349_127_729 198
124 3300049822 Ga0501035_0044235 Ga0501035_0044235_1544_2140 198
125 3300054114 Ga0501084_0010432 Ga0501084_0010432_5587_6189 198
126 3300060353 Ga0501082_0081925 Ga0501082_0081925_2016_2618 198
127 3300031235 Ga0265330_10034889 Ga0265330_100348892 199
128 3300031247 Ga0265340_10003608 Ga0265340_1000360810 199
129 3300031247 Ga0265340_10257093 Ga0265340_102570931 199
130 3300031711 Ga0265314_10180725 Ga0265314_101807252 199
131 3300031712 Ga0265342_10178464 Ga0265342_101784642 199
132 3300039062 Ga0400483_134809 Ga0400483_134809_84_692 199
133 3300049572 Ga0501036_0184691 Ga0501036_0184691_885_1508 199
134 3300031247 Ga0265340_10001383 Ga0265340_100013835 200
135 3300031249 Ga0265339_10079841 Ga0265339_100798412 200
136 3300031344 Ga0265316_10010377 Ga0265316_100103773 200
137 3300031595 Ga0265313_10005153 Ga0265313_1000515310 200
138 3300031711 Ga0265314_10106472 Ga0265314_101064723 200
139 3300031712 Ga0265342_10002116 Ga0265342_100021167 200
140 3300049568 Ga0501031_0656512 Ga0501031_0656512_14_619 200
141 3300049572 Ga0501036_0025328 Ga0501036_0025328_148_753 200
142 3300049581 Ga0501047_0028951 Ga0501047_0028951_4412_5017 200
143 3300049582 Ga0501048_0055255 Ga0501048_0055255_1709_2314 200
144 3300049583 Ga0501067_0000181 Ga0501067_0000181_15734_16339 200
145 3300049585 Ga0501069_0078819 Ga0501069_0078819_1040_1645 200
146 3300049586 Ga0501070_0137348 Ga0501070_0137348_1216_1821 200
147 3300049589 Ga0501073_0060093 Ga0501073_0060093_1850_2455 200
148 3300049741 Ga0501079_0085688 Ga0501079_0085688_1070_1675 200
149 3300049742 Ga0501080_0119183 Ga0501080_0119183_401_1006 200
150 3300049822 Ga0501035_0004027 Ga0501035_0004027_10344_10949 200
151 3300049823 Ga0501044_0014583 Ga0501044_0014583_2029_2634 200
152 3300054114 Ga0501084_0001715 Ga0501084_0001715_16383_16988 200
153 3300060353 Ga0501082_0028223 Ga0501082_0028223_1577_2182 200
154 3300005441 Ga0070700_100443330 Ga0070700_1004433301 201
155 3300005563 Ga0068855_100283974 Ga0068855_1002839742 201
156 3300005563 Ga0068855_100333991 Ga0068855_1003339912 201
157 3300006846 Ga0075430_100181898 Ga0075430_1001818983 201
158 3300009093 Ga0105240_10042782 Ga0105240_100427827 201
159 3300009094 Ga0111539_10113621 Ga0111539_101136213 201
160 3300009094 Ga0111539_10485333 Ga0111539_104853332 201
161 3300013104 Ga0157370_10027880 Ga0157370_100278804 201
162 3300025913 Ga0207695_10053130 Ga0207695_100531302 201
163 3300025913 Ga0207695_10127135 Ga0207695_101271353 201
164 3300025913 Ga0207695_10222926 Ga0207695_102229262 201
165 3300025921 Ga0207652_10387233 Ga0207652_103872332 201
166 3300025928 Ga0207700_10216766 Ga0207700_102167662 201
167 3300025949 Ga0207667_10116424 Ga0207667_101164242 201
168 3300025949 Ga0207667_10190236 Ga0207667_101902362 201
169 3300028800 Ga0265338_10004163 Ga0265338_100041635 201
170 3300031235 Ga0265330_10037051 Ga0265330_100370513 201
171 3300031250 Ga0265331_10050492 Ga0265331_100504922 201
172 3300031711 Ga0265314_10077663 Ga0265314_100776632 201
