F439240

General Info

Members Datasets Scaffolds Average Seq Length
418 184 810 135

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_101103725|Ga0070708_1011037251
Length 158
Sequence MTPDAYNNEKDASGRLYTCISRMEVSVKAKLTVLGAGLLMAAMPMLAHHSFAAEYDSTKPVSVSGTVTKVEWMNPHARFYVDVKDESGKVTNWEFELGSPNGLMRQGWTRNSMKVGDQVGVEGYLAKDGSKLGNARNIKTAEGKKLFAGSTTDGGPTQ

Samples

Sample ID Description Type Environment
1 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
2 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
3 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
6 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300019161 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA2 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
80 3300019177 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI1 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
81 3300019179 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI2 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
82 3300019182 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE1 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
83 3300019183 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA1 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
84 3300019188 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE2 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
85 3300019190 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
86 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
89 3300023536 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
90 3300023547 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
91 3300023672 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
92 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
134 3300030762 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
135 3300030836 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
136 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
137 3300030877 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
138 3300030880 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
139 3300030882 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
140 3300030888 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
141 3300030963 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
142 3300031010 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
143 3300031043 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
144 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
145 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
146 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
147 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
148 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
149 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
150 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
151 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
152 3300031814 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
153 3300032120 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
154 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
155 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
156 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
157 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
158 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
159 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
160 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
161 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
162 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
163 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
164 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
165 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
166 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
167 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
168 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
169 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
170 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
171 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
172 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
173 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
174 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
175 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
176 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
177 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
178 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
