F439240
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 418 | 184 | 810 | 135 |
Family's Representative Sequence
| Representative Sequence | 3300005445|Ga0070708_101103725|Ga0070708_1011037251 |
| Length | 158 |
| Sequence | MTPDAYNNEKDASGRLYTCISRMEVSVKAKLTVLGAGLLMAAMPMLAHHSFAAEYDSTKPVSVSGTVTKVEWMNPHARFYVDVKDESGKVTNWEFELGSPNGLMRQGWTRNSMKVGDQVGVEGYLAKDGSKLGNARNIKTAEGKKLFAGSTTDGGPTQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 3 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 4 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 5 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 6 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 29 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 36 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 40 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 42 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 43 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 44 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 45 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 46 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 47 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 48 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 49 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 50 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 54 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 55 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 56 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 58 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300019161 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA2 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 80 | 3300019177 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI1 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 81 | 3300019179 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI2 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 82 | 3300019182 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE1 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 83 | 3300019183 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA1 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 84 | 3300019188 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE2 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 85 | 3300019190 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE3 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 86 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 87 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 88 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 89 | 3300023536 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 90 | 3300023547 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 91 | 3300023672 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 92 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 134 | 3300030762 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 135 | 3300030836 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 136 | 3300030863 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 137 | 3300030877 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 138 | 3300030880 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 139 | 3300030882 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 140 | 3300030888 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 141 | 3300030963 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 142 | 3300031010 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 143 | 3300031043 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 144 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 145 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 146 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 147 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 148 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 149 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 150 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 151 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 152 | 3300031814 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 153 | 3300032120 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 154 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 155 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 156 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 157 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 158 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 159 | 3300036457 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 160 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 161 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 162 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 163 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 164 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 165 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 166 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 181 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 182 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 183 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 184 | 3300059649 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 86.12 |
| Metatranscriptomes | 13.88 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 1.2 |
| Rhizosphere | 96.65 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 52.15 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070708_101103725 | 3300005445 | Unclassified | 743 |
| 2 | Ga0058859_10015619 | 3300004798 | Unclassified | 545 |
| 3 | Ga0058863_11862400 | 3300004799 | Bacteria | 554 |
| 4 | Ga0058861_12052172 | 3300004800 | Bacteria | 606 |