173 3300031711 Ga0265314_10078037 Ga0265314_100780372 201
174 3300031712 Ga0265342_10030572 Ga0265342_100305724 201
175 3300042461 Ga0439460_0078247 Ga0439460_0078247_132_740 201
176 3300045976 Ga0466967_0504101 Ga0466967_0504101_442_1053 201
177 3300046684 Ga0495669_0337712 Ga0495669_0337712_63_668 201
178 3300049577 Ga0501041_0197721 Ga0501041_0197721_168_776 201
179 3300049581 Ga0501047_0002217 Ga0501047_0002217_47_655 201
180 3300049583 Ga0501067_0005837 Ga0501067_0005837_3852_4460 201
181 3300049588 Ga0501072_0011727 Ga0501072_0011727_676_1284 201
182 3300049589 Ga0501073_0004754 Ga0501073_0004754_6318_6926 201
183 3300049590 Ga0501074_0096962 Ga0501074_0096962_1070_1678 201
184 3300049741 Ga0501079_0299987 Ga0501079_0299987_170_778 201
185 3300049742 Ga0501080_0844828 Ga0501080_0844828_27_719 201
186 3300049823 Ga0501044_0049225 Ga0501044_0049225_1066_1686 201
187 3300050509 nmdc:mga0qj67_259428_c1 nmdc:mga0qj67_259428_c1_322_930 201
188 3300050511 nmdc:mga08y16_389239_c1 nmdc:mga08y16_389239_c1_698_1306 201
189 3300054114 Ga0501084_0056393 Ga0501084_0056393_1021_1629 201
190 3300054114 Ga0501084_0117600 Ga0501084_0117600_824_1432 201
191 3300061734 Ga0530510_0142470 Ga0530510_0142470_389_997 201
192 3300061734 Ga0530510_0416673 Ga0530510_0416673_356_964 201
193 3300005340 Ga0070689_100139620 Ga0070689_1001396202 202
194 3300005347 Ga0070668_100105307 Ga0070668_1001053073 202
195 3300005356 Ga0070674_100590503 Ga0070674_1005905031 202
196 3300005364 Ga0070673_100252484 Ga0070673_1002524842 202
197 3300005441 Ga0070700_100586841 Ga0070700_1005868411 202
198 3300005444 Ga0070694_100378665 Ga0070694_1003786652 202
199 3300005457 Ga0070662_100315240 Ga0070662_1003152402 202
200 3300005544 Ga0070686_100066624 Ga0070686_1000666243 202
201 3300005578 Ga0068854_100219346 Ga0068854_1002193462 202
202 3300005719 Ga0068861_100095372 Ga0068861_1000953723 202
203 3300005842 Ga0068858_100324371 Ga0068858_1003243712 202
204 3300006237 Ga0097621_100053334 Ga0097621_1000533343 202
205 3300006358 Ga0068871_100245014 Ga0068871_1002450142 202
206 3300009148 Ga0105243_10047782 Ga0105243_100477823 202
207 3300011119 Ga0105246_10082605 Ga0105246_100826053 202
208 3300013297 Ga0157378_10662093 Ga0157378_106620932 202
209 3300013308 Ga0157375_10138794 Ga0157375_101387943 202
210 3300014968 Ga0157379_10319705 Ga0157379_103197052 202
211 3300014969 Ga0157376_10010729 Ga0157376_100107298 202
212 3300017792 Ga0163161_10035309 Ga0163161_100353092 202
213 3300025899 Ga0207642_10129433 Ga0207642_101294332 202
214 3300025923 Ga0207681_10435912 Ga0207681_104359121 202
215 3300025961 Ga0207712_10086685 Ga0207712_100866852 202
216 3300025981 Ga0207640_10398919 Ga0207640_103989192 202
217 3300026035 Ga0207703_10337404 Ga0207703_103374042 202
218 3300026041 Ga0207639_11314203 Ga0207639_113142031 202
219 3300026075 Ga0207708_10033276 Ga0207708_100332762 202
220 3300026089 Ga0207648_10052179 Ga0207648_100521793 202
221 3300026118 Ga0207675_100113945 Ga0207675_1001139452 202
222 3300031247 Ga0265340_10005883 Ga0265340_100058836 202