179 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
180 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
181 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
182 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
183 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
184 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.12
Metatranscriptomes 13.88
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.2
Rhizosphere 96.65
Stem 0
Stem Tuber 0
Unclassified 52.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070708_101103725 3300005445 Unclassified 743
2 Ga0058859_10015619 3300004798 Unclassified 545
3 Ga0058863_11862400 3300004799 Bacteria 554
4 Ga0058861_12052172 3300004800 Bacteria 606
5 Ga0058860_10075199 3300004801 Unclassified 615
6 Ga0058862_12785879 3300004803 Unclassified 1061
7 Ga0070658_10119218 3300005327 Unclassified 2192
8 Ga0070683_100944034 3300005329 Bacteria 828
9 Ga0070690_100163471 3300005330 Bacteria 1527
10 Ga0068869_100718948 3300005334 Unclassified 853
11 Ga0070666_10012430 3300005335 Bacteria 5371
12 Ga0070666_10658651 3300005335 Unclassified 766
13 Ga0070680_100989280 3300005336 Unclassified 726
14 Ga0070682_100366121 3300005337 Bacteria 1079
15 Ga0070682_101218132 3300005337 Unclassified 636
16 Ga0068868_100020748 3300005338 Unclassified 4943
17 Ga0068868_100039710 3300005338 Unclassified 3658
18 Ga0068868_100156184 3300005338 Bacteria 1882
19 Ga0070660_100051775 3300005339 Bacteria 3163
20 Ga0070660_100605324 3300005339 Unclassified 916
21 Ga0070689_100094878 3300005340 Bacteria 2356
22 Ga0070661_100076598 3300005344 Bacteria 2465
23 Ga0070661_100133319 3300005344 Bacteria 1867
24 Ga0070661_100217541 3300005344 Unclassified 1464
25 Ga0070661_100513908 3300005344 Unclassified 960
26 Ga0070675_100516884 3300005354 Unclassified 1077
27 Ga0070674_100396870 3300005356 Unclassified 1126
28 Ga0070688_100834411 3300005365 Unclassified 723
29 Ga0070659_100741852 3300005366 Unclassified 851
30 Ga0070667_100086941 3300005367 Bacteria 2683
31 Ga0070667_100146795 3300005367 Bacteria 2069
32 Ga0070709_10715639 3300005434 Unclassified 780
33 Ga0070709_11195565 3300005434 Viruses 611
34 Ga0070713_100042270 3300005436 Bacteria 3719
35 Ga0070710_10818849 3300005437 Bacteria 666
36 Ga0070708_100242974 3300005445 Bacteria 1690
37 Ga0070678_100926015 3300005456 Bacteria 798
38 Ga0070681_10040882 3300005458 Unclassified 4645
39 Ga0070681_10081042 3300005458 Unclassified 3201
40 Ga0070681_10298566 3300005458 Bacteria 1521
41 Ga0068867_100039796 3300005459 Unclassified 3429
42 Ga0068867_100099010 3300005459 Unclassified 2224
43 Ga0070706_101925123 3300005467 Unclassified 536
44 Ga0070707_100001855 3300005468 Bacteria 20307
45 Ga0070707_100149901 3300005468 Bacteria 2271
46 Ga0070699_100281262 3300005518 Unclassified 1490
47 Ga0070679_100222391 3300005530 Unclassified 1849
48 Ga0070679_101067311 3300005530 Unclassified 752
49 Ga0070684_100031689 3300005535 Unclassified 4502
50 Ga0070684_100057237 3300005535 Bacteria 3403
51 Ga0070684_100164481 3300005535 Bacteria 2014
52 Ga0070684_100448975 3300005535 Unclassified 1192
53 Ga0070697_101040740 3300005536 Unclassified 728
54 Ga0068853_100061844 3300005539 Unclassified 3239
55 Ga0068853_101223695 3300005539 Unclassified 725
56 Ga0070696_101231652 3300005546 Unclassified 633
57 Ga0070693_100237471 3300005547 Bacteria 1202
58 Ga0070665_100292701 3300005548 Bacteria 1630
59 Ga0070665_101248257 3300005548 Unclassified 753
60 Ga0070665_101440663 3300005548 Unclassified 698
61 Ga0070665_101480583 3300005548 Unclassified 687
62 Ga0068855_100020451 3300005563 Bacteria 7937
63 Ga0068855_100060280 3300005563 Unclassified 4438
64 Ga0068855_100103147 3300005563 Bacteria 3282
65 Ga0068855_100176672 3300005563 Unclassified 2416
66 Ga0068855_100222611 3300005563 Bacteria 2115
67 Ga0068855_100254186 3300005563 Unclassified 1959
68 Ga0068855_100463249 3300005563 Unclassified 1382
69 Ga0068855_101030201 3300005563 Unclassified 863
70 Ga0070664_100018189 3300005564 Bacteria 5769
71 Ga0070664_100142081 3300005564 Bacteria 2114
72 Ga0070664_100270108 3300005564 Unclassified 1532
73 Ga0070664_100356607 3300005564 Bacteria 1331
74 Ga0068857_100034762 3300005577 Bacteria 4458
75 Ga0068857_100042498 3300005577 Unclassified 4033
76 Ga0068857_100073928 3300005577 Bacteria 3038
77 Ga0068857_100096283 3300005577 Unclassified 2652
78 Ga0068854_101521865 3300005578 Unclassified 608
79 Ga0068856_100011778 3300005614 Bacteria 8481
80 Ga0068856_100113992 3300005614 Bacteria 2702