| 5 | Ga0058860_10075199 | 3300004801 | Unclassified | 615 |
| 6 | Ga0058862_12785879 | 3300004803 | Unclassified | 1061 |
| 7 | Ga0070658_10119218 | 3300005327 | Unclassified | 2192 |
| 8 | Ga0070683_100944034 | 3300005329 | Bacteria | 828 |
| 9 | Ga0070690_100163471 | 3300005330 | Bacteria | 1527 |
| 10 | Ga0068869_100718948 | 3300005334 | Unclassified | 853 |
| 11 | Ga0070666_10012430 | 3300005335 | Bacteria | 5371 |
| 12 | Ga0070666_10658651 | 3300005335 | Unclassified | 766 |
| 13 | Ga0070680_100989280 | 3300005336 | Unclassified | 726 |
| 14 | Ga0070682_100366121 | 3300005337 | Bacteria | 1079 |
| 15 | Ga0070682_101218132 | 3300005337 | Unclassified | 636 |
| 16 | Ga0068868_100020748 | 3300005338 | Unclassified | 4943 |
| 17 | Ga0068868_100039710 | 3300005338 | Unclassified | 3658 |
| 18 | Ga0068868_100156184 | 3300005338 | Bacteria | 1882 |
| 19 | Ga0070660_100051775 | 3300005339 | Bacteria | 3163 |
| 20 | Ga0070660_100605324 | 3300005339 | Unclassified | 916 |
| 21 | Ga0070689_100094878 | 3300005340 | Bacteria | 2356 |
| 22 | Ga0070661_100076598 | 3300005344 | Bacteria | 2465 |
| 23 | Ga0070661_100133319 | 3300005344 | Bacteria | 1867 |
| 24 | Ga0070661_100217541 | 3300005344 | Unclassified | 1464 |
| 25 | Ga0070661_100513908 | 3300005344 | Unclassified | 960 |
| 26 | Ga0070675_100516884 | 3300005354 | Unclassified | 1077 |
| 27 | Ga0070674_100396870 | 3300005356 | Unclassified | 1126 |
| 28 | Ga0070688_100834411 | 3300005365 | Unclassified | 723 |
| 29 | Ga0070659_100741852 | 3300005366 | Unclassified | 851 |
| 30 | Ga0070667_100086941 | 3300005367 | Bacteria | 2683 |
| 31 | Ga0070667_100146795 | 3300005367 | Bacteria | 2069 |
| 32 | Ga0070709_10715639 | 3300005434 | Unclassified | 780 |
| 33 | Ga0070709_11195565 | 3300005434 | Viruses | 611 |
| 34 | Ga0070713_100042270 | 3300005436 | Bacteria | 3719 |
| 35 | Ga0070710_10818849 | 3300005437 | Bacteria | 666 |
| 36 | Ga0070708_100242974 | 3300005445 | Bacteria | 1690 |
| 37 | Ga0070678_100926015 | 3300005456 | Bacteria | 798 |
| 38 | Ga0070681_10040882 | 3300005458 | Unclassified | 4645 |
| 39 | Ga0070681_10081042 | 3300005458 | Unclassified | 3201 |
| 40 | Ga0070681_10298566 | 3300005458 | Bacteria | 1521 |
| 41 | Ga0068867_100039796 | 3300005459 | Unclassified | 3429 |
| 42 | Ga0068867_100099010 | 3300005459 | Unclassified | 2224 |
| 43 | Ga0070706_101925123 | 3300005467 | Unclassified | 536 |
| 44 | Ga0070707_100001855 | 3300005468 | Bacteria | 20307 |
| 45 | Ga0070707_100149901 | 3300005468 | Bacteria | 2271 |
| 46 | Ga0070699_100281262 | 3300005518 | Unclassified | 1490 |
| 47 | Ga0070679_100222391 | 3300005530 | Unclassified | 1849 |
| 48 | Ga0070679_101067311 | 3300005530 | Unclassified | 752 |
| 49 | Ga0070684_100031689 | 3300005535 | Unclassified | 4502 |
| 50 | Ga0070684_100057237 | 3300005535 | Bacteria | 3403 |
| 51 | Ga0070684_100164481 | 3300005535 | Bacteria | 2014 |
| 52 | Ga0070684_100448975 | 3300005535 | Unclassified | 1192 |
| 53 | Ga0070697_101040740 | 3300005536 | Unclassified | 728 |
| 54 | Ga0068853_100061844 | 3300005539 | Unclassified | 3239 |
| 55 | Ga0068853_101223695 | 3300005539 | Unclassified | 725 |
| 56 | Ga0070696_101231652 | 3300005546 | Unclassified | 633 |
| 57 | Ga0070693_100237471 | 3300005547 | Bacteria | 1202 |
| 58 | Ga0070665_100292701 | 3300005548 | Bacteria | 1630 |
| 59 | Ga0070665_101248257 | 3300005548 | Unclassified | 753 |
| 60 | Ga0070665_101440663 | 3300005548 | Unclassified | 698 |
| 61 | Ga0070665_101480583 | 3300005548 | Unclassified | 687 |
| 62 | Ga0068855_100020451 | 3300005563 | Bacteria | 7937 |
| 63 | Ga0068855_100060280 | 3300005563 | Unclassified | 4438 |
| 64 | Ga0068855_100103147 | 3300005563 | Bacteria | 3282 |
| 65 | Ga0068855_100176672 | 3300005563 | Unclassified | 2416 |
| 66 | Ga0068855_100222611 | 3300005563 | Bacteria | 2115 |
| 67 | Ga0068855_100254186 | 3300005563 | Unclassified | 1959 |
| 68 | Ga0068855_100463249 | 3300005563 | Unclassified | 1382 |
| 69 | Ga0068855_101030201 | 3300005563 | Unclassified | 863 |
| 70 | Ga0070664_100018189 | 3300005564 | Bacteria | 5769 |
| 71 | Ga0070664_100142081 | 3300005564 | Bacteria | 2114 |
| 72 | Ga0070664_100270108 | 3300005564 | Unclassified | 1532 |
| 73 | Ga0070664_100356607 | 3300005564 | Bacteria | 1331 |
| 74 | Ga0068857_100034762 | 3300005577 | Bacteria | 4458 |
| 75 | Ga0068857_100042498 | 3300005577 | Unclassified | 4033 |
| 76 | Ga0068857_100073928 | 3300005577 | Bacteria | 3038 |
| 77 | Ga0068857_100096283 | 3300005577 | Unclassified | 2652 |
| 78 | Ga0068854_101521865 | 3300005578 | Unclassified | 608 |
| 79 | Ga0068856_100011778 | 3300005614 | Bacteria | 8481 |
| 80 | Ga0068856_100113992 | 3300005614 | Bacteria | 2702 |
| 81 | Ga0068856_100159811 | 3300005614 | Unclassified | 2263 |
| 82 | Ga0068856_100178029 | 3300005614 | Unclassified | 2139 |
| 83 | Ga0068856_100294633 | 3300005614 | Unclassified | 1639 |
| 84 | Ga0068852_100054909 | 3300005616 | Unclassified | 3436 |
| 85 | Ga0068852_100075107 | 3300005616 | Bacteria | 2980 |
| 86 | Ga0068852_100570714 | 3300005616 | Bacteria | 1133 |
| 87 | Ga0068852_101485437 | 3300005616 | Unclassified | 700 |
| 88 | Ga0068859_100132456 | 3300005617 | Bacteria | 2565 |
| 89 | Ga0068859_100135567 | 3300005617 | Unclassified | 2534 |
| 90 | Ga0068859_100867547 | 3300005617 | Bacteria | 988 |
| 91 | Ga0068864_100325536 | 3300005618 | Bacteria | 1444 |
| 92 | Ga0068864_100388032 | 3300005618 | Bacteria | 1325 |
| 93 | Ga0068863_100010803 | 3300005841 | Bacteria | 8856 |
| 94 | Ga0068863_100161947 | 3300005841 | Bacteria | 2144 |
| 95 | Ga0068858_100028869 | 3300005842 | Bacteria | 5151 |
| 96 | Ga0068858_100049857 | 3300005842 | Unclassified | 3876 |