223 3300046523 Ga0495644_0182023 Ga0495644_0182023_99_710 202
224 3300048904 Ga0496101_0009386 Ga0496101_0009386_2279_2890 202
225 3300048905 Ga0496102_0211486 Ga0496102_0211486_867_1478 202
226 3300048907 Ga0496104_0062088 Ga0496104_0062088_459_1070 202
227 3300048910 Ga0496107_0043086 Ga0496107_0043086_2262_2873 202
228 3300048917 Ga0496114_0003066 Ga0496114_0003066_3930_4541 202
229 3300049569 Ga0501032_0228092 Ga0501032_0228092_313_936 202
230 3300049571 Ga0501034_0122574 Ga0501034_0122574_1591_2214 202
231 3300049571 Ga0501034_0193016 Ga0501034_0193016_668_1300 202
232 3300049573 Ga0501037_0259493 Ga0501037_0259493_413_1036 202
233 3300049583 Ga0501067_0003609 Ga0501067_0003609_6675_7310 202
234 3300049586 Ga0501070_0427439 Ga0501070_0427439_299_922 202
235 3300049589 Ga0501073_0462141 Ga0501073_0462141_117_728 202
236 3300049590 Ga0501074_0030882 Ga0501074_0030882_2153_2845 202
237 3300049744 Ga0501083_0053356 Ga0501083_0053356_923_1534 202
238 3300049744 Ga0501083_0100564 Ga0501083_0100564_646_1338 202
239 3300049823 Ga0501044_0212073 Ga0501044_0212073_504_1127 202
240 3300054114 Ga0501084_0051806 Ga0501084_0051806_1886_2578 202
241 3300054114 Ga0501084_0142518 Ga0501084_0142518_1181_1813 202
242 3300060353 Ga0501082_0013815 Ga0501082_0013815_6201_6812 202
243 3300060353 Ga0501082_0023545 Ga0501082_0023545_3378_4070 202
244 3300060353 Ga0501082_0231982 Ga0501082_0231982_437_1072 202
245 3300009093 Ga0105240_10235392 Ga0105240_102353921 203
246 3300013105 Ga0157369_10348260 Ga0157369_103482602 203
247 3300037312 Ga0395899_0086300 Ga0395899_0086300_1030_1647 203
248 3300037418 Ga0395900_0009747 Ga0395900_0009747_8883_9500 203
249 3300037466 Ga0395898_0015029 Ga0395898_0015029_6071_6688 203
250 3300049571 Ga0501034_0057093 Ga0501034_0057093_3196_3834 203
251 3300049578 Ga0501042_0180749 Ga0501042_0180749_649_1278 203
252 3300049589 Ga0501073_0020963 Ga0501073_0020963_1822_2439 203
253 3300049742 Ga0501080_0031899 Ga0501080_0031899_3011_3628 203
254 3300005327 Ga0070658_10011434 Ga0070658_100114347 204
255 3300005336 Ga0070680_100715220 Ga0070680_1007152202 204
256 3300005339 Ga0070660_100253839 Ga0070660_1002538391 204
257 3300005530 Ga0070679_100150005 Ga0070679_1001500052 204
258 3300005548 Ga0070665_100001946 Ga0070665_1000019462 204
259 3300009093 Ga0105240_10266296 Ga0105240_102662962 204
260 3300025909 Ga0207705_10014909 Ga0207705_100149094 204
261 3300025919 Ga0207657_10036998 Ga0207657_100369982 204
262 3300025921 Ga0207652_10213245 Ga0207652_102132452 204
263 3300026041 Ga0207639_10610040 Ga0207639_106100402 204
264 3300028379 Ga0268266_10000847 Ga0268266_1000084731 204
265 3300035695 Ga0373927_0149766 Ga0373927_0149766_598_1233 204
266 3300049583 Ga0501067_0251091 Ga0501067_0251091_113_727 204
267 3300049593 Ga0501077_0272120 Ga0501077_0272120_58_693 204
268 3300049823 Ga0501044_0844307 Ga0501044_0844307_68_688 204
269 3300005347 Ga0070668_100421155 Ga0070668_1004211552 205
270 3300005347 Ga0070668_100599011 Ga0070668_1005990112 205