81 Ga0068856_100159811 3300005614 Unclassified 2263
82 Ga0068856_100178029 3300005614 Unclassified 2139
83 Ga0068856_100294633 3300005614 Unclassified 1639
84 Ga0068852_100054909 3300005616 Unclassified 3436
85 Ga0068852_100075107 3300005616 Bacteria 2980
86 Ga0068852_100570714 3300005616 Bacteria 1133
87 Ga0068852_101485437 3300005616 Unclassified 700
88 Ga0068859_100132456 3300005617 Bacteria 2565
89 Ga0068859_100135567 3300005617 Unclassified 2534
90 Ga0068859_100867547 3300005617 Bacteria 988
91 Ga0068864_100325536 3300005618 Bacteria 1444
92 Ga0068864_100388032 3300005618 Bacteria 1325
93 Ga0068863_100010803 3300005841 Bacteria 8856
94 Ga0068863_100161947 3300005841 Bacteria 2144
95 Ga0068858_100028869 3300005842 Bacteria 5151
96 Ga0068858_100049857 3300005842 Unclassified 3876
97 Ga0068858_100424261 3300005842 Bacteria 1279
98 Ga0068858_100757141 3300005842 Unclassified 946
99 Ga0068860_100001444 3300005843 Bacteria 25740
100 Ga0070717_10058062 3300006028 Plasmid 3199
101 Ga0070716_100679184 3300006173 Unclassified 784
102 Ga0097621_100020566 3300006237 Bacteria 5087
103 Ga0097621_100104802 3300006237 Unclassified 2383
104 Ga0097621_100642365 3300006237 Unclassified 973
105 Ga0068871_100007234 3300006358 Bacteria 7918
106 Ga0068871_100018947 3300006358 Bacteria 5245
107 Ga0068871_100025680 3300006358 Unclassified 4586
108 Ga0075433_11548037 3300006852 Unclassified 572
109 Ga0068865_100002631 3300006881 Bacteria 10670
110 Ga0068865_100114376 3300006881 Bacteria 1996
111 Ga0068865_101592805 3300006881 Unclassified 587
112 Ga0097620_100132453 3300006931 Bacteria 2565
113 Ga0097620_100135575 3300006931 Unclassified 2534
114 Ga0097620_100867574 3300006931 Bacteria 988
115 Ga0075435_101480887 3300007076 Unclassified 595
116 Ga0105240_10133854 3300009093 Unclassified 2970
117 Ga0105240_10574312 3300009093 Unclassified 1244
118 Ga0105245_10007154 3300009098 Bacteria 9789
119 Ga0105245_10008311 3300009098 Bacteria 9070
120 Ga0105245_10069752 3300009098 Bacteria 3188
121 Ga0105245_10381237 3300009098 Unclassified 1404
122 Ga0105245_10940713 3300009098 Unclassified 907
123 Ga0105247_10417277 3300009101 Bacteria 960
124 Ga0105247_11061311 3300009101 Unclassified 637
125 Ga0105243_10885662 3300009148 Unclassified 887
126 Ga0105241_10000146 3300009174 Bacteria 50607
127 Ga0105241_10007994 3300009174 Bacteria 7779
128 Ga0105241_10086395 3300009174 Unclassified 2467
129 Ga0105241_10149116 3300009174 Unclassified 1912
130 Ga0105241_10274461 3300009174 Unclassified 1438
131 Ga0105241_10740715 3300009174 Unclassified 900
132 Ga0105241_10926439 3300009174 Unclassified 811
133 Ga0105242_10005122 3300009176 Bacteria 10110
134 Ga0105242_10016530 3300009176 Bacteria 5736
135 Ga0105242_10064759 3300009176 Unclassified 3014
136 Ga0105242_10140398 3300009176 Unclassified 2096
137 Ga0105242_11057374 3300009176 Unclassified 823
138 Ga0105248_10041582 3300009177 Bacteria 5153
139 Ga0105248_10078889 3300009177 Bacteria 3701
140 Ga0105248_10092943 3300009177 Bacteria 3397
141 Ga0105248_10410227 3300009177 Bacteria 1525
142 Ga0105248_10528594 3300009177 Unclassified 1330
143 Ga0105248_10622771 3300009177 Unclassified 1217
144 Ga0105248_12368943 3300009177 Unclassified 605
145 Ga0105237_10029304 3300009545 Bacteria 5597
146 Ga0105237_10046305 3300009545 Unclassified 4375
147 Ga0105237_10141601 3300009545 Unclassified 2399
148 Ga0105237_10493953 3300009545 Bacteria 1230
149 Ga0105237_11206882 3300009545 Unclassified 763
150 Ga0105238_10009230 3300009551 Bacteria 9870
151 Ga0105238_10014384 3300009551 Bacteria 7998
152 Ga0105238_10039724 3300009551 Unclassified 4772
153 Ga0105238_10083479 3300009551 Unclassified 3184
154 Ga0105239_10004050 3300010375 Bacteria 17713
155 Ga0105239_10009961 3300010375 Bacteria 10671
156 Ga0105239_10045008 3300010375 Unclassified 4837
157 Ga0105239_10246613 3300010375 Bacteria 2005
158 Ga0105239_10625599 3300010375 Unclassified 1229
159 Ga0105246_10007063 3300011119 Bacteria 6874
160 Ga0157370_10111084 3300013104 Bacteria 2562
161 Ga0157370_10124353 3300013104 Unclassified 2408
162 Ga0157370_10497251 3300013104 Unclassified 1120
163 Ga0157369_10180047 3300013105 Unclassified 2224
164 Ga0157369_10193518 3300013105 Bacteria 2136
165 Ga0157369_11707949 3300013105 Bacteria 640
166 Ga0157374_10007972 3300013296 Bacteria 9048
167 Ga0157374_10125361 3300013296 Bacteria 2482
168 Ga0157374_10799905 3300013296 Bacteria 959
169 Ga0157374_11045855 3300013296 Bacteria 836
170 Ga0157378_10077489 3300013297 Unclassified 2997