| 97 | Ga0068858_100424261 | 3300005842 | Bacteria | 1279 |
| 98 | Ga0068858_100757141 | 3300005842 | Unclassified | 946 |
| 99 | Ga0068860_100001444 | 3300005843 | Bacteria | 25740 |
| 100 | Ga0070717_10058062 | 3300006028 | Plasmid | 3199 |
| 101 | Ga0070716_100679184 | 3300006173 | Unclassified | 784 |
| 102 | Ga0097621_100020566 | 3300006237 | Bacteria | 5087 |
| 103 | Ga0097621_100104802 | 3300006237 | Unclassified | 2383 |
| 104 | Ga0097621_100642365 | 3300006237 | Unclassified | 973 |
| 105 | Ga0068871_100007234 | 3300006358 | Bacteria | 7918 |
| 106 | Ga0068871_100018947 | 3300006358 | Bacteria | 5245 |
| 107 | Ga0068871_100025680 | 3300006358 | Unclassified | 4586 |
| 108 | Ga0075433_11548037 | 3300006852 | Unclassified | 572 |
| 109 | Ga0068865_100002631 | 3300006881 | Bacteria | 10670 |
| 110 | Ga0068865_100114376 | 3300006881 | Bacteria | 1996 |
| 111 | Ga0068865_101592805 | 3300006881 | Unclassified | 587 |
| 112 | Ga0097620_100132453 | 3300006931 | Bacteria | 2565 |
| 113 | Ga0097620_100135575 | 3300006931 | Unclassified | 2534 |
| 114 | Ga0097620_100867574 | 3300006931 | Bacteria | 988 |
| 115 | Ga0075435_101480887 | 3300007076 | Unclassified | 595 |
| 116 | Ga0105240_10133854 | 3300009093 | Unclassified | 2970 |
| 117 | Ga0105240_10574312 | 3300009093 | Unclassified | 1244 |
| 118 | Ga0105245_10007154 | 3300009098 | Bacteria | 9789 |
| 119 | Ga0105245_10008311 | 3300009098 | Bacteria | 9070 |
| 120 | Ga0105245_10069752 | 3300009098 | Bacteria | 3188 |
| 121 | Ga0105245_10381237 | 3300009098 | Unclassified | 1404 |
| 122 | Ga0105245_10940713 | 3300009098 | Unclassified | 907 |
| 123 | Ga0105247_10417277 | 3300009101 | Bacteria | 960 |
| 124 | Ga0105247_11061311 | 3300009101 | Unclassified | 637 |
| 125 | Ga0105243_10885662 | 3300009148 | Unclassified | 887 |
| 126 | Ga0105241_10000146 | 3300009174 | Bacteria | 50607 |
| 127 | Ga0105241_10007994 | 3300009174 | Bacteria | 7779 |
| 128 | Ga0105241_10086395 | 3300009174 | Unclassified | 2467 |
| 129 | Ga0105241_10149116 | 3300009174 | Unclassified | 1912 |
| 130 | Ga0105241_10274461 | 3300009174 | Unclassified | 1438 |
| 131 | Ga0105241_10740715 | 3300009174 | Unclassified | 900 |
| 132 | Ga0105241_10926439 | 3300009174 | Unclassified | 811 |
| 133 | Ga0105242_10005122 | 3300009176 | Bacteria | 10110 |
| 134 | Ga0105242_10016530 | 3300009176 | Bacteria | 5736 |
| 135 | Ga0105242_10064759 | 3300009176 | Unclassified | 3014 |
| 136 | Ga0105242_10140398 | 3300009176 | Unclassified | 2096 |
| 137 | Ga0105242_11057374 | 3300009176 | Unclassified | 823 |
| 138 | Ga0105248_10041582 | 3300009177 | Bacteria | 5153 |
| 139 | Ga0105248_10078889 | 3300009177 | Bacteria | 3701 |
| 140 | Ga0105248_10092943 | 3300009177 | Bacteria | 3397 |
| 141 | Ga0105248_10410227 | 3300009177 | Bacteria | 1525 |
| 142 | Ga0105248_10528594 | 3300009177 | Unclassified | 1330 |
| 143 | Ga0105248_10622771 | 3300009177 | Unclassified | 1217 |
| 144 | Ga0105248_12368943 | 3300009177 | Unclassified | 605 |
| 145 | Ga0105237_10029304 | 3300009545 | Bacteria | 5597 |
| 146 | Ga0105237_10046305 | 3300009545 | Unclassified | 4375 |
| 147 | Ga0105237_10141601 | 3300009545 | Unclassified | 2399 |
| 148 | Ga0105237_10493953 | 3300009545 | Bacteria | 1230 |
| 149 | Ga0105237_11206882 | 3300009545 | Unclassified | 763 |
| 150 | Ga0105238_10009230 | 3300009551 | Bacteria | 9870 |
| 151 | Ga0105238_10014384 | 3300009551 | Bacteria | 7998 |
| 152 | Ga0105238_10039724 | 3300009551 | Unclassified | 4772 |
| 153 | Ga0105238_10083479 | 3300009551 | Unclassified | 3184 |
| 154 | Ga0105239_10004050 | 3300010375 | Bacteria | 17713 |
| 155 | Ga0105239_10009961 | 3300010375 | Bacteria | 10671 |
| 156 | Ga0105239_10045008 | 3300010375 | Unclassified | 4837 |
| 157 | Ga0105239_10246613 | 3300010375 | Bacteria | 2005 |
| 158 | Ga0105239_10625599 | 3300010375 | Unclassified | 1229 |
| 159 | Ga0105246_10007063 | 3300011119 | Bacteria | 6874 |
| 160 | Ga0157370_10111084 | 3300013104 | Bacteria | 2562 |
| 161 | Ga0157370_10124353 | 3300013104 | Unclassified | 2408 |
| 162 | Ga0157370_10497251 | 3300013104 | Unclassified | 1120 |
| 163 | Ga0157369_10180047 | 3300013105 | Unclassified | 2224 |
| 164 | Ga0157369_10193518 | 3300013105 | Bacteria | 2136 |
| 165 | Ga0157369_11707949 | 3300013105 | Bacteria | 640 |
| 166 | Ga0157374_10007972 | 3300013296 | Bacteria | 9048 |
| 167 | Ga0157374_10125361 | 3300013296 | Bacteria | 2482 |
| 168 | Ga0157374_10799905 | 3300013296 | Bacteria | 959 |
| 169 | Ga0157374_11045855 | 3300013296 | Bacteria | 836 |
| 170 | Ga0157378_10077489 | 3300013297 | Unclassified | 2997 |
| 171 | Ga0157378_10078918 | 3300013297 | Bacteria | 2971 |
| 172 | Ga0163162_10068424 | 3300013306 | Unclassified | 3602 |
| 173 | Ga0163162_10083600 | 3300013306 | Unclassified | 3266 |
| 174 | Ga0163162_10103811 | 3300013306 | Unclassified | 2937 |
| 175 | Ga0157372_10165806 | 3300013307 | Bacteria | 2555 |
| 176 | Ga0157372_10346941 | 3300013307 | Bacteria | 1729 |
| 177 | Ga0157372_10702611 | 3300013307 | Bacteria | 1177 |
| 178 | Ga0157372_11174827 | 3300013307 | Unclassified | 887 |
| 179 | Ga0157375_10127263 | 3300013308 | Unclassified | 2664 |
| 180 | Ga0157375_10335078 | 3300013308 | Bacteria | 1678 |
| 181 | Ga0163163_10088192 | 3300014325 | Bacteria | 3114 |
| 182 | Ga0163163_10181416 | 3300014325 | Bacteria | 2152 |
| 183 | Ga0163163_10214327 | 3300014325 | Unclassified | 1975 |
| 184 | Ga0163163_10479185 | 3300014325 | Bacteria | 1305 |
| 185 | Ga0157379_10032039 | 3300014968 | Unclassified | 4684 |
| 186 | Ga0157379_10101647 | 3300014968 | Unclassified | 2580 |
| 187 | Ga0157379_10478138 | 3300014968 | Bacteria | 1153 |