271 3300005367 Ga0070667_100454057 Ga0070667_1004540573 205
272 3300005844 Ga0068862_100043481 Ga0068862_1000434812 205
273 3300006048 Ga0075363_100001050 Ga0075363_10000105010 205
274 3300006048 Ga0075363_100068636 Ga0075363_1000686363 205
275 3300006178 Ga0075367_10001270 Ga0075367_100012705 205
276 3300006178 Ga0075367_10007982 Ga0075367_100079824 205
277 3300006844 Ga0075428_100006310 Ga0075428_1000063108 205
278 3300009094 Ga0111539_10319012 Ga0111539_103190121 205
279 3300009147 Ga0114129_10125554 Ga0114129_101255543 205
280 3300025972 Ga0207668_10671781 Ga0207668_106717812 205
281 3300025986 Ga0207658_10367431 Ga0207658_103674312 205
282 3300026075 Ga0207708_10071522 Ga0207708_100715222 205
283 3300028380 Ga0268265_10081538 Ga0268265_100815382 205
284 3300028381 Ga0268264_11016333 Ga0268264_110163331 205
285 3300031995 Ga0307409_100529140 Ga0307409_1005291402 205
286 3300049571 Ga0501034_0040039 Ga0501034_0040039_21_641 205
287 3300049576 Ga0501040_0078366 Ga0501040_0078366_1608_2252 205
288 3300049583 Ga0501067_0062414 Ga0501067_0062414_137_760 205
289 3300049584 Ga0501068_0357146 Ga0501068_0357146_22_639 205
290 3300050490 nmdc:mga03n38_34413_c1 nmdc:mga03n38_34413_c1_133_759 205
291 3300050490 nmdc:mga03n38_69159_c1 nmdc:mga03n38_69159_c1_290_925 205
292 3300050491 nmdc:mga00v17_96632_c1 nmdc:mga00v17_96632_c1_680_1315 205
293 3300050492 nmdc:mga0yw44_29967_c1 nmdc:mga0yw44_29967_c1_1116_1742 205
294 3300050492 nmdc:mga0yw44_64775_c1 nmdc:mga0yw44_64775_c1_1224_1859 205
295 3300050494 nmdc:mga06z11_3052_c2 nmdc:mga06z11_3052_c2_1355_1981 205
296 3300050495 nmdc:mga04h51_17519_c1 nmdc:mga04h51_17519_c1_757_1392 205
297 3300050495 nmdc:mga04h51_37007_c1 nmdc:mga04h51_37007_c1_793_1410 205
298 3300053727 Ga0500611_046423 Ga0500611_046423_251_877 205
299 3300060353 Ga0501082_0041818 Ga0501082_0041818_711_1331 205
300 3300003659 JGI25404J52841_10021865 JGI25404J52841_100218652 206
301 3300005328 Ga0070676_10575905 Ga0070676_105759051 206
302 3300005341 Ga0070691_10014693 Ga0070691_100146933 206
303 3300005347 Ga0070668_100220394 Ga0070668_1002203941 206
304 3300005365 Ga0070688_100365260 Ga0070688_1003652602 206
305 3300005434 Ga0070709_10773895 Ga0070709_107738951 206
306 3300005444 Ga0070694_100109618 Ga0070694_1001096182 206
307 3300005455 Ga0070663_100158309 Ga0070663_1001583093 206
308 3300005457 Ga0070662_100870056 Ga0070662_1008700561 206
309 3300005545 Ga0070695_100016385 Ga0070695_1000163852 206
310 3300005617 Ga0068859_100287730 Ga0068859_1002877302 206
311 3300005617 Ga0068859_100834327 Ga0068859_1008343272 206
312 3300005842 Ga0068858_100194749 Ga0068858_1001947492 206
313 3300005937 Ga0081455_10000017 Ga0081455_1000001799 206
314 3300005983 Ga0081540_1000059 Ga0081540_100005946 206
315 3300006038 Ga0075365_10015020 Ga0075365_100150201 206
316 3300006163 Ga0070715_10169331 Ga0070715_101693311 206
317 3300006844 Ga0075428_100257988 Ga0075428_1002579883 206
318 3300006844 Ga0075428_100694420 Ga0075428_1006944202 206
319 3300006847 Ga0075431_100000736 Ga0075431_10000073629 206
