F439219

General Info

Members Datasets Scaffolds Average Seq Length
418 210 836 312

Family's Representative Sequence

Representative Sequence 3300005330|Ga0070690_100067416|Ga0070690_1000674161
Length 355
Sequence MAFAHHWQATLQRDIGLCLQSPDRSESDVKRAWMRYAIEDRRQMLIKRRWFAGACVAHALIAWDLSSLAPGARAQDIEPRAYSNAPVGVNFLIGGYAYTRGGIAFGAQLPITNPHLDTSSAVLAYARVLDLWGMSAKFDAIVPYTWLSGTAEYKGETVSRSVNGFANAAFRLSVNFYGAPALTLKEFTGWEQDLIVGASLRVIAPVGQYDDTRLVNIGNNRWSFKPEIGISKAIGPWTFEGTAGATFYTDNNNFFGGKMLSQNPIYSVQAHVIYGFASGVWTSFDATYFTGGRTTVDGVLNSDLQQNWRLGATLAVPVDRRNSIKFYASTGVASRTGNDFDLLGIAWQYRWGGGV

Samples

Sample ID Description Type Environment
1 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
74 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
89 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
146 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
147 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
148 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
149 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
150 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
151 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
152 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
153 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
154 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
155 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
156 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
157 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
158 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
159 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
160 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
161 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
162 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
163 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
164 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
165 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
166 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
167 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
168 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
169 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
170 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
171 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
172 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
173 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
174 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
175 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
176 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
177 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
178 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
179 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
180 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
181 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
182 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
183 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
184 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
185 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
186 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
187 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
188 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
189 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
196 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
197 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
198 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
199 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
200 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
201 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
202 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
203 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
204 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
205 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
206 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
207 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
208 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
209 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
210 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.48
Nodule 0
Rhizoplane 5.74
Rhizosphere 93.78
Stem 0
Stem Tuber 0
Unclassified 8.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070690_100067416 3300005330 Bacteria 2319
2 MRS1b_contig_7592505 2162886011 Bacteria 1283