| 188 | Ga0157376_10095945 | 3300014969 | Unclassified | 2580 |
| 189 | Ga0184602_114935 | 3300019161 | Unclassified | 511 |
| 190 | Ga0184592_117797 | 3300019177 | Bacteria | 501 |
| 191 | Ga0184593_114052 | 3300019179 | Bacteria | 520 |
| 192 | Ga0184593_114649 | 3300019179 | Unclassified | 596 |
| 193 | Ga0184598_134573 | 3300019182 | Unclassified | 750 |
| 194 | Ga0184598_139349 | 3300019182 | Bacteria | 754 |
| 195 | Ga0184598_142580 | 3300019182 | Unclassified | 514 |
| 196 | Ga0184601_114305 | 3300019183 | Unclassified | 664 |
| 197 | Ga0184599_153226 | 3300019188 | Unclassified | 501 |
| 198 | Ga0184600_144323 | 3300019190 | Bacteria | 706 |
| 199 | Ga0206356_10390452 | 3300020070 | Unclassified | 693 |
| 200 | Ga0206352_10862057 | 3300020078 | Unclassified | 697 |
| 201 | Ga0213875_10005602 | 3300021388 | Bacteria | 6712 |
| 202 | Ga0213875_10616341 | 3300021388 | Unclassified | 525 |
| 203 | Ga0247552_103891 | 3300023536 | Unclassified | 523 |
| 204 | Ga0247554_101439 | 3300023547 | Unclassified | 821 |
| 205 | Ga0247554_103470 | 3300023547 | Unclassified | 619 |
| 206 | Ga0247553_104578 | 3300023672 | Unclassified | 703 |
| 207 | Ga0207680_10002408 | 3300025903 | Bacteria | 8720 |
| 208 | Ga0207680_10080340 | 3300025903 | Bacteria | 2047 |
| 209 | Ga0207699_10387661 | 3300025906 | Unclassified | 993 |
| 210 | Ga0207705_10159364 | 3300025909 | Bacteria | 1695 |
| 211 | Ga0207705_10253513 | 3300025909 | Bacteria | 1342 |
| 212 | Ga0207654_10021749 | 3300025911 | Bacteria | 3414 |
| 213 | Ga0207654_10040598 | 3300025911 | Bacteria | 2623 |
| 214 | Ga0207654_10048070 | 3300025911 | Unclassified | 2440 |
| 215 | Ga0207654_10278458 | 3300025911 | Bacteria | 1131 |
| 216 | Ga0207654_10296703 | 3300025911 | Unclassified | 1098 |
| 217 | Ga0207654_10381754 | 3300025911 | Unclassified | 976 |
| 218 | Ga0207707_10006121 | 3300025912 | Bacteria | 10515 |
| 219 | Ga0207707_10731053 | 3300025912 | Unclassified | 829 |
| 220 | Ga0207695_10015863 | 3300025913 | Bacteria | 8849 |
| 221 | Ga0207695_10021552 | 3300025913 | Bacteria | 7348 |
| 222 | Ga0207695_10102436 | 3300025913 | Unclassified | 2856 |
| 223 | Ga0207695_10152180 | 3300025913 | Unclassified | 2252 |
| 224 | Ga0207695_10716933 | 3300025913 | Unclassified | 881 |
| 225 | Ga0207695_10845529 | 3300025913 | Unclassified | 795 |
| 226 | Ga0207671_10009411 | 3300025914 | Bacteria | 8168 |
| 227 | Ga0207671_10035872 | 3300025914 | Unclassified | 3677 |
| 228 | Ga0207671_10055248 | 3300025914 | Bacteria | 2942 |
| 229 | Ga0207671_10308673 | 3300025914 | Bacteria | 1250 |
| 230 | Ga0207671_10641727 | 3300025914 | Unclassified | 846 |
| 231 | Ga0207660_10774420 | 3300025917 | Unclassified | 783 |
| 232 | Ga0207657_10063195 | 3300025919 | Bacteria | 3166 |
| 233 | Ga0207657_10111585 | 3300025919 | Unclassified | 2257 |
| 234 | Ga0207657_10347992 | 3300025919 | Bacteria | 1169 |
| 235 | Ga0207649_10067836 | 3300025920 | Bacteria | 2266 |
| 236 | Ga0207649_10274190 | 3300025920 | Unclassified | 1224 |
| 237 | Ga0207649_10375103 | 3300025920 | Bacteria | 1059 |
| 238 | Ga0207652_10097257 | 3300025921 | Bacteria | 2594 |
| 239 | Ga0207652_10241161 | 3300025921 | Unclassified | 1630 |
| 240 | Ga0207646_10018911 | 3300025922 | Bacteria | 6415 |
| 241 | Ga0207694_10001099 | 3300025924 | Bacteria | 23436 |
| 242 | Ga0207694_10010213 | 3300025924 | Bacteria | 7078 |
| 243 | Ga0207694_10056156 | 3300025924 | Unclassified | 3058 |
| 244 | Ga0207694_10063164 | 3300025924 | Bacteria | 2885 |
| 245 | Ga0207694_10577919 | 3300025924 | Unclassified | 944 |
| 246 | Ga0207659_11519211 | 3300025926 | Unclassified | 573 |
| 247 | Ga0207687_10009592 | 3300025927 | Bacteria | 6328 |
| 248 | Ga0207687_10011413 | 3300025927 | Bacteria | 5807 |
| 249 | Ga0207687_10012358 | 3300025927 | Bacteria | 5582 |
| 250 | Ga0207687_10040588 | 3300025927 | Bacteria | 3191 |
| 251 | Ga0207700_10017052 | 3300025928 | Bacteria | 4840 |
| 252 | Ga0207700_10612107 | 3300025928 | Unclassified | 970 |
| 253 | Ga0207700_10748495 | 3300025928 | Unclassified | 873 |
| 254 | Ga0207690_10315251 | 3300025932 | Unclassified | 1228 |
| 255 | Ga0207686_10013105 | 3300025934 | Unclassified | 4579 |
| 256 | Ga0207686_10067102 | 3300025934 | Bacteria | 2294 |
| 257 | Ga0207686_10084546 | 3300025934 | Bacteria | 2079 |
| 258 | Ga0207686_10141392 | 3300025934 | Unclassified | 1664 |
| 259 | Ga0207686_10153089 | 3300025934 | Unclassified | 1608 |
| 260 | Ga0207686_10887142 | 3300025934 | Unclassified | 719 |
| 261 | Ga0207709_10331826 | 3300025935 | Bacteria | 1142 |
| 262 | Ga0207670_10070799 | 3300025936 | Bacteria | 2410 |
| 263 | Ga0207669_10496889 | 3300025937 | Unclassified | 975 |
| 264 | Ga0207704_10052419 | 3300025938 | Bacteria | 2473 |
| 265 | Ga0207704_10934692 | 3300025938 | Unclassified | 731 |
| 266 | Ga0207711_10029269 | 3300025941 | Bacteria | 4644 |
| 267 | Ga0207711_10030189 | 3300025941 | Bacteria | 4571 |
| 268 | Ga0207711_10058476 | 3300025941 | Bacteria | 3318 |
| 269 | Ga0207711_10342167 | 3300025941 | Unclassified | 1384 |
| 270 | Ga0207711_10421213 | 3300025941 | Unclassified | 1242 |
| 271 | Ga0207711_11467202 | 3300025941 | Unclassified | 625 |
| 272 | Ga0207689_10662840 | 3300025942 | Unclassified | 879 |
| 273 | Ga0207661_10001587 | 3300025944 | Bacteria | 15474 |
| 274 | Ga0207661_10210443 | 3300025944 | Bacteria | 1714 |
| 275 | Ga0207661_10428450 | 3300025944 | Bacteria | 1202 |
| 276 | Ga0207679_10015402 | 3300025945 | Bacteria | 5051 |
| 277 | Ga0207679_10181466 | 3300025945 | Bacteria | 1742 |
| 278 | Ga0207679_10251304 | 3300025945 | Bacteria | 1503 |
| 279 | Ga0207667_10016434 | 3300025949 | Bacteria | 8362 |
| 280 | Ga0207667_10035590 | 3300025949 | Bacteria | 5341 |