171 Ga0157378_10078918 3300013297 Bacteria 2971
172 Ga0163162_10068424 3300013306 Unclassified 3602
173 Ga0163162_10083600 3300013306 Unclassified 3266
174 Ga0163162_10103811 3300013306 Unclassified 2937
175 Ga0157372_10165806 3300013307 Bacteria 2555
176 Ga0157372_10346941 3300013307 Bacteria 1729
177 Ga0157372_10702611 3300013307 Bacteria 1177
178 Ga0157372_11174827 3300013307 Unclassified 887
179 Ga0157375_10127263 3300013308 Unclassified 2664
180 Ga0157375_10335078 3300013308 Bacteria 1678
181 Ga0163163_10088192 3300014325 Bacteria 3114
182 Ga0163163_10181416 3300014325 Bacteria 2152
183 Ga0163163_10214327 3300014325 Unclassified 1975
184 Ga0163163_10479185 3300014325 Bacteria 1305
185 Ga0157379_10032039 3300014968 Unclassified 4684
186 Ga0157379_10101647 3300014968 Unclassified 2580
187 Ga0157379_10478138 3300014968 Bacteria 1153
188 Ga0157376_10095945 3300014969 Unclassified 2580
189 Ga0184602_114935 3300019161 Unclassified 511
190 Ga0184592_117797 3300019177 Bacteria 501
191 Ga0184593_114052 3300019179 Bacteria 520
192 Ga0184593_114649 3300019179 Unclassified 596
193 Ga0184598_134573 3300019182 Unclassified 750
194 Ga0184598_139349 3300019182 Bacteria 754
195 Ga0184598_142580 3300019182 Unclassified 514
196 Ga0184601_114305 3300019183 Unclassified 664
197 Ga0184599_153226 3300019188 Unclassified 501
198 Ga0184600_144323 3300019190 Bacteria 706
199 Ga0206356_10390452 3300020070 Unclassified 693
200 Ga0206352_10862057 3300020078 Unclassified 697
201 Ga0213875_10005602 3300021388 Bacteria 6712
202 Ga0213875_10616341 3300021388 Unclassified 525
203 Ga0247552_103891 3300023536 Unclassified 523
204 Ga0247554_101439 3300023547 Unclassified 821
205 Ga0247554_103470 3300023547 Unclassified 619
206 Ga0247553_104578 3300023672 Unclassified 703
207 Ga0207680_10002408 3300025903 Bacteria 8720
208 Ga0207680_10080340 3300025903 Bacteria 2047
209 Ga0207699_10387661 3300025906 Unclassified 993
210 Ga0207705_10159364 3300025909 Bacteria 1695
211 Ga0207705_10253513 3300025909 Bacteria 1342
212 Ga0207654_10021749 3300025911 Bacteria 3414
213 Ga0207654_10040598 3300025911 Bacteria 2623
214 Ga0207654_10048070 3300025911 Unclassified 2440
215 Ga0207654_10278458 3300025911 Bacteria 1131
216 Ga0207654_10296703 3300025911 Unclassified 1098
217 Ga0207654_10381754 3300025911 Unclassified 976
218 Ga0207707_10006121 3300025912 Bacteria 10515
219 Ga0207707_10731053 3300025912 Unclassified 829
220 Ga0207695_10015863 3300025913 Bacteria 8849
221 Ga0207695_10021552 3300025913 Bacteria 7348
222 Ga0207695_10102436 3300025913 Unclassified 2856
223 Ga0207695_10152180 3300025913 Unclassified 2252
224 Ga0207695_10716933 3300025913 Unclassified 881
225 Ga0207695_10845529 3300025913 Unclassified 795
226 Ga0207671_10009411 3300025914 Bacteria 8168
227 Ga0207671_10035872 3300025914 Unclassified 3677
228 Ga0207671_10055248 3300025914 Bacteria 2942
229 Ga0207671_10308673 3300025914 Bacteria 1250
230 Ga0207671_10641727 3300025914 Unclassified 846
231 Ga0207660_10774420 3300025917 Unclassified 783
232 Ga0207657_10063195 3300025919 Bacteria 3166
233 Ga0207657_10111585 3300025919 Unclassified 2257
234 Ga0207657_10347992 3300025919 Bacteria 1169
235 Ga0207649_10067836 3300025920 Bacteria 2266
236 Ga0207649_10274190 3300025920 Unclassified 1224
237 Ga0207649_10375103 3300025920 Bacteria 1059
238 Ga0207652_10097257 3300025921 Bacteria 2594
239 Ga0207652_10241161 3300025921 Unclassified 1630
240 Ga0207646_10018911 3300025922 Bacteria 6415
241 Ga0207694_10001099 3300025924 Bacteria 23436
242 Ga0207694_10010213 3300025924 Bacteria 7078
243 Ga0207694_10056156 3300025924 Unclassified 3058
244 Ga0207694_10063164 3300025924 Bacteria 2885
245 Ga0207694_10577919 3300025924 Unclassified 944
246 Ga0207659_11519211 3300025926 Unclassified 573
247 Ga0207687_10009592 3300025927 Bacteria 6328
248 Ga0207687_10011413 3300025927 Bacteria 5807
249 Ga0207687_10012358 3300025927 Bacteria 5582
250 Ga0207687_10040588 3300025927 Bacteria 3191
251 Ga0207700_10017052 3300025928 Bacteria 4840
252 Ga0207700_10612107 3300025928 Unclassified 970
253 Ga0207700_10748495 3300025928 Unclassified 873
254 Ga0207690_10315251 3300025932 Unclassified 1228
255 Ga0207686_10013105 3300025934 Unclassified 4579
256 Ga0207686_10067102 3300025934 Bacteria 2294
257 Ga0207686_10084546 3300025934 Bacteria 2079
258 Ga0207686_10141392 3300025934 Unclassified 1664
259 Ga0207686_10153089 3300025934 Unclassified 1608
260 Ga0207686_10887142 3300025934 Unclassified 719
261 Ga0207709_10331826 3300025935 Bacteria 1142