3 Ga0065712_10103642 3300005290 Bacteria 1980
4 Ga0065715_10126385 3300005293 Bacteria 2110
5 Ga0065715_10159342 3300005293 Bacteria 1645
6 Ga0070683_100007283 3300005329 Bacteria 9333
7 Ga0070683_100007569 3300005329 Bacteria 9182
8 Ga0070683_100021701 3300005329 Bacteria 5733
9 Ga0070690_100149864 3300005330 Bacteria 1590
10 Ga0070670_100271087 3300005331 Bacteria 1481
11 Ga0070670_100275971 3300005331 Bacteria 1467
12 Ga0070670_100277846 3300005331 Bacteria 1462
13 Ga0068869_100070729 3300005334 Bacteria 2582
14 Ga0070666_10009625 3300005335 Bacteria 6031
15 Ga0070666_10009810 3300005335 Bacteria 5982
16 Ga0070666_10080029 3300005335 Unclassified 2232
17 Ga0070666_10092234 3300005335 Bacteria 2082
18 Ga0068868_100019180 3300005338 Bacteria 5124
19 Ga0068868_100221886 3300005338 Bacteria 1583
20 Ga0070689_100194851 3300005340 Bacteria 1651
21 Ga0070668_100122564 3300005347 Bacteria 2079
22 Ga0070668_100179628 3300005347 Bacteria 1728
23 Ga0070668_100412439 3300005347 Bacteria 1155
24 Ga0070669_100026478 3300005353 Bacteria 4172
25 Ga0070669_100351202 3300005353 Unclassified 1197
26 Ga0070675_100002928 3300005354 Bacteria 12874
27 Ga0070675_100099353 3300005354 Bacteria 2449
28 Ga0070675_100193486 3300005354 Unclassified 1763
29 Ga0070675_100207383 3300005354 Bacteria 1703
30 Ga0070671_100020833 3300005355 Bacteria 5348
31 Ga0070671_100045346 3300005355 Bacteria 3654
32 Ga0070671_100068303 3300005355 Bacteria 2964
33 Ga0070674_100006794 3300005356 Bacteria 6703
34 Ga0070674_100028002 3300005356 Bacteria 3698
35 Ga0070674_100037952 3300005356 Bacteria 3243
36 Ga0070674_100165295 3300005356 Unclassified 1682
37 Ga0070674_100243259 3300005356 Bacteria 1410
38 Ga0070673_100123808 3300005364 Bacteria 2161
39 Ga0070673_100370191 3300005364 Unclassified 1276
40 Ga0070688_100357202 3300005365 Bacteria 1071
41 Ga0070659_100003949 3300005366 Bacteria 10550
42 Ga0070659_100045121 3300005366 Bacteria 3452
43 Ga0070667_100019832 3300005367 Bacteria 5580
44 Ga0070667_100019846 3300005367 Bacteria 5577
45 Ga0070667_100076640 3300005367 Bacteria 2855
46 Ga0070713_100000036 3300005436 Bacteria 85712
47 Ga0070708_100020363 3300005445 Bacteria 5593
48 Ga0070663_100012610 3300005455 Bacteria 5356
49 Ga0070678_100000638 3300005456 Bacteria 17152
50 Ga0070678_100247285 3300005456 Bacteria 1494
51 Ga0070662_100002620 3300005457 Bacteria 11099
52 Ga0070662_100428134 3300005457 Unclassified 1096
53 Ga0070681_10315671 3300005458 Unclassified 1472
54 Ga0068867_100131421 3300005459 Bacteria 1946
55 Ga0068867_100177628 3300005459 Bacteria 1691
56 Ga0070707_100286217 3300005468 Bacteria 1601
57 Ga0070684_100009526 3300005535 Bacteria 7652
58 Ga0070684_100017912 3300005535 Bacteria 5822
59 Ga0070697_100016263 3300005536 Bacteria 5849
60 Ga0068853_100052194 3300005539 Bacteria 3522
61 Ga0068853_100287316 3300005539 Bacteria 1517
62 Ga0070672_100002101 3300005543 Bacteria 12567
63 Ga0070672_100031018 3300005543 Bacteria 4020
64 Ga0070672_100251582 3300005543 Bacteria 1488
65 Ga0070693_100014316 3300005547 Bacteria 4062
66 Ga0070693_100091593 3300005547 Bacteria 1834
67 Ga0070693_100103965 3300005547 Bacteria 1735
68 Ga0070665_100381880 3300005548 Unclassified 1416
69 Ga0070704_100022161 3300005549 Unclassified 4131
70 Ga0070664_100024682 3300005564 Bacteria 4976
71 Ga0070664_100036203 3300005564 Bacteria 4147
72 Ga0070664_100070701 3300005564 Bacteria 2989
73 Ga0070664_100085512 3300005564 Bacteria 2724
74 Ga0070664_100319207 3300005564 Unclassified 1407
75 Ga0068857_100004247 3300005577 Bacteria 12075
76 Ga0068857_100045883 3300005577 Bacteria 3878
77 Ga0068857_100130273 3300005577 Bacteria 2268
78 Ga0068854_100393361 3300005578 Bacteria 1145
79 Ga0068856_100073083 3300005614 Plasmid 3396
80 Ga0068856_100179463 3300005614 Bacteria 2130
81 Ga0070702_100013188 3300005615 Bacteria 4166
82 Ga0068852_100001418 3300005616 Bacteria 16176
83 Ga0068852_100168867 3300005616 Bacteria 2049
84 Ga0068859_100007928 3300005617 Bacteria 10771
85 Ga0068859_100022490 3300005617 Bacteria 6322
86 Ga0068859_100229601 3300005617 Bacteria 1944
87 Ga0068864_100003764 3300005618 Bacteria 12517
88 Ga0068864_100036407 3300005618 Bacteria 4195
89 Ga0068864_100075412 3300005618 Bacteria 2945
90 Ga0068864_100096288 3300005618 Bacteria 2619
91 Ga0068864_100155266 3300005618 Bacteria 2077
92 Ga0068864_100370581 3300005618 Bacteria 1355
93 Ga0068866_10007113 3300005718 Bacteria 4678
94 Ga0068861_100171758 3300005719 Bacteria 1797
95 Ga0068861_100389742 3300005719 Unclassified 1233