| 281 | Ga0207667_10145156 | 3300025949 | Unclassified | 2443 |
| 282 | Ga0207667_10256080 | 3300025949 | Unclassified | 1790 |
| 283 | Ga0207667_10410948 | 3300025949 | Unclassified | 1377 |
| 284 | Ga0207667_10467797 | 3300025949 | Unclassified | 1280 |
| 285 | Ga0207667_11203877 | 3300025949 | Unclassified | 737 |
| 286 | Ga0207640_10512567 | 3300025981 | Bacteria | 1001 |
| 287 | Ga0207658_10399703 | 3300025986 | Bacteria | 1207 |
| 288 | Ga0207677_10014300 | 3300026023 | Bacteria | 4631 |
| 289 | Ga0207677_10017392 | 3300026023 | Unclassified | 4285 |
| 290 | Ga0207677_10239067 | 3300026023 | Unclassified | 1468 |
| 291 | Ga0207703_10006808 | 3300026035 | Bacteria | 9109 |
| 292 | Ga0207703_10093854 | 3300026035 | Bacteria | 2528 |
| 293 | Ga0207703_11269313 | 3300026035 | Unclassified | 708 |
| 294 | Ga0207639_10040145 | 3300026041 | Bacteria | 3491 |
| 295 | Ga0207639_10050466 | 3300026041 | Unclassified | 3160 |
| 296 | Ga0207639_11197794 | 3300026041 | Unclassified | 713 |
| 297 | Ga0207702_10016717 | 3300026078 | Bacteria | 6073 |
| 298 | Ga0207702_10024920 | 3300026078 | Bacteria | 4964 |
| 299 | Ga0207702_10068148 | 3300026078 | Unclassified | 3056 |
| 300 | Ga0207702_10258900 | 3300026078 | Bacteria | 1637 |
| 301 | Ga0207702_10265554 | 3300026078 | Unclassified | 1617 |
| 302 | Ga0207702_10495812 | 3300026078 | Bacteria | 1190 |
| 303 | Ga0207702_11116737 | 3300026078 | Unclassified | 782 |
| 304 | Ga0207641_10079293 | 3300026088 | Bacteria | 2846 |
| 305 | Ga0207641_10145225 | 3300026088 | Bacteria | 2144 |
| 306 | Ga0207648_10004245 | 3300026089 | Bacteria | 14809 |
| 307 | Ga0207648_10053765 | 3300026089 | Unclassified | 3519 |
| 308 | Ga0207676_10610921 | 3300026095 | Unclassified | 1048 |
| 309 | Ga0207674_10003767 | 3300026116 | Bacteria | 18504 |
| 310 | Ga0207674_10064006 | 3300026116 | Bacteria | 3710 |
| 311 | Ga0207674_10064159 | 3300026116 | Unclassified | 3705 |
| 312 | Ga0207683_10277183 | 3300026121 | Unclassified | 1532 |
| 313 | Ga0207698_10410792 | 3300026142 | Unclassified | 1296 |
| 314 | Ga0207698_10636907 | 3300026142 | Bacteria | 1055 |
| 315 | Ga0207698_11702404 | 3300026142 | Unclassified | 646 |
| 316 | Ga0268266_10085068 | 3300028379 | Bacteria | 2763 |
| 317 | Ga0268266_10713504 | 3300028379 | Bacteria | 967 |
| 318 | Ga0268266_11679448 | 3300028379 | Unclassified | 610 |
| 319 | Ga0268264_10034747 | 3300028381 | Unclassified | 4148 |
| 320 | Ga0268264_10619344 | 3300028381 | Unclassified | 1068 |
| 321 | Ga0265762_1041930 | 3300030760 | Unclassified | 898 |
| 322 | Ga0265762_1090481 | 3300030760 | Unclassified | 667 |
| 323 | Ga0265762_1127490 | 3300030760 | Unclassified | 587 |
| 324 | Ga0265762_1163892 | 3300030760 | Unclassified | 537 |
| 325 | Ga0265775_106877 | 3300030762 | Bacteria | 674 |
| 326 | Ga0265775_109463 | 3300030762 | Unclassified | 603 |
| 327 | Ga0265775_111192 | 3300030762 | Bacteria | 572 |
| 328 | Ga0265775_111430 | 3300030762 | Bacteria | 568 |
| 329 | Ga0265767_111260 | 3300030836 | Unclassified | 605 |
| 330 | Ga0265767_112784 | 3300030836 | Bacteria | 583 |
| 331 | Ga0265767_116534 | 3300030836 | Unclassified | 537 |
| 332 | Ga0265766_1003102 | 3300030863 | Unclassified | 954 |
| 333 | Ga0265766_1004621 | 3300030863 | Unclassified | 846 |
| 334 | Ga0265766_1007312 | 3300030863 | Unclassified | 740 |
| 335 | Ga0265766_1009775 | 3300030863 | Unclassified | 676 |
| 336 | Ga0265766_1024804 | 3300030863 | Unclassified | 511 |
| 337 | Ga0265777_103055 | 3300030877 | Unclassified | 1009 |
| 338 | Ga0265776_109009 | 3300030880 | Unclassified | 576 |
| 339 | Ga0265764_114105 | 3300030882 | Unclassified | 538 |
| 340 | Ga0265769_111222 | 3300030888 | Bacteria | 621 |
| 341 | Ga0265769_112885 | 3300030888 | Unclassified | 597 |
| 342 | Ga0265769_113869 | 3300030888 | Unclassified | 585 |
| 343 | Ga0265768_108797 | 3300030963 | Unclassified | 631 |
| 344 | Ga0265768_115383 | 3300030963 | Unclassified | 530 |
| 345 | Ga0265768_116628 | 3300030963 | Unclassified | 518 |
| 346 | Ga0265768_117604 | 3300030963 | Unclassified | 508 |
| 347 | Ga0265771_1027937 | 3300031010 | Unclassified | 526 |
| 348 | Ga0265779_108737 | 3300031043 | Unclassified | 596 |
| 349 | Ga0265760_10289864 | 3300031090 | Unclassified | 578 |
| 350 | Ga0265325_10357663 | 3300031241 | Unclassified | 644 |
| 351 | Ga0265329_10219256 | 3300031242 | Bacteria | 629 |
| 352 | Ga0265340_10104523 | 3300031247 | Bacteria | 1314 |
| 353 | Ga0265316_10067806 | 3300031344 | Bacteria | 2758 |
| 354 | Ga0265313_10246939 | 3300031595 | Unclassified | 729 |
| 355 | Ga0265314_10000932 | 3300031711 | Bacteria | 34486 |
| 356 | Ga0265314_10010089 | 3300031711 | Bacteria | 7915 |
| 357 | Ga0265314_10044081 | 3300031711 | Bacteria | 3165 |
| 358 | Ga0265342_10034779 | 3300031712 | Bacteria | 3089 |
| 359 | Ga0265342_10353324 | 3300031712 | Unclassified | 765 |
| 360 | Ga0265342_10384980 | 3300031712 | Bacteria | 726 |
| 361 | Ga0247548_103353 | 3300031814 | Unclassified | 720 |
| 362 | Ga0247548_103629 | 3300031814 | Unclassified | 698 |
| 363 | Ga0316053_120041 | 3300032120 | Bacteria | 520 |
| 364 | Ga0373926_0145254 | 3300035083 | Unclassified | 902 |
| 365 | Ga0373935_1016933 | 3300035692 | Unclassified | 616 |
| 366 | Ga0373927_0096834 | 3300035695 | Unclassified | 1918 |
| 367 | Ga0373933_0513537 | 3300035724 | Unclassified | 785 |
| 368 | Ga0373933_0646084 | 3300035724 | Bacteria | 695 |
| 369 | Ga0373947_0381554 | 3300035725 | Bacteria | 949 |
| 370 | Ga0265778_038482 | 3300036457 | Unclassified | 633 |
| 371 | Ga0265778_040089 | 3300036457 | Unclassified | 623 |
| 372 | Ga0265778_050214 | 3300036457 | Bacteria | 570 |