320 3300006847 Ga0075431_100002411 Ga0075431_10000241114 206
321 3300006847 Ga0075431_100087540 Ga0075431_1000875403 206
322 3300006847 Ga0075431_100258653 Ga0075431_1002586532 206
323 3300006852 Ga0075433_10002019 Ga0075433_1000201916 206
324 3300006852 Ga0075433_10353753 Ga0075433_103537531 206
325 3300006871 Ga0075434_100002448 Ga0075434_1000024486 206
326 3300006914 Ga0075436_100171053 Ga0075436_1001710533 206
327 3300006931 Ga0097620_100287723 Ga0097620_1002877232 206
328 3300006931 Ga0097620_100834339 Ga0097620_1008343392 206
329 3300007076 Ga0075435_100047066 Ga0075435_1000470663 206
330 3300009094 Ga0111539_10065251 Ga0111539_100652514 206
331 3300009147 Ga0114129_10047596 Ga0114129_100475966 206
332 3300009147 Ga0114129_10320934 Ga0114129_103209343 206
333 3300013297 Ga0157378_11018638 Ga0157378_110186382 206
334 3300014325 Ga0163163_10124859 Ga0163163_101248592 206
335 3300014325 Ga0163163_10497751 Ga0163163_104977512 206
336 3300014326 Ga0157380_10067047 Ga0157380_100670473 206
337 3300014326 Ga0157380_10603927 Ga0157380_106039271 206
338 3300014968 Ga0157379_10327011 Ga0157379_103270112 206
339 3300014968 Ga0157379_10780274 Ga0157379_107802742 206
340 3300014968 Ga0157379_11172076 Ga0157379_111720761 206
341 3300025905 Ga0207685_10192603 Ga0207685_101926031 206
342 3300025906 Ga0207699_10730064 Ga0207699_107300641 206
343 3300025936 Ga0207670_10399344 Ga0207670_103993442 206
344 3300025945 Ga0207679_10629838 Ga0207679_106298381 206
345 3300025972 Ga0207668_10197321 Ga0207668_101973211 206
346 3300025972 Ga0207668_10518283 Ga0207668_105182832 206
347 3300026118 Ga0207675_100452858 Ga0207675_1004528582 206
348 3300026118 Ga0207675_100866457 Ga0207675_1008664572 206
349 3300026121 Ga0207683_10418838 Ga0207683_104188381 206
350 3300028379 Ga0268266_10756255 Ga0268266_107562551 206
351 3300034819 Ga0373958_0059477 Ga0373958_0059477_185_808 206
352 3300034957 Ga0373938_0022074 Ga0373938_0022074_90_713 206
353 3300035085 Ga0373929_0013887 Ga0373929_0013887_154_777 206
354 3300035085 Ga0373929_0024358 Ga0373929_0024358_95_715 206
355 3300035092 Ga0373952_0024168 Ga0373952_0024168_365_985 206
356 3300035092 Ga0373952_0030450 Ga0373952_0030450_321_944 206
357 3300035114 Ga0373939_0024483 Ga0373939_0024483_895_1518 206
358 3300035114 Ga0373939_0041606 Ga0373939_0041606_333_953 206
359 3300035115 Ga0373941_0001936 Ga0373941_0001936_241_864 206
360 3300035121 Ga0373960_0163651 Ga0373960_0163651_11_634 206
361 3300035241 Ga0373961_0009577 Ga0373961_0009577_1727_2350 206
362 3300035241 Ga0373961_0046615 Ga0373961_0046615_125_745 206
363 3300035242 Ga0373962_0020519 Ga0373962_0020519_117_740 206
364 3300035691 Ga0373931_0001487 Ga0373931_0001487_37_657 206
365 3300035691 Ga0373931_0005459 Ga0373931_0005459_1973_2596 206
366 3300035725 Ga0373947_0337712 Ga0373947_0337712_274_903 206
367 3300046455 Ga0495603_0105330 Ga0495603_0105330_212_841 206
368 3300046491 Ga0495584_0063798 Ga0495584_0063798_757_1377 206
369 3300046499 Ga0495594_0071923 Ga0495594_0071923_396_1025 206