96 Ga0068851_10010324 3300005834 Bacteria 4356
97 Ga0068851_10017878 3300005834 Bacteria 3412
98 Ga0068851_10099419 3300005834 Bacteria 1542
99 Ga0068870_10055685 3300005840 Bacteria 2108
100 Ga0068863_100073020 3300005841 Bacteria 3245
101 Ga0068858_100024786 3300005842 Bacteria 5586
102 Ga0068860_100003065 3300005843 Bacteria 17265
103 Ga0068860_100061501 3300005843 Bacteria 3568
104 Ga0068860_100075079 3300005843 Unclassified 3216
105 Ga0068860_100093831 3300005843 Bacteria 2860
106 Ga0068860_100270503 3300005843 Unclassified 1658
107 Ga0068862_100091650 3300005844 Bacteria 2648
108 Ga0081455_10268840 3300005937 Bacteria 1238
109 Ga0097621_100009265 3300006237 Bacteria 7143
110 Ga0097621_100010631 3300006237 Bacteria 6743
111 Ga0097621_100010721 3300006237 Bacteria 6720
112 Ga0097621_100029936 3300006237 Bacteria 4304
113 Ga0097621_100030481 3300006237 Bacteria 4270
114 Ga0097621_100096872 3300006237 Bacteria 2476
115 Ga0097621_100356106 3300006237 Bacteria 1303
116 Ga0068871_100012734 3300006358 Bacteria 6219
117 Ga0068871_100062946 3300006358 Bacteria 3033
118 Ga0068871_100077315 3300006358 Bacteria 2750
119 Ga0075428_100101303 3300006844 Bacteria 3140
120 Ga0075433_10274588 3300006852 Bacteria 1494
121 Ga0075434_100254274 3300006871 Unclassified 1776
122 Ga0075434_100353622 3300006871 Bacteria 1490
123 Ga0075434_100559392 3300006871 Unclassified 1163
124 Ga0068865_100018449 3300006881 Bacteria 4501
125 Ga0068865_100025526 3300006881 Bacteria 3887
126 Ga0068865_100133488 3300006881 Unclassified 1862
127 Ga0097620_100007928 3300006931 Bacteria 10771
128 Ga0097620_100022490 3300006931 Bacteria 6322
129 Ga0097620_100229609 3300006931 Bacteria 1944
130 Ga0099794_10000571 3300007265 Bacteria 12352
131 Ga0105240_10010886 3300009093 Bacteria 12740
132 Ga0105240_10043140 3300009093 Bacteria 5742
133 Ga0111539_10164923 3300009094 Bacteria 2591
134 Ga0111539_10218960 3300009094 Bacteria 2217
135 Ga0105245_10010414 3300009098 Bacteria 8097
136 Ga0114129_10994481 3300009147 Unclassified 1057
137 Ga0105243_10159982 3300009148 Bacteria 1941
138 Ga0105241_10010058 3300009174 Bacteria 6944
139 Ga0105241_10207637 3300009174 Bacteria 1640
140 Ga0105241_10343874 3300009174 Bacteria 1293
141 Ga0105242_10000724 3300009176 Bacteria 25786
142 Ga0105242_10001208 3300009176 Bacteria 20409
143 Ga0105242_10015404 3300009176 Bacteria 5937
144 Ga0105242_10180609 3300009176 Bacteria 1861
145 Ga0105248_10000999 3300009177 Bacteria 31268
146 Ga0105248_10042355 3300009177 Bacteria 5106
147 Ga0105248_10043800 3300009177 Bacteria 5019
148 Ga0105248_10072724 3300009177 Bacteria 3864
149 Ga0105248_10081679 3300009177 Bacteria 3633
150 Ga0105248_10286094 3300009177 Bacteria 1856
151 Ga0105248_10359629 3300009177 Unclassified 1639
152 Ga0105248_10373856 3300009177 Bacteria 1604
153 Ga0105237_10007370 3300009545 Bacteria 12051
154 Ga0105238_10001949 3300009551 Bacteria 20771
155 Ga0105238_10008744 3300009551 Bacteria 10130
156 Ga0105238_10017302 3300009551 Bacteria 7324
157 Ga0105238_10247844 3300009551 Bacteria 1759
158 Ga0105249_10047072 3300009553 Bacteria 3928
159 Ga0105249_10047834 3300009553 Bacteria 3899
160 Ga0105239_10009168 3300010375 Bacteria 11194
161 Ga0105239_10393395 3300010375 Bacteria 1568
162 Ga0105246_10008085 3300011119 Bacteria 6456
163 Ga0157327_1002805 3300012512 Bacteria 1234
164 Ga0157373_10014339 3300013100 Bacteria 5809
165 Ga0157371_10051377 3300013102 Bacteria 2929
166 Ga0157369_10028252 3300013105 Bacteria 6209
167 Ga0157374_10021201 3300013296 Bacteria 5777
168 Ga0157374_10068711 3300013296 Bacteria 3334
169 Ga0157374_10153301 3300013296 Bacteria 2241
170 Ga0157378_10042600 3300013297 Bacteria 4029
171 Ga0157378_10323636 3300013297 Bacteria 1498
172 Ga0163162_10010684 3300013306 Bacteria 8929
173 Ga0163162_10196261 3300013306 Bacteria 2147
174 Ga0163162_10237423 3300013306 Unclassified 1953
175 Ga0163162_10357817 3300013306 Bacteria 1593
176 Ga0163162_10413350 3300013306 Bacteria 1481
177 Ga0157372_10024931 3300013307 Bacteria 6500
178 Ga0157375_10000333 3300013308 Bacteria 42507
179 Ga0157375_10001631 3300013308 Bacteria 19296
180 Ga0157375_10076840 3300013308 Bacteria 3367
181 Ga0157375_10299070 3300013308 Bacteria 1773
182 Ga0157375_10389428 3300013308 Bacteria 1560
183 Ga0163163_10001829 3300014325 Bacteria 17965
184 Ga0163163_10006388 3300014325 Bacteria 10297
185 Ga0163163_10277857 3300014325 Bacteria 1726
186 Ga0157380_10037036 3300014326 Bacteria 3779