262 Ga0207670_10070799 3300025936 Bacteria 2410
263 Ga0207669_10496889 3300025937 Unclassified 975
264 Ga0207704_10052419 3300025938 Bacteria 2473
265 Ga0207704_10934692 3300025938 Unclassified 731
266 Ga0207711_10029269 3300025941 Bacteria 4644
267 Ga0207711_10030189 3300025941 Bacteria 4571
268 Ga0207711_10058476 3300025941 Bacteria 3318
269 Ga0207711_10342167 3300025941 Unclassified 1384
270 Ga0207711_10421213 3300025941 Unclassified 1242
271 Ga0207711_11467202 3300025941 Unclassified 625
272 Ga0207689_10662840 3300025942 Unclassified 879
273 Ga0207661_10001587 3300025944 Bacteria 15474
274 Ga0207661_10210443 3300025944 Bacteria 1714
275 Ga0207661_10428450 3300025944 Bacteria 1202
276 Ga0207679_10015402 3300025945 Bacteria 5051
277 Ga0207679_10181466 3300025945 Bacteria 1742
278 Ga0207679_10251304 3300025945 Bacteria 1503
279 Ga0207667_10016434 3300025949 Bacteria 8362
280 Ga0207667_10035590 3300025949 Bacteria 5341
281 Ga0207667_10145156 3300025949 Unclassified 2443
282 Ga0207667_10256080 3300025949 Unclassified 1790
283 Ga0207667_10410948 3300025949 Unclassified 1377
284 Ga0207667_10467797 3300025949 Unclassified 1280
285 Ga0207667_11203877 3300025949 Unclassified 737
286 Ga0207640_10512567 3300025981 Bacteria 1001
287 Ga0207658_10399703 3300025986 Bacteria 1207
288 Ga0207677_10014300 3300026023 Bacteria 4631
289 Ga0207677_10017392 3300026023 Unclassified 4285
290 Ga0207677_10239067 3300026023 Unclassified 1468
291 Ga0207703_10006808 3300026035 Bacteria 9109
292 Ga0207703_10093854 3300026035 Bacteria 2528
293 Ga0207703_11269313 3300026035 Unclassified 708
294 Ga0207639_10040145 3300026041 Bacteria 3491
295 Ga0207639_10050466 3300026041 Unclassified 3160
296 Ga0207639_11197794 3300026041 Unclassified 713
297 Ga0207702_10016717 3300026078 Bacteria 6073
298 Ga0207702_10024920 3300026078 Bacteria 4964
299 Ga0207702_10068148 3300026078 Unclassified 3056
300 Ga0207702_10258900 3300026078 Bacteria 1637
301 Ga0207702_10265554 3300026078 Unclassified 1617
302 Ga0207702_10495812 3300026078 Bacteria 1190
303 Ga0207702_11116737 3300026078 Unclassified 782
304 Ga0207641_10079293 3300026088 Bacteria 2846
305 Ga0207641_10145225 3300026088 Bacteria 2144
306 Ga0207648_10004245 3300026089 Bacteria 14809
307 Ga0207648_10053765 3300026089 Unclassified 3519
308 Ga0207676_10610921 3300026095 Unclassified 1048
309 Ga0207674_10003767 3300026116 Bacteria 18504
310 Ga0207674_10064006 3300026116 Bacteria 3710
311 Ga0207674_10064159 3300026116 Unclassified 3705
312 Ga0207683_10277183 3300026121 Unclassified 1532
313 Ga0207698_10410792 3300026142 Unclassified 1296
314 Ga0207698_10636907 3300026142 Bacteria 1055
315 Ga0207698_11702404 3300026142 Unclassified 646
316 Ga0268266_10085068 3300028379 Bacteria 2763
317 Ga0268266_10713504 3300028379 Bacteria 967
318 Ga0268266_11679448 3300028379 Unclassified 610
319 Ga0268264_10034747 3300028381 Unclassified 4148
320 Ga0268264_10619344 3300028381 Unclassified 1068
321 Ga0265762_1041930 3300030760 Unclassified 898
322 Ga0265762_1090481 3300030760 Unclassified 667
323 Ga0265762_1127490 3300030760 Unclassified 587
324 Ga0265762_1163892 3300030760 Unclassified 537
325 Ga0265775_106877 3300030762 Bacteria 674
326 Ga0265775_109463 3300030762 Unclassified 603
327 Ga0265775_111192 3300030762 Bacteria 572
328 Ga0265775_111430 3300030762 Bacteria 568
329 Ga0265767_111260 3300030836 Unclassified 605
330 Ga0265767_112784 3300030836 Bacteria 583
331 Ga0265767_116534 3300030836 Unclassified 537
332 Ga0265766_1003102 3300030863 Unclassified 954
333 Ga0265766_1004621 3300030863 Unclassified 846
334 Ga0265766_1007312 3300030863 Unclassified 740
335 Ga0265766_1009775 3300030863 Unclassified 676
336 Ga0265766_1024804 3300030863 Unclassified 511
337 Ga0265777_103055 3300030877 Unclassified 1009
338 Ga0265776_109009 3300030880 Unclassified 576
339 Ga0265764_114105 3300030882 Unclassified 538
340 Ga0265769_111222 3300030888 Bacteria 621
341 Ga0265769_112885 3300030888 Unclassified 597
342 Ga0265769_113869 3300030888 Unclassified 585
343 Ga0265768_108797 3300030963 Unclassified 631
344 Ga0265768_115383 3300030963 Unclassified 530
345 Ga0265768_116628 3300030963 Unclassified 518
346 Ga0265768_117604 3300030963 Unclassified 508
347 Ga0265771_1027937 3300031010 Unclassified 526
348 Ga0265779_108737 3300031043 Unclassified 596
349 Ga0265760_10289864 3300031090 Unclassified 578
350 Ga0265325_10357663 3300031241 Unclassified 644
351 Ga0265329_10219256 3300031242 Bacteria 629