370 3300046660 Ga0495625_0162194 Ga0495625_0162194_456_1082 206
371 3300048906 Ga0496103_0190178 Ga0496103_0190178_137_769 206
372 3300048907 Ga0496104_0000631 Ga0496104_0000631_6649_7284 206
373 3300048907 Ga0496104_0133347 Ga0496104_0133347_213_845 206
374 3300048908 Ga0496105_0054587 Ga0496105_0054587_949_1581 206
375 3300048911 Ga0496108_0001447 Ga0496108_0001447_17069_17704 206
376 3300048911 Ga0496108_0157595 Ga0496108_0157595_1186_1818 206
377 3300048911 Ga0496108_0160319 Ga0496108_0160319_1089_1730 206
378 3300048911 Ga0496108_0851055 Ga0496108_0851055_52_702 206
379 3300048912 Ga0496109_0036782 Ga0496109_0036782_761_1396 206
380 3300048912 Ga0496109_0203057 Ga0496109_0203057_147_779 206
381 3300048913 Ga0496110_0005498 Ga0496110_0005498_3644_4279 206
382 3300048913 Ga0496110_0352122 Ga0496110_0352122_559_1191 206
383 3300048913 Ga0496110_0466971 Ga0496110_0466971_478_1119 206
384 3300048914 Ga0496111_0012936 Ga0496111_0012936_832_1467 206
385 3300048914 Ga0496111_0130424 Ga0496111_0130424_362_994 206
386 3300048914 Ga0496111_0414614 Ga0496111_0414614_240_881 206
387 3300048915 Ga0496112_0056950 Ga0496112_0056950_1206_1841 206
388 3300048915 Ga0496112_0192565 Ga0496112_0192565_1358_1990 206
389 3300048916 Ga0496113_0001476 Ga0496113_0001476_9134_9769 206
390 3300048918 Ga0496115_0055302 Ga0496115_0055302_2120_2752 206
391 3300049572 Ga0501036_0323985 Ga0501036_0323985_111_758 206
392 3300049575 Ga0501039_0084309 Ga0501039_0084309_98_736 206
393 3300049576 Ga0501040_0084508 Ga0501040_0084508_1450_2088 206
394 3300049577 Ga0501041_0058666 Ga0501041_0058666_369_1016 206
395 3300049578 Ga0501042_0255678 Ga0501042_0255678_183_830 206
396 3300049580 Ga0501046_0032180 Ga0501046_0032180_2461_3108 206
397 3300049591 Ga0501075_0102807 Ga0501075_0102807_1293_1931 206
398 3300049591 Ga0501075_0118743 Ga0501075_0118743_208_855 206
399 3300049741 Ga0501079_0044753 Ga0501079_0044753_2645_3283 206
400 3300049741 Ga0501079_0116914 Ga0501079_0116914_1194_1841 206
401 3300049743 Ga0501081_0047893 Ga0501081_0047893_1945_2592 206
402 3300049743 Ga0501081_0085530 Ga0501081_0085530_762_1400 206
403 3300050507 nmdc:mga05p37_289249_c1 nmdc:mga05p37_289249_c1_1037_1666 206
404 3300050510 nmdc:mga06r32_1698_c1 nmdc:mga06r32_1698_c1_9608_10240 206
405 3300050510 nmdc:mga06r32_18858_c1 nmdc:mga06r32_18858_c1_28_675 206
406 3300050510 nmdc:mga06r32_357392_c1 nmdc:mga06r32_357392_c1_720_1349 206
407 3300050510 nmdc:mga06r32_480777_c1 nmdc:mga06r32_480777_c1_550_1179 206
408 3300050511 nmdc:mga08y16_156060_c1 nmdc:mga08y16_156060_c1_115_735 206
409 3300050512 nmdc:mga0n895_47419_c1 nmdc:mga0n895_47419_c1_909_1529 206
410 3300050513 nmdc:mga0rr50_39758_c1 nmdc:mga0rr50_39758_c1_1196_1825 206
411 3300050514 nmdc:mga08x19_153944_c1 nmdc:mga08x19_153944_c1_703_1344 206
412 3300050515 nmdc:mga0a205_1678_c1 nmdc:mga0a205_1678_c1_5706_6326 206
413 3300050515 nmdc:mga0a205_330401_c1 nmdc:mga0a205_330401_c1_609_1229 206
414 3300053085 Ga0495619_0426960 Ga0495619_0426960_115_744 206