187 Ga0157380_10064571 3300014326 Bacteria 2939
188 Ga0157377_10004817 3300014745 Bacteria 6267
189 Ga0157377_10049667 3300014745 Bacteria 2359
190 Ga0157379_10005400 3300014968 Bacteria 10975
191 Ga0157379_10012597 3300014968 Bacteria 7386
192 Ga0157379_10031090 3300014968 Bacteria 4757
193 Ga0157379_10114355 3300014968 Bacteria 2426
194 Ga0157379_10307829 3300014968 Bacteria 1445
195 Ga0157376_10006341 3300014969 Bacteria 8355
196 Ga0157376_10009396 3300014969 Bacteria 7103
197 Ga0157376_10020704 3300014969 Bacteria 5096
198 Ga0157376_10034904 3300014969 Unclassified 4064
199 Ga0157376_10068164 3300014969 Bacteria 3012
200 Ga0163161_10024912 3300017792 Bacteria 4229
201 Ga0163161_10216737 3300017792 Bacteria 1481
202 Ga0207673_1001939 3300025290 Bacteria 2312
203 Ga0207697_10000636 3300025315 Bacteria 20008
204 Ga0207656_10012219 3300025321 Bacteria 3260
205 Ga0207682_10009735 3300025893 Bacteria 3787
206 Ga0207682_10095649 3300025893 Bacteria 1293
207 Ga0207688_10032713 3300025901 Bacteria 2875
208 Ga0207688_10054921 3300025901 Bacteria 2235
209 Ga0207680_10051144 3300025903 Unclassified 2470
210 Ga0207680_10093057 3300025903 Unclassified 1922
211 Ga0207645_10010753 3300025907 Bacteria 6273
212 Ga0207643_10026448 3300025908 Bacteria 3212
213 Ga0207684_10050242 3300025910 Bacteria 3537
214 Ga0207654_10027282 3300025911 Plasmid 3103
215 Ga0207695_10189744 3300025913 Unclassified 1973
216 Ga0207671_10008897 3300025914 Bacteria 8454
217 Ga0207693_10232272 3300025915 Bacteria 1448
218 Ga0207662_10058738 3300025918 Bacteria 2303
219 Ga0207657_10128742 3300025919 Bacteria 2077
220 Ga0207649_10255874 3300025920 Bacteria 1263
221 Ga0207646_10175364 3300025922 Bacteria 1936
222 Ga0207681_10146981 3300025923 Bacteria 1762
223 Ga0207694_10007299 3300025924 Bacteria 8386
224 Ga0207694_10084727 3300025924 Bacteria 2493
225 Ga0207694_10107013 3300025924 Bacteria 2221
226 Ga0207694_10147658 3300025924 Bacteria 1893
227 Ga0207650_10002128 3300025925 Bacteria 13846
228 Ga0207650_10187019 3300025925 Bacteria 1653
229 Ga0207659_10000664 3300025926 Bacteria 20333
230 Ga0207659_10021996 3300025926 Bacteria 4241
231 Ga0207659_10034836 3300025926 Bacteria 3475
232 Ga0207659_10036134 3300025926 Bacteria 3420
233 Ga0207687_10047296 3300025927 Bacteria 2982
234 Ga0207700_10000062 3300025928 Bacteria 66509
235 Ga0207644_10000233 3300025931 Bacteria 38178
236 Ga0207644_10023972 3300025931 Bacteria 4184
237 Ga0207644_10048631 3300025931 Bacteria 3034
238 Ga0207686_10003009 3300025934 Bacteria 9079
239 Ga0207686_10020173 3300025934 Bacteria 3804
240 Ga0207686_10020539 3300025934 Bacteria 3775
241 Ga0207670_10303837 3300025936 Bacteria 1250
242 Ga0207669_10003255 3300025937 Bacteria 7022
243 Ga0207669_10031578 3300025937 Bacteria 2961
244 Ga0207704_10002246 3300025938 Bacteria 8672
245 Ga0207704_10006594 3300025938 Bacteria 5431
246 Ga0207704_10058093 3300025938 Unclassified 2380
247 Ga0207704_10098255 3300025938 Bacteria 1944
248 Ga0207691_10003840 3300025940 Bacteria 14579
249 Ga0207691_10003969 3300025940 Bacteria 14365
250 Ga0207691_10320333 3300025940 Bacteria 1329
251 Ga0207711_10004733 3300025941 Bacteria 11570
252 Ga0207711_10031230 3300025941 Bacteria 4496
253 Ga0207711_10031241 3300025941 Bacteria 4495
254 Ga0207711_10052634 3300025941 Bacteria 3490
255 Ga0207689_10003781 3300025942 Bacteria 13791
256 Ga0207689_10011125 3300025942 Bacteria 7724
257 Ga0207661_10025233 3300025944 Bacteria 4516
258 Ga0207661_10038672 3300025944 Bacteria 3741
259 Ga0207661_10237695 3300025944 Bacteria 1615
260 Ga0207679_10008845 3300025945 Bacteria 6420
261 Ga0207667_10361797 3300025949 Bacteria 1479
262 Ga0207667_10540345 3300025949 Unclassified 1179
263 Ga0207651_10430513 3300025960 Bacteria 1128
264 Ga0207712_10143477 3300025961 Unclassified 1835
265 Ga0207668_10007881 3300025972 Bacteria 6332
266 Ga0207668_10053961 3300025972 Bacteria 2788
267 Ga0207668_10116163 3300025972 Bacteria 2017
268 Ga0207640_10340225 3300025981 Bacteria 1201
269 Ga0207658_10006346 3300025986 Bacteria 8072
270 Ga0207658_10015011 3300025986 Bacteria 5311
271 Ga0207658_10142852 3300025986 Bacteria 1940
272 Ga0207658_10249127 3300025986 Bacteria 1508
273 Ga0207658_10394240 3300025986 Bacteria 1215
274 Ga0207677_10021186 3300026023 Bacteria 3965
275 Ga0207677_10188116 3300026023 Bacteria 1631
276 Ga0207703_10008093 3300026035 Bacteria 8310
277 Ga0207703_10122351 3300026035 Bacteria 2235
278 Ga0207639_10061422 3300026041 Bacteria 2902