| 373 | Ga0265778_065697 | 3300036457 | Unclassified | 510 |
| 374 | Ga0373925_0133424 | 3300037068 | Unclassified | 1938 |
| 375 | Ga0436364_0068908 | 3300037853 | Bacteria | 1946 |
| 376 | Ga0436364_0511250 | 3300037853 | Unclassified | 807 |
| 377 | Ga0436364_1068537 | 3300037853 | Bacteria | 918 |
| 378 | Ga0436364_1248520 | 3300037853 | Bacteria | 1963 |
| 379 | Ga0436360_0438100 | 3300039438 | Unclassified | 932 |
| 380 | Ga0436361_0693630 | 3300039447 | Unclassified | 615 |
| 381 | Ga0436363_0307363 | 3300039450 | Bacteria | 2513 |
| 382 | Ga0436362_1263546 | 3300039453 | Unclassified | 571 |
| 383 | Ga0495651_0398752 | 3300046462 | Bacteria | 899 |
| 384 | Ga0495580_0008802 | 3300046472 | Bacteria | 7990 |
| 385 | Ga0495580_0022548 | 3300046472 | Unclassified | 4633 |
| 386 | Ga0495584_0535757 | 3300046491 | Bacteria | 597 |
| 387 | Ga0495628_0170980 | 3300046516 | Bacteria | 1648 |
| 388 | Ga0495628_0686792 | 3300046516 | Bacteria | 724 |
| 389 | Ga0495665_0580764 | 3300046531 | Unclassified | 561 |
| 390 | Ga0495640_0573933 | 3300046533 | Bacteria | 683 |
| 391 | Ga0495645_0470808 | 3300046543 | Unclassified | 790 |
| 392 | Ga0495635_0961285 | 3300046663 | Bacteria | 545 |
| 393 | Ga0495599_0129812 | 3300046678 | Bacteria | 1565 |
| 394 | Ga0495658_0155530 | 3300046683 | Bacteria | 1407 |
| 395 | Ga0495674_0308920 | 3300047319 | Bacteria | 1290 |
| 396 | Ga0495680_0179149 | 3300047322 | Bacteria | 1531 |
| 397 | Ga0495675_0656036 | 3300047444 | Unclassified | 591 |
| 398 | Ga0495684_0630697 | 3300047471 | Bacteria | 719 |
| 399 | Ga0496101_1524635 | 3300048904 | Unclassified | 520 |
| 400 | Ga0496104_1522311 | 3300048907 | Unclassified | 572 |
| 401 | Ga0496104_1656319 | 3300048907 | Unclassified | 542 |
| 402 | Ga0496107_0988430 | 3300048910 | Bacteria | 611 |
| 403 | Ga0496107_1020644 | 3300048910 | Unclassified | 600 |
| 404 | nmdc:mga0a205_1314514_c1 | 3300050515 | Unclassified | 571 |
| 405 | Ga0587102_032639 | 3300059649 | Bacteria | 642 |
| 406 | Ga0070708_101103725 | |||
| 407 | Ga0058859_10015619 | |||
| 408 | Ga0058863_11862400 | |||
| 409 | Ga0058861_12052172 | |||
| 410 | Ga0058860_10075199 | |||
| 411 | Ga0058862_12785879 | |||
| 412 | Ga0070658_10119218 | |||
| 413 | Ga0070683_100944034 | |||
| 414 | Ga0070690_100163471 | |||
| 415 | Ga0068869_100718948 | |||
| 416 | Ga0070666_10012430 | |||
| 417 | Ga0070666_10658651 | |||
| 418 | Ga0070680_100989280 | |||
| 419 | Ga0070682_100366121 | |||
| 420 | Ga0070682_101218132 | |||
| 421 | Ga0068868_100020748 | |||
| 422 | Ga0068868_100039710 | |||
| 423 | Ga0068868_100156184 | |||
| 424 | Ga0070660_100051775 | |||
| 425 | Ga0070660_100605324 | |||
| 426 | Ga0070689_100094878 | |||
| 427 | Ga0070661_100076598 | |||
| 428 | Ga0070661_100133319 | |||
| 429 | Ga0070661_100217541 | |||
| 430 | Ga0070661_100513908 | |||
| 431 | Ga0070675_100516884 | |||
| 432 | Ga0070674_100396870 | |||
| 433 | Ga0070688_100834411 | |||
| 434 | Ga0070659_100741852 | |||
| 435 | Ga0070667_100086941 | |||
| 436 | Ga0070667_100146795 | |||
| 437 | Ga0070709_10715639 | |||
| 438 | Ga0070709_11195565 | |||
| 439 | Ga0070713_100042270 | |||
| 440 | Ga0070710_10818849 | |||
| 441 | Ga0070708_100242974 | |||
| 442 | Ga0070678_100926015 | |||
| 443 | Ga0070681_10040882 | |||
| 444 | Ga0070681_10081042 | |||
| 445 | Ga0070681_10298566 | |||
| 446 | Ga0068867_100039796 | |||
| 447 | Ga0068867_100099010 | |||
| 448 | Ga0070706_101925123 | |||
| 449 | Ga0070707_100001855 | |||
| 450 | Ga0070707_100149901 | |||
| 451 | Ga0070699_100281262 | |||
| 452 | Ga0070679_100222391 | |||
| 453 | Ga0070679_101067311 | |||
| 454 | Ga0070684_100031689 | |||
| 455 | Ga0070684_100057237 | |||
| 456 | Ga0070684_100164481 | |||
| 457 | Ga0070684_100448975 | |||
| 458 | Ga0070697_101040740 | |||
| 459 | Ga0068853_100061844 | |||
| 460 | Ga0068853_101223695 | |||
| 461 | Ga0070696_101231652 | |||
| 462 | Ga0070693_100237471 | |||
| 463 | Ga0070665_100292701 | |||
| 464 | Ga0070665_101248257 | |||
| 465 | Ga0070665_101440663 | |||
| 466 | Ga0070665_101480583 | |||
| 467 | Ga0068855_100020451 | |||
| 468 | Ga0068855_100060280 | |||
| 469 | Ga0068855_100103147 | |||
| 470 | Ga0068855_100176672 | |||
| 471 | Ga0068855_100222611 | |||
| 472 | Ga0068855_100254186 | |||
| 473 | Ga0068855_100463249 | |||
| 474 | Ga0068855_101030201 | |||
| 475 | Ga0070664_100018189 | |||
| 476 | Ga0070664_100142081 | |||
| 477 | Ga0070664_100270108 | |||
| 478 | Ga0070664_100356607 | |||
| 479 | Ga0068857_100034762 | |||
| 480 | Ga0068857_100042498 | |||
| 481 | Ga0068857_100073928 | |||
| 482 | Ga0068857_100096283 | |||
| 483 | Ga0068854_101521865 | |||
| 484 | Ga0068856_100011778 | |||
| 485 | Ga0068856_100113992 | |||
| 486 | Ga0068856_100159811 | |||
| 487 | Ga0068856_100178029 | |||
| 488 | Ga0068856_100294633 | |||
| 489 | Ga0068852_100054909 | |||
| 490 | Ga0068852_100075107 | |||
| 491 | Ga0068852_100570714 | |||
| 492 | Ga0068852_101485437 | |||
| 493 | Ga0068859_100132456 | |||
| 494 | Ga0068859_100135567 | |||
| 495 | Ga0068859_100867547 | |||
| 496 | Ga0068864_100325536 | |||
| 497 | Ga0068864_100388032 | |||
| 498 | Ga0068863_100010803 | |||
| 499 | Ga0068863_100161947 | |||
| 500 | Ga0068858_100028869 | |||
| 501 | Ga0068858_100049857 | |||
| 502 | Ga0068858_100424261 | |||
| 503 | Ga0068858_100757141 | |||
| 504 | Ga0068860_100001444 | |||
| 505 | Ga0070717_10058062 | |||
| 506 | Ga0070716_100679184 | |||
| 507 | Ga0097621_100020566 | |||
| 508 | Ga0097621_100104802 | |||
| 509 | Ga0097621_100642365 | |||
| 510 | Ga0068871_100007234 | |||
| 511 | Ga0068871_100018947 | |||
| 512 | Ga0068871_100025680 | |||
| 513 | Ga0075433_11548037 | |||
| 514 | Ga0068865_100002631 | |||