415 3300054114 Ga0501084_0333559 Ga0501084_0333559_520_1158 206
416 3300060353 Ga0501082_0050413 Ga0501082_0050413_256_903 206
417 3300060353 Ga0501082_0459889 Ga0501082_0459889_132_758 206
418 3300061734 Ga0530510_0078048 Ga0530510_0078048_254_901 206

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01725

Ham1p_like

Ham1 family

34

227

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2q16-assembly1.cif.gz_B structure of the e. coli inosine triphosphate pyrophosphatase rgdb in complex with itp 0.9316 11 201
3s86-assembly1.cif.gz_D crystal structure of tm0159 with bound imp 0.9283 9 201
2q16-assembly1.cif.gz_B structure of the e. coli inosine triphosphate pyrophosphatase rgdb in complex with itp 0.913 11 201
3tqu-assembly2.cif.gz_D structure of a ham1 protein from coxiella burnetii 0.9125 9 201
4bnq-assembly1.cif.gz_B the structure of the staphylococcus aureus ham1 protein 0.8961 10 201
ID Description Score Start End Superfamily
af_P52061_1_197_3.90.950.10 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.9449 9 201 3.90.950.10
3s86D00 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.9283 9 201 3.90.950.10
af_P52061_1_197_3.90.950.10 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.9171 9 201 3.90.950.10
af_Q2FZC5_1_195_3.90.950.10 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.9167 9 198 3.90.950.10
af_Q9UU89_2_186_3.90.950.10 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.9088 10 201 3.90.950.10
ID Description Score Start End GO Terms
AF-A0A317HU07-F1-model_v4 deleted 0.9834 26 203
AF-A0A1H0D667-F1-model_v4 dITP/XTP pyrophosphatase (EC 3.6.1.66) (Non-canonical purine NTP pyrophosphatase) (Non-standard purine NTP pyrophosphatase) (Nucleoside-triphosphate diphosphatase) (Nucleoside-triphosphate pyrophosphatase) (NTPase) 0.981 1 203 GO:0000166
GO:0005829
GO:0009117
GO:0009146
GO:0017111
GO:0035870
GO:0036220
GO:0036222
GO:0046872
AF-A0A845MKD1-F1-model_v4 dITP/XTP pyrophosphatase (EC 3.6.1.66) (Non-canonical purine NTP pyrophosphatase) (Non-standard purine NTP pyrophosphatase) (Nucleoside-triphosphate diphosphatase) (Nucleoside-triphosphate pyrophosphatase) (NTPase) 0.9793 3 206 GO:0000166
GO:0005829
GO:0009117
GO:0009146
GO:0017111
GO:0046872
GO:0047429
AF-A0A2A5DYS1-F1-model_v4 dITP/XTP pyrophosphatase (EC 3.6.1.66) (Non-canonical purine NTP pyrophosphatase) (Non-standard purine NTP pyrophosphatase) (Nucleoside-triphosphate diphosphatase) (Nucleoside-triphosphate pyrophosphatase) (NTPase) 0.9709 1 202 GO:0000166
GO:0005829
GO:0009117
GO:0009146
GO:0017111
GO:0035870
GO:0036220
GO:0036222
GO:0046872
AF-A0A0N1BKL6-F1-model_v4 dITP/XTP pyrophosphatase (EC 3.6.1.66) (Non-canonical purine NTP pyrophosphatase) (Non-standard purine NTP pyrophosphatase) (Nucleoside-triphosphate diphosphatase) (Nucleoside-triphosphate pyrophosphatase) (NTPase) 0.9706 1 205 GO:0000166
GO:0005829
GO:0009117
GO:0009146
GO:0017111
GO:0035870
GO:0036220
GO:0036222
GO:0046872

Feature Viewer

pLDDT pTM Quality
94.08 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map