279 Ga0207639_10133194 3300026041 Bacteria 2060
280 Ga0207678_10023230 3300026067 Bacteria 5424
281 Ga0207678_10075367 3300026067 Unclassified 2890
282 Ga0207678_10107031 3300026067 Bacteria 2385
283 Ga0207678_10128312 3300026067 Bacteria 2163
284 Ga0207708_10035715 3300026075 Bacteria 3782
285 Ga0207708_10280698 3300026075 Bacteria 1350
286 Ga0207702_10124601 3300026078 Unclassified 2311
287 Ga0207641_10056162 3300026088 Bacteria 3345
288 Ga0207641_10079776 3300026088 Bacteria 2838
289 Ga0207641_10480308 3300026088 Unclassified 1204
290 Ga0207648_10007183 3300026089 Bacteria 10980
291 Ga0207648_10012816 3300026089 Bacteria 7832
292 Ga0207648_10017961 3300026089 Bacteria 6415
293 Ga0207648_10131370 3300026089 Bacteria 2204
294 Ga0207648_10183735 3300026089 Bacteria 1851
295 Ga0207648_10216323 3300026089 Bacteria 1702
296 Ga0207648_10309248 3300026089 Unclassified 1418
297 Ga0207676_10039185 3300026095 Bacteria 3623
298 Ga0207676_10057673 3300026095 Bacteria 3060
299 Ga0207676_10089527 3300026095 Bacteria 2522
300 Ga0207674_10001186 3300026116 Bacteria 33879
301 Ga0207674_10009808 3300026116 Bacteria 10905
302 Ga0207674_10032329 3300026116 Bacteria 5489
303 Ga0207675_100227245 3300026118 Bacteria 1800
304 Ga0207683_10006420 3300026121 Bacteria 10070
305 Ga0207683_10010862 3300026121 Bacteria 7765
306 Ga0207683_10014853 3300026121 Bacteria 6630
307 Ga0207698_10214510 3300026142 Bacteria 1734
308 Ga0207698_10400457 3300026142 Bacteria 1312
309 Ga0209588_1015076 3300027671 Bacteria 2374
310 Ga0209974_10004157 3300027876 Bacteria 5175
311 Ga0209974_10075478 3300027876 Bacteria 1154
312 Ga0268266_10021684 3300028379 Bacteria 5474
313 Ga0268266_10030419 3300028379 Bacteria 4587
314 Ga0268266_10046881 3300028379 Unclassified 3700
315 Ga0268265_10055773 3300028380 Bacteria 3004
316 Ga0268265_10112440 3300028380 Bacteria 2226
317 Ga0268264_10030417 3300028381 Bacteria 4425
318 Ga0268264_10113878 3300028381 Bacteria 2374
319 Ga0268264_10340952 3300028381 Unclassified 1424
320 Ga0316579_10082015 3300031691 Bacteria 1536
321 Ga0316576_10207425 3300031727 Bacteria 1475
322 Ga0316578_10028651 3300031728 Bacteria 3155
323 Ga0307415_100339032 3300032126 Bacteria 1261
324 Ga0316583_10029768 3300032133 Bacteria 1946
325 Ga0316583_10058517 3300032133 Bacteria 1352
326 Ga0316585_10037739 3300032137 Bacteria 1534
327 Ga0373942_0020889 3300035207 Bacteria 1648
328 Ga0316574_0005072 3300035398 Bacteria 6995
329 Ga0316574_0008289 3300035398 Bacteria 5762
330 Ga0316574_0165325 3300035398 Bacteria 1425
331 Ga0373937_0003233 3300036401 Bacteria 13655
332 Ga0373937_0089518 3300036401 Bacteria 2850
333 Ga0373937_0106919 3300036401 Bacteria 2601
334 Ga0316582_0062026 3300036647 Bacteria 2400
335 Ga0316582_0176218 3300036647 Bacteria 1453
336 Ga0316584_0105527 3300036712 Bacteria 2108
337 Ga0373925_0001480 3300037068 Bacteria 20166
338 Ga0373925_0037519 3300037068 Bacteria 3578
339 Ga0373925_0052701 3300037068 Bacteria 3040
340 Ga0395905_0002034 3300037471 Bacteria 23113
341 Ga0395901_0063846 3300038443 Bacteria 3833
342 Ga0451576_0004712 3300045051 Bacteria 17529
343 Ga0451576_0246908 3300045051 Bacteria 1865
344 Ga0451576_0279598 3300045051 Bacteria 1745
345 Ga0495629_0031239 3300046459 Bacteria 3772
346 Ga0495580_0057270 3300046472 Bacteria 2743
347 Ga0495582_0000764 3300046473 Bacteria 17782
348 Ga0495582_0020045 3300046473 Bacteria 3658
349 Ga0495665_0002433 3300046531 Bacteria 10061
350 Ga0495621_0004102 3300046539 Bacteria 4058
351 Ga0495621_0013084 3300046539 Bacteria 2602
352 Ga0495621_0021322 3300046539 Bacteria 2136
353 Ga0495621_0030729 3300046539 Bacteria 1838
354 Ga0495656_0000764 3300046615 Bacteria 10377
355 Ga0495656_0019838 3300046615 Bacteria 2600
356 Ga0495635_0019328 3300046663 Bacteria 4751
357 Ga0495647_0001707 3300046681 Bacteria 6801
358 Ga0495658_0002717 3300046683 Bacteria 8902
359 Ga0495658_0057370 3300046683 Unclassified 2224
360 Ga0495658_0076807 3300046683 Bacteria 1953
361 Ga0495658_0148962 3300046683 Unclassified 1436
362 Ga0495600_0122092 3300046809 Bacteria 1694
363 Ga0495581_0012742 3300047315 Bacteria 4870
364 Ga0495636_0000187 3300047318 Bacteria 24622
365 Ga0495636_0002043 3300047318 Bacteria 7741
366 Ga0495636_0067855 3300047318 Bacteria 1518
367 Ga0495677_0038851 3300047445 Bacteria 1739
368 Ga0495685_039058 3300047447 Bacteria 1625
369 Ga0495684_0002042 3300047471 Bacteria 16246
370 Ga0496100_0032732 3300048903 Bacteria 3246
371 Ga0496100_0219627 3300048903 Bacteria 1394