| 515 | Ga0068865_100114376 | |||
| 516 | Ga0068865_101592805 | |||
| 517 | Ga0097620_100132453 | |||
| 518 | Ga0097620_100135575 | |||
| 519 | Ga0097620_100867574 | |||
| 520 | Ga0075435_101480887 | |||
| 521 | Ga0105240_10133854 | |||
| 522 | Ga0105240_10574312 | |||
| 523 | Ga0105245_10007154 | |||
| 524 | Ga0105245_10008311 | |||
| 525 | Ga0105245_10069752 | |||
| 526 | Ga0105245_10381237 | |||
| 527 | Ga0105245_10940713 | |||
| 528 | Ga0105247_10417277 | |||
| 529 | Ga0105247_11061311 | |||
| 530 | Ga0105243_10885662 | |||
| 531 | Ga0105241_10000146 | |||
| 532 | Ga0105241_10007994 | |||
| 533 | Ga0105241_10086395 | |||
| 534 | Ga0105241_10149116 | |||
| 535 | Ga0105241_10274461 | |||
| 536 | Ga0105241_10740715 | |||
| 537 | Ga0105241_10926439 | |||
| 538 | Ga0105242_10005122 | |||
| 539 | Ga0105242_10016530 | |||
| 540 | Ga0105242_10064759 | |||
| 541 | Ga0105242_10140398 | |||
| 542 | Ga0105242_11057374 | |||
| 543 | Ga0105248_10041582 | |||
| 544 | Ga0105248_10078889 | |||
| 545 | Ga0105248_10092943 | |||
| 546 | Ga0105248_10410227 | |||
| 547 | Ga0105248_10528594 | |||
| 548 | Ga0105248_10622771 | |||
| 549 | Ga0105248_12368943 | |||
| 550 | Ga0105237_10029304 | |||
| 551 | Ga0105237_10046305 | |||
| 552 | Ga0105237_10141601 | |||
| 553 | Ga0105237_10493953 | |||
| 554 | Ga0105237_11206882 | |||
| 555 | Ga0105238_10009230 | |||
| 556 | Ga0105238_10014384 | |||
| 557 | Ga0105238_10039724 | |||
| 558 | Ga0105238_10083479 | |||
| 559 | Ga0105239_10004050 | |||
| 560 | Ga0105239_10009961 | |||
| 561 | Ga0105239_10045008 | |||
| 562 | Ga0105239_10246613 | |||
| 563 | Ga0105239_10625599 | |||
| 564 | Ga0105246_10007063 | |||
| 565 | Ga0157370_10111084 | |||
| 566 | Ga0157370_10124353 | |||
| 567 | Ga0157370_10497251 | |||
| 568 | Ga0157369_10180047 | |||
| 569 | Ga0157369_10193518 | |||
| 570 | Ga0157369_11707949 | |||
| 571 | Ga0157374_10007972 | |||
| 572 | Ga0157374_10125361 | |||
| 573 | Ga0157374_10799905 | |||
| 574 | Ga0157374_11045855 | |||
| 575 | Ga0157378_10077489 | |||
| 576 | Ga0157378_10078918 | |||
| 577 | Ga0163162_10068424 | |||
| 578 | Ga0163162_10083600 | |||
| 579 | Ga0163162_10103811 | |||
| 580 | Ga0157372_10165806 | |||
| 581 | Ga0157372_10346941 | |||
| 582 | Ga0157372_10702611 | |||
| 583 | Ga0157372_11174827 | |||
| 584 | Ga0157375_10127263 | |||
| 585 | Ga0157375_10335078 | |||
| 586 | Ga0163163_10088192 | |||
| 587 | Ga0163163_10181416 | |||
| 588 | Ga0163163_10214327 | |||
| 589 | Ga0163163_10479185 | |||
| 590 | Ga0157379_10032039 | |||
| 591 | Ga0157379_10101647 | |||
| 592 | Ga0157379_10478138 | |||
| 593 | Ga0157376_10095945 | |||
| 594 | Ga0184602_114935 | |||
| 595 | Ga0184592_117797 | |||
| 596 | Ga0184593_114052 | |||
| 597 | Ga0184593_114649 | |||
| 598 | Ga0184598_134573 | |||
| 599 | Ga0184598_139349 | |||
| 600 | Ga0184598_142580 | |||
| 601 | Ga0184601_114305 | |||
| 602 | Ga0184599_153226 | |||
| 603 | Ga0184600_144323 | |||
| 604 | Ga0206356_10390452 | |||
| 605 | Ga0206352_10862057 | |||
| 606 | Ga0213875_10005602 | |||
| 607 | Ga0213875_10616341 | |||
| 608 | Ga0247552_103891 | |||
| 609 | Ga0247554_101439 | |||
| 610 | Ga0247554_103470 | |||
| 611 | Ga0247553_104578 | |||
| 612 | Ga0207680_10002408 | |||
| 613 | Ga0207680_10080340 | |||
| 614 | Ga0207699_10387661 | |||
| 615 | Ga0207705_10159364 | |||
| 616 | Ga0207705_10253513 | |||
| 617 | Ga0207654_10021749 | |||
| 618 | Ga0207654_10040598 | |||
| 619 | Ga0207654_10048070 | |||
| 620 | Ga0207654_10278458 | |||
| 621 | Ga0207654_10296703 | |||
| 622 | Ga0207654_10381754 | |||
| 623 | Ga0207707_10006121 | |||
| 624 | Ga0207707_10731053 | |||
| 625 | Ga0207695_10015863 | |||
| 626 | Ga0207695_10021552 | |||
| 627 | Ga0207695_10102436 | |||
| 628 | Ga0207695_10152180 | |||
| 629 | Ga0207695_10716933 | |||
| 630 | Ga0207695_10845529 | |||
| 631 | Ga0207671_10009411 | |||
| 632 | Ga0207671_10035872 | |||
| 633 | Ga0207671_10055248 | |||
| 634 | Ga0207671_10308673 | |||
| 635 | Ga0207671_10641727 | |||
| 636 | Ga0207660_10774420 | |||
| 637 | Ga0207657_10063195 | |||
| 638 | Ga0207657_10111585 | |||
| 639 | Ga0207657_10347992 | |||
| 640 | Ga0207649_10067836 | |||
| 641 | Ga0207649_10274190 | |||
| 642 | Ga0207649_10375103 | |||
| 643 | Ga0207652_10097257 | |||
| 644 | Ga0207652_10241161 | |||
| 645 | Ga0207646_10018911 | |||
| 646 | Ga0207694_10001099 | |||
| 647 | Ga0207694_10010213 | |||
| 648 | Ga0207694_10056156 | |||
| 649 | Ga0207694_10063164 | |||
| 650 | Ga0207694_10577919 | |||
| 651 | Ga0207659_11519211 | |||
| 652 | Ga0207687_10009592 | |||
| 653 | Ga0207687_10011413 | |||
| 654 | Ga0207687_10012358 | |||
| 655 | Ga0207687_10040588 | |||
| 656 | Ga0207700_10017052 | |||
| 657 | Ga0207700_10612107 | |||
| 658 | Ga0207700_10748495 | |||
| 659 | Ga0207690_10315251 | |||
| 660 | Ga0207686_10013105 | |||
| 661 | Ga0207686_10067102 | |||
| 662 | Ga0207686_10084546 | |||
| 663 | Ga0207686_10141392 | |||
| 664 | Ga0207686_10153089 | |||
| 665 | Ga0207686_10887142 | |||
| 666 | Ga0207709_10331826 | |||
| 667 | Ga0207670_10070799 | |||
| 668 | Ga0207669_10496889 | |||
| 669 | Ga0207704_10052419 | |||
| 670 | Ga0207704_10934692 | |||
| 671 | Ga0207711_10029269 | |||
| 672 | Ga0207711_10030189 | |||
| 673 | Ga0207711_10058476 | |||
| 674 | Ga0207711_10342167 | |||
| 675 | Ga0207711_10421213 | |||
| 676 | Ga0207711_11467202 | |||
| 677 | Ga0207689_10662840 | |||
| 678 | Ga0207661_10001587 | |||
| 679 | Ga0207661_10210443 | |||
| 680 | Ga0207661_10428450 | |||
| 681 | Ga0207679_10015402 | |||
| 682 | Ga0207679_10181466 | |||
| 683 | Ga0207679_10251304 | |||
| 684 | Ga0207667_10016434 | |||
| 685 | Ga0207667_10035590 | |||
| 686 | Ga0207667_10145156 | |||