352 Ga0265340_10104523 3300031247 Bacteria 1314
353 Ga0265316_10067806 3300031344 Bacteria 2758
354 Ga0265313_10246939 3300031595 Unclassified 729
355 Ga0265314_10000932 3300031711 Bacteria 34486
356 Ga0265314_10010089 3300031711 Bacteria 7915
357 Ga0265314_10044081 3300031711 Bacteria 3165
358 Ga0265342_10034779 3300031712 Bacteria 3089
359 Ga0265342_10353324 3300031712 Unclassified 765
360 Ga0265342_10384980 3300031712 Bacteria 726
361 Ga0247548_103353 3300031814 Unclassified 720
362 Ga0247548_103629 3300031814 Unclassified 698
363 Ga0316053_120041 3300032120 Bacteria 520
364 Ga0373926_0145254 3300035083 Unclassified 902
365 Ga0373935_1016933 3300035692 Unclassified 616
366 Ga0373927_0096834 3300035695 Unclassified 1918
367 Ga0373933_0513537 3300035724 Unclassified 785
368 Ga0373933_0646084 3300035724 Bacteria 695
369 Ga0373947_0381554 3300035725 Bacteria 949
370 Ga0265778_038482 3300036457 Unclassified 633
371 Ga0265778_040089 3300036457 Unclassified 623
372 Ga0265778_050214 3300036457 Bacteria 570
373 Ga0265778_065697 3300036457 Unclassified 510
374 Ga0373925_0133424 3300037068 Unclassified 1938
375 Ga0436364_0068908 3300037853 Bacteria 1946
376 Ga0436364_0511250 3300037853 Unclassified 807
377 Ga0436364_1068537 3300037853 Bacteria 918
378 Ga0436364_1248520 3300037853 Bacteria 1963
379 Ga0436360_0438100 3300039438 Unclassified 932
380 Ga0436361_0693630 3300039447 Unclassified 615
381 Ga0436363_0307363 3300039450 Bacteria 2513
382 Ga0436362_1263546 3300039453 Unclassified 571
383 Ga0495651_0398752 3300046462 Bacteria 899
384 Ga0495580_0008802 3300046472 Bacteria 7990
385 Ga0495580_0022548 3300046472 Unclassified 4633
386 Ga0495584_0535757 3300046491 Bacteria 597
387 Ga0495628_0170980 3300046516 Bacteria 1648
388 Ga0495628_0686792 3300046516 Bacteria 724
389 Ga0495665_0580764 3300046531 Unclassified 561
390 Ga0495640_0573933 3300046533 Bacteria 683
391 Ga0495645_0470808 3300046543 Unclassified 790
392 Ga0495635_0961285 3300046663 Bacteria 545
393 Ga0495599_0129812 3300046678 Bacteria 1565
394 Ga0495658_0155530 3300046683 Bacteria 1407
395 Ga0495674_0308920 3300047319 Bacteria 1290
396 Ga0495680_0179149 3300047322 Bacteria 1531
397 Ga0495675_0656036 3300047444 Unclassified 591
398 Ga0495684_0630697 3300047471 Bacteria 719
399 Ga0496101_1524635 3300048904 Unclassified 520
400 Ga0496104_1522311 3300048907 Unclassified 572
401 Ga0496104_1656319 3300048907 Unclassified 542
402 Ga0496107_0988430 3300048910 Bacteria 611
403 Ga0496107_1020644 3300048910 Unclassified 600
404 nmdc:mga0a205_1314514_c1 3300050515 Unclassified 571
405 Ga0587102_032639 3300059649 Bacteria 642
406 Ga0070708_101103725
407 Ga0058859_10015619
408 Ga0058863_11862400
409 Ga0058861_12052172
410 Ga0058860_10075199
411 Ga0058862_12785879
412 Ga0070658_10119218
413 Ga0070683_100944034
414 Ga0070690_100163471
415 Ga0068869_100718948
416 Ga0070666_10012430
417 Ga0070666_10658651
418 Ga0070680_100989280
419 Ga0070682_100366121
420 Ga0070682_101218132
421 Ga0068868_100020748
422 Ga0068868_100039710
423 Ga0068868_100156184
424 Ga0070660_100051775
425 Ga0070660_100605324
426 Ga0070689_100094878
427 Ga0070661_100076598
428 Ga0070661_100133319
429 Ga0070661_100217541
430 Ga0070661_100513908
431 Ga0070675_100516884
432 Ga0070674_100396870
433 Ga0070688_100834411
434 Ga0070659_100741852
435 Ga0070667_100086941
436 Ga0070667_100146795
437 Ga0070709_10715639
438 Ga0070709_11195565
439 Ga0070713_100042270
440 Ga0070710_10818849
441 Ga0070708_100242974
442 Ga0070678_100926015
443 Ga0070681_10040882
444 Ga0070681_10081042
445 Ga0070681_10298566
446 Ga0068867_100039796
447 Ga0068867_100099010
448 Ga0070706_101925123
449 Ga0070707_100001855
450 Ga0070707_100149901
451 Ga0070699_100281262
452 Ga0070679_100222391
453 Ga0070679_101067311
454 Ga0070684_100031689
455 Ga0070684_100057237
456 Ga0070684_100164481
457 Ga0070684_100448975
458 Ga0070697_101040740
459 Ga0068853_100061844
460 Ga0068853_101223695
461 Ga0070696_101231652
462 Ga0070693_100237471
463 Ga0070665_100292701
464 Ga0070665_101248257
465 Ga0070665_101440663
466 Ga0070665_101480583
467 Ga0068855_100020451
468 Ga0068855_100060280
469 Ga0068855_100103147
470 Ga0068855_100176672
471 Ga0068855_100222611
472 Ga0068855_100254186
473 Ga0068855_100463249
474 Ga0068855_101030201
475 Ga0070664_100018189
476 Ga0070664_100142081
477 Ga0070664_100270108
478 Ga0070664_100356607
479 Ga0068857_100034762
480 Ga0068857_100042498
481 Ga0068857_100073928
482 Ga0068857_100096283
483 Ga0068854_101521865
484 Ga0068856_100011778
485 Ga0068856_100113992