372 Ga0496101_0062410 3300048904 Bacteria 2709
373 Ga0496102_0332183 3300048905 Bacteria 1432
374 Ga0496104_0000058 3300048907 Bacteria 118768
375 Ga0496104_0286036 3300048907 Bacteria 1561
376 Ga0496105_0000048 3300048908 Bacteria 96832
377 Ga0496106_0139314 3300048909 Bacteria 1907
378 Ga0496106_0164674 3300048909 Bacteria 1755
379 Ga0496107_0058866 3300048910 Bacteria 2779
380 Ga0496107_0159383 3300048910 Bacteria 1672
381 Ga0496107_0226286 3300048910 Bacteria 1392
382 Ga0496108_0020280 3300048911 Bacteria 5463
383 Ga0496109_0078508 3300048912 Bacteria 3040
384 Ga0496110_0018092 3300048913 Bacteria 5904
385 Ga0496110_0189352 3300048913 Bacteria 1868
386 Ga0496112_0008262 3300048915 Bacteria 9314
387 Ga0496112_0366646 3300048915 Bacteria 1382
388 Ga0496112_0605053 3300048915 Unclassified 1028
389 Ga0496113_0009939 3300048916 Bacteria 6268
390 Ga0496114_0171856 3300048917 Bacteria 1889
391 Ga0496114_0348966 3300048917 Bacteria 1309
392 Ga0496114_0447780 3300048917 Unclassified 1144
393 Ga0496115_0340092 3300048918 Bacteria 1225
394 Ga0501033_0206122 3300049570 Bacteria 1403
395 Ga0501037_0144507 3300049573 Bacteria 1702
396 Ga0501038_0021316 3300049574 Bacteria 5818
397 Ga0501041_0008327 3300049577 Bacteria 6102
398 Ga0501042_0037591 3300049578 Bacteria 3436
399 Ga0501046_0024118 3300049580 Bacteria 4995
400 Ga0501071_0278530 3300049587 Bacteria 1266
401 Ga0501072_0124264 3300049588 Bacteria 2056
402 Ga0501075_0038812 3300049591 Bacteria 3561
403 Ga0501075_0467638 3300049591 Bacteria 962
404 Ga0501076_0000182 3300049592 Bacteria 37306
405 Ga0501077_0002097 3300049593 Bacteria 12018
406 Ga0501079_0074432 3300049741 Bacteria 2625
407 Ga0501081_0000080 3300049743 Bacteria 38313
408 Ga0501045_0022180 3300049824 Bacteria 4544
409 nmdc:mga08y16_312272_c1 3300050511 Unclassified 1619
410 nmdc:mga08y16_89318_c1 3300050511 Bacteria 3211
411 nmdc:mga0n895_396765_c1 3300050512 Bacteria 1395
412 Ga0495601_0163585 3300053077 Bacteria 1454
413 Ga0500572_000409 3300053111 Bacteria 15071
414 Ga0500570_074442 3300053724 Bacteria 1566
415 Ga0501084_0010056 3300054114 Bacteria 7819
416 Ga0501084_0439084 3300054114 Bacteria 1103
417 Ga0501082_0010107 3300060353 Bacteria 8129
418 Ga0530510_0003291 3300061734 Bacteria 11118
419 Ga0070690_100067416
420 MRS1b_contig_7592505
421 Ga0065712_10103642
422 Ga0065715_10126385
423 Ga0065715_10159342
424 Ga0070683_100007283
425 Ga0070683_100007569
426 Ga0070683_100021701
427 Ga0070690_100149864
428 Ga0070670_100271087
429 Ga0070670_100275971
430 Ga0070670_100277846
431 Ga0068869_100070729
432 Ga0070666_10009625
433 Ga0070666_10009810
434 Ga0070666_10080029
435 Ga0070666_10092234
436 Ga0068868_100019180
437 Ga0068868_100221886
438 Ga0070689_100194851
439 Ga0070668_100122564
440 Ga0070668_100179628
441 Ga0070668_100412439
442 Ga0070669_100026478
443 Ga0070669_100351202
444 Ga0070675_100002928
445 Ga0070675_100099353
446 Ga0070675_100193486
447 Ga0070675_100207383
448 Ga0070671_100020833
449 Ga0070671_100045346
450 Ga0070671_100068303
451 Ga0070674_100006794
452 Ga0070674_100028002
453 Ga0070674_100037952
454 Ga0070674_100165295
455 Ga0070674_100243259
456 Ga0070673_100123808
457 Ga0070673_100370191
458 Ga0070688_100357202
459 Ga0070659_100003949
460 Ga0070659_100045121
461 Ga0070667_100019832
462 Ga0070667_100019846
463 Ga0070667_100076640
464 Ga0070713_100000036
465 Ga0070708_100020363
466 Ga0070663_100012610
467 Ga0070678_100000638
468 Ga0070678_100247285
469 Ga0070662_100002620
470 Ga0070662_100428134
471 Ga0070681_10315671
472 Ga0068867_100131421
473 Ga0068867_100177628
474 Ga0070707_100286217
475 Ga0070684_100009526
476 Ga0070684_100017912
477 Ga0070697_100016263
478 Ga0068853_100052194
479 Ga0068853_100287316
480 Ga0070672_100002101
481 Ga0070672_100031018
482 Ga0070672_100251582
483 Ga0070693_100014316
484 Ga0070693_100091593
485 Ga0070693_100103965
486 Ga0070665_100381880
487 Ga0070704_100022161
488 Ga0070664_100024682
489 Ga0070664_100036203
490 Ga0070664_100070701
491 Ga0070664_100085512
492 Ga0070664_100319207
493 Ga0068857_100004247
494 Ga0068857_100045883
495 Ga0068857_100130273
496 Ga0068854_100393361
497 Ga0068856_100073083
498 Ga0068856_100179463
499 Ga0070702_100013188
500 Ga0068852_100001418
501 Ga0068852_100168867
502 Ga0068859_100007928
503 Ga0068859_100022490
504 Ga0068859_100229601
505 Ga0068864_100003764
506 Ga0068864_100036407
507 Ga0068864_100075412
508 Ga0068864_100096288
509 Ga0068864_100155266
510 Ga0068864_100370581
511 Ga0068866_10007113