| 687 | Ga0207667_10256080 | |||
| 688 | Ga0207667_10410948 | |||
| 689 | Ga0207667_10467797 | |||
| 690 | Ga0207667_11203877 | |||
| 691 | Ga0207640_10512567 | |||
| 692 | Ga0207658_10399703 | |||
| 693 | Ga0207677_10014300 | |||
| 694 | Ga0207677_10017392 | |||
| 695 | Ga0207677_10239067 | |||
| 696 | Ga0207703_10006808 | |||
| 697 | Ga0207703_10093854 | |||
| 698 | Ga0207703_11269313 | |||
| 699 | Ga0207639_10040145 | |||
| 700 | Ga0207639_10050466 | |||
| 701 | Ga0207639_11197794 | |||
| 702 | Ga0207702_10016717 | |||
| 703 | Ga0207702_10024920 | |||
| 704 | Ga0207702_10068148 | |||
| 705 | Ga0207702_10258900 | |||
| 706 | Ga0207702_10265554 | |||
| 707 | Ga0207702_10495812 | |||
| 708 | Ga0207702_11116737 | |||
| 709 | Ga0207641_10079293 | |||
| 710 | Ga0207641_10145225 | |||
| 711 | Ga0207648_10004245 | |||
| 712 | Ga0207648_10053765 | |||
| 713 | Ga0207676_10610921 | |||
| 714 | Ga0207674_10003767 | |||
| 715 | Ga0207674_10064006 | |||
| 716 | Ga0207674_10064159 | |||
| 717 | Ga0207683_10277183 | |||
| 718 | Ga0207698_10410792 | |||
| 719 | Ga0207698_10636907 | |||
| 720 | Ga0207698_11702404 | |||
| 721 | Ga0268266_10085068 | |||
| 722 | Ga0268266_10713504 | |||
| 723 | Ga0268266_11679448 | |||
| 724 | Ga0268264_10034747 | |||
| 725 | Ga0268264_10619344 | |||
| 726 | Ga0265762_1041930 | |||
| 727 | Ga0265762_1090481 | |||
| 728 | Ga0265762_1127490 | |||
| 729 | Ga0265762_1163892 | |||
| 730 | Ga0265775_106877 | |||
| 731 | Ga0265775_109463 | |||
| 732 | Ga0265775_111192 | |||
| 733 | Ga0265775_111430 | |||
| 734 | Ga0265767_111260 | |||
| 735 | Ga0265767_112784 | |||
| 736 | Ga0265767_116534 | |||
| 737 | Ga0265766_1003102 | |||
| 738 | Ga0265766_1004621 | |||
| 739 | Ga0265766_1007312 | |||
| 740 | Ga0265766_1009775 | |||
| 741 | Ga0265766_1024804 | |||
| 742 | Ga0265777_103055 | |||
| 743 | Ga0265776_109009 | |||
| 744 | Ga0265764_114105 | |||
| 745 | Ga0265769_111222 | |||
| 746 | Ga0265769_112885 | |||
| 747 | Ga0265769_113869 | |||
| 748 | Ga0265768_108797 | |||
| 749 | Ga0265768_115383 | |||
| 750 | Ga0265768_116628 | |||
| 751 | Ga0265768_117604 | |||
| 752 | Ga0265771_1027937 | |||
| 753 | Ga0265779_108737 | |||
| 754 | Ga0265760_10289864 | |||
| 755 | Ga0265325_10357663 | |||
| 756 | Ga0265329_10219256 | |||
| 757 | Ga0265340_10104523 | |||
| 758 | Ga0265316_10067806 | |||
| 759 | Ga0265313_10246939 | |||
| 760 | Ga0265314_10000932 | |||
| 761 | Ga0265314_10010089 | |||
| 762 | Ga0265314_10044081 | |||
| 763 | Ga0265342_10034779 | |||
| 764 | Ga0265342_10353324 | |||
| 765 | Ga0265342_10384980 | |||
| 766 | Ga0247548_103353 | |||
| 767 | Ga0247548_103629 | |||
| 768 | Ga0316053_120041 | |||
| 769 | Ga0373926_0145254 | |||
| 770 | Ga0373935_1016933 | |||
| 771 | Ga0373927_0096834 | |||
| 772 | Ga0373933_0513537 | |||
| 773 | Ga0373933_0646084 | |||
| 774 | Ga0373947_0381554 | |||
| 775 | Ga0265778_038482 | |||
| 776 | Ga0265778_040089 | |||
| 777 | Ga0265778_050214 | |||
| 778 | Ga0265778_065697 | |||
| 779 | Ga0373925_0133424 | |||
| 780 | Ga0436364_0068908 | |||
| 781 | Ga0436364_0511250 | |||
| 782 | Ga0436364_1068537 | |||
| 783 | Ga0436364_1248520 | |||
| 784 | Ga0436360_0438100 | |||
| 785 | Ga0436361_0693630 | |||
| 786 | Ga0436363_0307363 | |||
| 787 | Ga0436362_1263546 | |||
| 788 | Ga0495651_0398752 | |||
| 789 | Ga0495580_0008802 | |||
| 790 | Ga0495580_0022548 | |||
| 791 | Ga0495584_0535757 | |||
| 792 | Ga0495628_0170980 | |||
| 793 | Ga0495628_0686792 | |||
| 794 | Ga0495665_0580764 | |||
| 795 | Ga0495640_0573933 | |||
| 796 | Ga0495645_0470808 | |||
| 797 | Ga0495635_0961285 | |||
| 798 | Ga0495599_0129812 | |||
| 799 | Ga0495658_0155530 | |||
| 800 | Ga0495674_0308920 | |||
| 801 | Ga0495680_0179149 | |||
| 802 | Ga0495675_0656036 | |||
| 803 | Ga0495684_0630697 | |||
| 804 | Ga0496101_1524635 | |||
| 805 | Ga0496104_1522311 | |||
| 806 | Ga0496104_1656319 | |||
| 807 | Ga0496107_0988430 | |||
| 808 | Ga0496107_1020644 | |||
| 809 | nmdc:mga0a205_1314514_c1 | |||
| 810 | Ga0587102_032639 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7og2-assembly1.cif.gz_B | crystal structure of pseudoalteromonas luteoviolacea l-amino acid oxidase | 0.8457 | 43 | 73 |
| 4fxd-assembly1.cif.gz_A | crystal structure of yeast dna polymerase alpha bound to dna/rna | 0.8123 | 40 | 74 |
| 4fxd-assembly2.cif.gz_B | crystal structure of yeast dna polymerase alpha bound to dna/rna | 0.8116 | 40 | 74 |
| 4b08-assembly1.cif.gz_A | yeast dna polymerase alpha, selenomethionine protein | 0.7933 | 40 | 74 |
| 3kdf-assembly3.cif.gz_D | x-ray crystal structure of the human replication protein a complex from wheat germ cell free expression | 0.7918 | 37 | 117 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9VKY7_200_296_2.30.29.30 | Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) | 0.8602 | 43 | 71 | 2.30.29.30 |
| af_F7EZF5_90_224_2.30.29.30 | Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) | 0.8433 | 43 | 71 | 2.30.29.30 |
| 2awoD03 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.8269 | 38 | 76 | 2.40.50.140 |
| 3rlfA03 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.8173 | 38 | 98 | 2.40.50.140 |
| 4fxdB01 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); | 0.8116 | 40 | 74 | 2.40.50.730 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A383CUF3-F1-model_v4 | OB domain-containing protein | 0.9993 | 32 | 125 |
|
| AF-A0A2V8LU00-F1-model_v4 | OB domain-containing protein | 0.9801 | 38 | 124 |
|
| AF-A0A521RFX0-F1-model_v4 | Uncharacterized protein | 0.9727 | 32 | 122 |
|
| AF-A0A7C2J476-F1-model_v4 | DUF5666 domain-containing protein | 0.9681 | 32 | 116 |
|
| AF-A0A2V9CMA3-F1-model_v4 | Uncharacterized protein | 0.9662 | 42 | 125 |
|