486 Ga0068856_100159811
487 Ga0068856_100178029
488 Ga0068856_100294633
489 Ga0068852_100054909
490 Ga0068852_100075107
491 Ga0068852_100570714
492 Ga0068852_101485437
493 Ga0068859_100132456
494 Ga0068859_100135567
495 Ga0068859_100867547
496 Ga0068864_100325536
497 Ga0068864_100388032
498 Ga0068863_100010803
499 Ga0068863_100161947
500 Ga0068858_100028869
501 Ga0068858_100049857
502 Ga0068858_100424261
503 Ga0068858_100757141
504 Ga0068860_100001444
505 Ga0070717_10058062
506 Ga0070716_100679184
507 Ga0097621_100020566
508 Ga0097621_100104802
509 Ga0097621_100642365
510 Ga0068871_100007234
511 Ga0068871_100018947
512 Ga0068871_100025680
513 Ga0075433_11548037
514 Ga0068865_100002631
515 Ga0068865_100114376
516 Ga0068865_101592805
517 Ga0097620_100132453
518 Ga0097620_100135575
519 Ga0097620_100867574
520 Ga0075435_101480887
521 Ga0105240_10133854
522 Ga0105240_10574312
523 Ga0105245_10007154
524 Ga0105245_10008311
525 Ga0105245_10069752
526 Ga0105245_10381237
527 Ga0105245_10940713
528 Ga0105247_10417277
529 Ga0105247_11061311
530 Ga0105243_10885662
531 Ga0105241_10000146
532 Ga0105241_10007994
533 Ga0105241_10086395
534 Ga0105241_10149116
535 Ga0105241_10274461
536 Ga0105241_10740715
537 Ga0105241_10926439
538 Ga0105242_10005122
539 Ga0105242_10016530
540 Ga0105242_10064759
541 Ga0105242_10140398
542 Ga0105242_11057374
543 Ga0105248_10041582
544 Ga0105248_10078889
545 Ga0105248_10092943
546 Ga0105248_10410227
547 Ga0105248_10528594
548 Ga0105248_10622771
549 Ga0105248_12368943
550 Ga0105237_10029304
551 Ga0105237_10046305
552 Ga0105237_10141601
553 Ga0105237_10493953
554 Ga0105237_11206882
555 Ga0105238_10009230
556 Ga0105238_10014384
557 Ga0105238_10039724
558 Ga0105238_10083479
559 Ga0105239_10004050
560 Ga0105239_10009961
561 Ga0105239_10045008
562 Ga0105239_10246613
563 Ga0105239_10625599
564 Ga0105246_10007063
565 Ga0157370_10111084
566 Ga0157370_10124353
567 Ga0157370_10497251
568 Ga0157369_10180047
569 Ga0157369_10193518
570 Ga0157369_11707949
571 Ga0157374_10007972
572 Ga0157374_10125361
573 Ga0157374_10799905
574 Ga0157374_11045855
575 Ga0157378_10077489
576 Ga0157378_10078918
577 Ga0163162_10068424
578 Ga0163162_10083600
579 Ga0163162_10103811
580 Ga0157372_10165806
581 Ga0157372_10346941
582 Ga0157372_10702611
583 Ga0157372_11174827
584 Ga0157375_10127263
585 Ga0157375_10335078
586 Ga0163163_10088192
587 Ga0163163_10181416
588 Ga0163163_10214327
589 Ga0163163_10479185
590 Ga0157379_10032039
591 Ga0157379_10101647
592 Ga0157379_10478138
593 Ga0157376_10095945
594 Ga0184602_114935
595 Ga0184592_117797
596 Ga0184593_114052
597 Ga0184593_114649
598 Ga0184598_134573
599 Ga0184598_139349
600 Ga0184598_142580
601 Ga0184601_114305
602 Ga0184599_153226
603 Ga0184600_144323
604 Ga0206356_10390452
605 Ga0206352_10862057
606 Ga0213875_10005602
607 Ga0213875_10616341
608 Ga0247552_103891
609 Ga0247554_101439
610 Ga0247554_103470
611 Ga0247553_104578
612 Ga0207680_10002408
613 Ga0207680_10080340
614 Ga0207699_10387661
615 Ga0207705_10159364
616 Ga0207705_10253513
617 Ga0207654_10021749
618 Ga0207654_10040598
619 Ga0207654_10048070
620 Ga0207654_10278458
621 Ga0207654_10296703
622 Ga0207654_10381754
623 Ga0207707_10006121
624 Ga0207707_10731053
625 Ga0207695_10015863
626 Ga0207695_10021552
627 Ga0207695_10102436
628 Ga0207695_10152180
629 Ga0207695_10716933
630 Ga0207695_10845529
631 Ga0207671_10009411
632 Ga0207671_10035872
633 Ga0207671_10055248
634 Ga0207671_10308673
635 Ga0207671_10641727
636 Ga0207660_10774420
637 Ga0207657_10063195
638 Ga0207657_10111585
639 Ga0207657_10347992
640 Ga0207649_10067836
641 Ga0207649_10274190
642 Ga0207649_10375103
643 Ga0207652_10097257
644 Ga0207652_10241161
645 Ga0207646_10018911
646 Ga0207694_10001099
647 Ga0207694_10010213
648 Ga0207694_10056156
649 Ga0207694_10063164
650 Ga0207694_10577919
651 Ga0207659_11519211
652 Ga0207687_10009592
653 Ga0207687_10011413
654 Ga0207687_10012358
655 Ga0207687_10040588
656 Ga0207700_10017052
657 Ga0207700_10612107
658 Ga0207700_10748495
659 Ga0207690_10315251
660 Ga0207686_10013105
661 Ga0207686_10067102
662 Ga0207686_10084546
663 Ga0207686_10141392
664 Ga0207686_10153089
665 Ga0207686_10887142
666 Ga0207709_10331826
667 Ga0207670_10070799
668 Ga0207669_10496889
669 Ga0207704_10052419
670 Ga0207704_10934692
671 Ga0207711_10029269
672 Ga0207711_10030189
673 Ga0207711_10058476
674 Ga0207711_10342167
675 Ga0207711_10421213
676 Ga0207711_11467202
677 Ga0207689_10662840
678 Ga0207661_10001587
679 Ga0207661_10210443
680 Ga0207661_10428450