512 Ga0068861_100171758
513 Ga0068861_100389742
514 Ga0068851_10010324
515 Ga0068851_10017878
516 Ga0068851_10099419
517 Ga0068870_10055685
518 Ga0068863_100073020
519 Ga0068858_100024786
520 Ga0068860_100003065
521 Ga0068860_100061501
522 Ga0068860_100075079
523 Ga0068860_100093831
524 Ga0068860_100270503
525 Ga0068862_100091650
526 Ga0081455_10268840
527 Ga0097621_100009265
528 Ga0097621_100010631
529 Ga0097621_100010721
530 Ga0097621_100029936
531 Ga0097621_100030481
532 Ga0097621_100096872
533 Ga0097621_100356106
534 Ga0068871_100012734
535 Ga0068871_100062946
536 Ga0068871_100077315
537 Ga0075428_100101303
538 Ga0075433_10274588
539 Ga0075434_100254274
540 Ga0075434_100353622
541 Ga0075434_100559392
542 Ga0068865_100018449
543 Ga0068865_100025526
544 Ga0068865_100133488
545 Ga0097620_100007928
546 Ga0097620_100022490
547 Ga0097620_100229609
548 Ga0099794_10000571
549 Ga0105240_10010886
550 Ga0105240_10043140
551 Ga0111539_10164923
552 Ga0111539_10218960
553 Ga0105245_10010414
554 Ga0114129_10994481
555 Ga0105243_10159982
556 Ga0105241_10010058
557 Ga0105241_10207637
558 Ga0105241_10343874
559 Ga0105242_10000724
560 Ga0105242_10001208
561 Ga0105242_10015404
562 Ga0105242_10180609
563 Ga0105248_10000999
564 Ga0105248_10042355
565 Ga0105248_10043800
566 Ga0105248_10072724
567 Ga0105248_10081679
568 Ga0105248_10286094
569 Ga0105248_10359629
570 Ga0105248_10373856
571 Ga0105237_10007370
572 Ga0105238_10001949
573 Ga0105238_10008744
574 Ga0105238_10017302
575 Ga0105238_10247844
576 Ga0105249_10047072
577 Ga0105249_10047834
578 Ga0105239_10009168
579 Ga0105239_10393395
580 Ga0105246_10008085
581 Ga0157327_1002805
582 Ga0157373_10014339
583 Ga0157371_10051377
584 Ga0157369_10028252
585 Ga0157374_10021201
586 Ga0157374_10068711
587 Ga0157374_10153301
588 Ga0157378_10042600
589 Ga0157378_10323636
590 Ga0163162_10010684
591 Ga0163162_10196261
592 Ga0163162_10237423
593 Ga0163162_10357817
594 Ga0163162_10413350
595 Ga0157372_10024931
596 Ga0157375_10000333
597 Ga0157375_10001631
598 Ga0157375_10076840
599 Ga0157375_10299070
600 Ga0157375_10389428
601 Ga0163163_10001829
602 Ga0163163_10006388
603 Ga0163163_10277857
604 Ga0157380_10037036
605 Ga0157380_10064571
606 Ga0157377_10004817
607 Ga0157377_10049667
608 Ga0157379_10005400
609 Ga0157379_10012597
610 Ga0157379_10031090
611 Ga0157379_10114355
612 Ga0157379_10307829
613 Ga0157376_10006341
614 Ga0157376_10009396
615 Ga0157376_10020704
616 Ga0157376_10034904
617 Ga0157376_10068164
618 Ga0163161_10024912
619 Ga0163161_10216737
620 Ga0207673_1001939
621 Ga0207697_10000636
622 Ga0207656_10012219
623 Ga0207682_10009735
624 Ga0207682_10095649
625 Ga0207688_10032713
626 Ga0207688_10054921
627 Ga0207680_10051144
628 Ga0207680_10093057
629 Ga0207645_10010753
630 Ga0207643_10026448
631 Ga0207684_10050242
632 Ga0207654_10027282
633 Ga0207695_10189744
634 Ga0207671_10008897
635 Ga0207693_10232272
636 Ga0207662_10058738
637 Ga0207657_10128742
638 Ga0207649_10255874
639 Ga0207646_10175364
640 Ga0207681_10146981
641 Ga0207694_10007299
642 Ga0207694_10084727
643 Ga0207694_10107013
644 Ga0207694_10147658
645 Ga0207650_10002128
646 Ga0207650_10187019
647 Ga0207659_10000664
648 Ga0207659_10021996
649 Ga0207659_10034836
650 Ga0207659_10036134
651 Ga0207687_10047296
652 Ga0207700_10000062
653 Ga0207644_10000233
654 Ga0207644_10023972
655 Ga0207644_10048631
656 Ga0207686_10003009
657 Ga0207686_10020173
658 Ga0207686_10020539
659 Ga0207670_10303837
660 Ga0207669_10003255
661 Ga0207669_10031578
662 Ga0207704_10002246
663 Ga0207704_10006594
664 Ga0207704_10058093
665 Ga0207704_10098255
666 Ga0207691_10003840
667 Ga0207691_10003969
668 Ga0207691_10320333
669 Ga0207711_10004733
670 Ga0207711_10031230
671 Ga0207711_10031241
672 Ga0207711_10052634
673 Ga0207689_10003781
674 Ga0207689_10011125
675 Ga0207661_10025233
676 Ga0207661_10038672
677 Ga0207661_10237695
678 Ga0207679_10008845
679 Ga0207667_10361797
680 Ga0207667_10540345
681 Ga0207651_10430513
682 Ga0207712_10143477
683 Ga0207668_10007881
684 Ga0207668_10053961
685 Ga0207668_10116163
686 Ga0207640_10340225
687 Ga0207658_10006346
688 Ga0207658_10015011
689 Ga0207658_10142852
690 Ga0207658_10249127
691 Ga0207658_10394240
692 Ga0207677_10021186
693 Ga0207677_10188116
694 Ga0207703_10008093
695 Ga0207703_10122351
696 Ga0207639_10061422
697 Ga0207639_10133194
698 Ga0207678_10023230
699 Ga0207678_10075367
700 Ga0207678_10107031
701 Ga0207678_10128312
702 Ga0207708_10035715
703 Ga0207708_10280698