681 Ga0207679_10015402
682 Ga0207679_10181466
683 Ga0207679_10251304
684 Ga0207667_10016434
685 Ga0207667_10035590
686 Ga0207667_10145156
687 Ga0207667_10256080
688 Ga0207667_10410948
689 Ga0207667_10467797
690 Ga0207667_11203877
691 Ga0207640_10512567
692 Ga0207658_10399703
693 Ga0207677_10014300
694 Ga0207677_10017392
695 Ga0207677_10239067
696 Ga0207703_10006808
697 Ga0207703_10093854
698 Ga0207703_11269313
699 Ga0207639_10040145
700 Ga0207639_10050466
701 Ga0207639_11197794
702 Ga0207702_10016717
703 Ga0207702_10024920
704 Ga0207702_10068148
705 Ga0207702_10258900
706 Ga0207702_10265554
707 Ga0207702_10495812
708 Ga0207702_11116737
709 Ga0207641_10079293
710 Ga0207641_10145225
711 Ga0207648_10004245
712 Ga0207648_10053765
713 Ga0207676_10610921
714 Ga0207674_10003767
715 Ga0207674_10064006
716 Ga0207674_10064159
717 Ga0207683_10277183
718 Ga0207698_10410792
719 Ga0207698_10636907
720 Ga0207698_11702404
721 Ga0268266_10085068
722 Ga0268266_10713504
723 Ga0268266_11679448
724 Ga0268264_10034747
725 Ga0268264_10619344
726 Ga0265762_1041930
727 Ga0265762_1090481
728 Ga0265762_1127490
729 Ga0265762_1163892
730 Ga0265775_106877
731 Ga0265775_109463
732 Ga0265775_111192
733 Ga0265775_111430
734 Ga0265767_111260
735 Ga0265767_112784
736 Ga0265767_116534
737 Ga0265766_1003102
738 Ga0265766_1004621
739 Ga0265766_1007312
740 Ga0265766_1009775
741 Ga0265766_1024804
742 Ga0265777_103055
743 Ga0265776_109009
744 Ga0265764_114105
745 Ga0265769_111222
746 Ga0265769_112885
747 Ga0265769_113869
748 Ga0265768_108797
749 Ga0265768_115383
750 Ga0265768_116628
751 Ga0265768_117604
752 Ga0265771_1027937
753 Ga0265779_108737
754 Ga0265760_10289864
755 Ga0265325_10357663
756 Ga0265329_10219256
757 Ga0265340_10104523
758 Ga0265316_10067806
759 Ga0265313_10246939
760 Ga0265314_10000932
761 Ga0265314_10010089
762 Ga0265314_10044081
763 Ga0265342_10034779
764 Ga0265342_10353324
765 Ga0265342_10384980
766 Ga0247548_103353
767 Ga0247548_103629
768 Ga0316053_120041
769 Ga0373926_0145254
770 Ga0373935_1016933
771 Ga0373927_0096834
772 Ga0373933_0513537
773 Ga0373933_0646084
774 Ga0373947_0381554
775 Ga0265778_038482
776 Ga0265778_040089
777 Ga0265778_050214
778 Ga0265778_065697
779 Ga0373925_0133424
780 Ga0436364_0068908
781 Ga0436364_0511250
782 Ga0436364_1068537
783 Ga0436364_1248520
784 Ga0436360_0438100
785 Ga0436361_0693630
786 Ga0436363_0307363
787 Ga0436362_1263546
788 Ga0495651_0398752
789 Ga0495580_0008802
790 Ga0495580_0022548
791 Ga0495584_0535757
792 Ga0495628_0170980
793 Ga0495628_0686792
794 Ga0495665_0580764
795 Ga0495640_0573933
796 Ga0495645_0470808
797 Ga0495635_0961285
798 Ga0495599_0129812
799 Ga0495658_0155530
800 Ga0495674_0308920
801 Ga0495680_0179149
802 Ga0495675_0656036
803 Ga0495684_0630697
804 Ga0496101_1524635
805 Ga0496104_1522311
806 Ga0496104_1656319
807 Ga0496107_0988430
808 Ga0496107_1020644
809 nmdc:mga0a205_1314514_c1
810 Ga0587102_032639

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19649

DUF6152

Family of unknown function (DUF6152)

36

136

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7og2-assembly1.cif.gz_B crystal structure of pseudoalteromonas luteoviolacea l-amino acid oxidase 0.8457 43 73
4fxd-assembly1.cif.gz_A crystal structure of yeast dna polymerase alpha bound to dna/rna 0.8123 40 74
4fxd-assembly2.cif.gz_B crystal structure of yeast dna polymerase alpha bound to dna/rna 0.8116 40 74
4b08-assembly1.cif.gz_A yeast dna polymerase alpha, selenomethionine protein 0.7933 40 74
3kdf-assembly3.cif.gz_D x-ray crystal structure of the human replication protein a complex from wheat germ cell free expression 0.7918 37 117
ID Description Score Start End Superfamily
af_Q9VKY7_200_296_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.8602 43 71 2.30.29.30
af_F7EZF5_90_224_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.8433 43 71 2.30.29.30
2awoD03 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8269 38 76 2.40.50.140
3rlfA03 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8173 38 98 2.40.50.140
4fxdB01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); 0.8116 40 74 2.40.50.730
ID Description Score Start End GO Terms
AF-A0A383CUF3-F1-model_v4 OB domain-containing protein 0.9993 32 125
AF-A0A2V8LU00-F1-model_v4 OB domain-containing protein 0.9801 38 124
AF-A0A521RFX0-F1-model_v4 Uncharacterized protein 0.9727 32 122
AF-A0A7C2J476-F1-model_v4 DUF5666 domain-containing protein 0.9681 32 116
AF-A0A2V9CMA3-F1-model_v4 Uncharacterized protein 0.9662 42 125

Map