704 Ga0207702_10124601
705 Ga0207641_10056162
706 Ga0207641_10079776
707 Ga0207641_10480308
708 Ga0207648_10007183
709 Ga0207648_10012816
710 Ga0207648_10017961
711 Ga0207648_10131370
712 Ga0207648_10183735
713 Ga0207648_10216323
714 Ga0207648_10309248
715 Ga0207676_10039185
716 Ga0207676_10057673
717 Ga0207676_10089527
718 Ga0207674_10001186
719 Ga0207674_10009808
720 Ga0207674_10032329
721 Ga0207675_100227245
722 Ga0207683_10006420
723 Ga0207683_10010862
724 Ga0207683_10014853
725 Ga0207698_10214510
726 Ga0207698_10400457
727 Ga0209588_1015076
728 Ga0209974_10004157
729 Ga0209974_10075478
730 Ga0268266_10021684
731 Ga0268266_10030419
732 Ga0268266_10046881
733 Ga0268265_10055773
734 Ga0268265_10112440
735 Ga0268264_10030417
736 Ga0268264_10113878
737 Ga0268264_10340952
738 Ga0316579_10082015
739 Ga0316576_10207425
740 Ga0316578_10028651
741 Ga0307415_100339032
742 Ga0316583_10029768
743 Ga0316583_10058517
744 Ga0316585_10037739
745 Ga0373942_0020889
746 Ga0316574_0005072
747 Ga0316574_0008289
748 Ga0316574_0165325
749 Ga0373937_0003233
750 Ga0373937_0089518
751 Ga0373937_0106919
752 Ga0316582_0062026
753 Ga0316582_0176218
754 Ga0316584_0105527
755 Ga0373925_0001480
756 Ga0373925_0037519
757 Ga0373925_0052701
758 Ga0395905_0002034
759 Ga0395901_0063846
760 Ga0451576_0004712
761 Ga0451576_0246908
762 Ga0451576_0279598
763 Ga0495629_0031239
764 Ga0495580_0057270
765 Ga0495582_0000764
766 Ga0495582_0020045
767 Ga0495665_0002433
768 Ga0495621_0004102
769 Ga0495621_0013084
770 Ga0495621_0021322
771 Ga0495621_0030729
772 Ga0495656_0000764
773 Ga0495656_0019838
774 Ga0495635_0019328
775 Ga0495647_0001707
776 Ga0495658_0002717
777 Ga0495658_0057370
778 Ga0495658_0076807
779 Ga0495658_0148962
780 Ga0495600_0122092
781 Ga0495581_0012742
782 Ga0495636_0000187
783 Ga0495636_0002043
784 Ga0495636_0067855
785 Ga0495677_0038851
786 Ga0495685_039058
787 Ga0495684_0002042
788 Ga0496100_0032732
789 Ga0496100_0219627
790 Ga0496101_0062410
791 Ga0496102_0332183
792 Ga0496104_0000058
793 Ga0496104_0286036
794 Ga0496105_0000048
795 Ga0496106_0139314
796 Ga0496106_0164674
797 Ga0496107_0058866
798 Ga0496107_0159383
799 Ga0496107_0226286
800 Ga0496108_0020280
801 Ga0496109_0078508
802 Ga0496110_0018092
803 Ga0496110_0189352
804 Ga0496112_0008262
805 Ga0496112_0366646
806 Ga0496112_0605053
807 Ga0496113_0009939
808 Ga0496114_0171856
809 Ga0496114_0348966
810 Ga0496114_0447780
811 Ga0496115_0340092
812 Ga0501033_0206122
813 Ga0501037_0144507
814 Ga0501038_0021316
815 Ga0501041_0008327
816 Ga0501042_0037591
817 Ga0501046_0024118
818 Ga0501071_0278530
819 Ga0501072_0124264
820 Ga0501075_0038812
821 Ga0501075_0467638
822 Ga0501076_0000182
823 Ga0501077_0002097
824 Ga0501079_0074432
825 Ga0501081_0000080
826 Ga0501045_0022180
827 nmdc:mga08y16_312272_c1
828 nmdc:mga08y16_89318_c1
829 nmdc:mga0n895_396765_c1
830 Ga0495601_0163585
831 Ga0500572_000409
832 Ga0500570_074442
833 Ga0501084_0010056
834 Ga0501084_0439084
835 Ga0501082_0010107
836 Ga0530510_0003291

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13557

Phenol_MetA_deg

Putative MetA-pathway of phenol degradation

92

349

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4rl8-assembly2.cif.gz_B crystal structure of the cog4313 outer membrane channel from pseudomonas putida f1 0.8305 51 326
4rl8-assembly2.cif.gz_B crystal structure of the cog4313 outer membrane channel from pseudomonas putida f1 0.8275 51 326
5o68-assembly2.cif.gz_F crystal structure of the pseudomonas functional amyloid secretion protein fapf - r157a mutant 0.8045 63 326
5o68-assembly4.cif.gz_L crystal structure of the pseudomonas functional amyloid secretion protein fapf - r157a mutant 0.8033 63 326
5o68-assembly3.cif.gz_I crystal structure of the pseudomonas functional amyloid secretion protein fapf - r157a mutant 0.7986 63 326
ID Description Score Start End Superfamily
1nrfA00 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.768 282 324 3.40.710.10
4k00B00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.7396 280 327 3.10.129.10
4fqeA00 Mainly Beta;Beta Barrel;Porin;monomeric porin ompg 0.7035 70 326 2.40.160.40
af_A0A178V9P2_1_118_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7005 288 323 3.10.450.50
4fqeA00 Mainly Beta;Beta Barrel;Porin;monomeric porin ompg 0.6938 70 326 2.40.160.40
ID Description Score Start End GO Terms
AF-A0A011NYG0-F1-model_v4 Protein involved in meta-pathway of phenol degradation 0.9745 53 330
AF-A0A523N781-F1-model_v4 Transporter 0.972 102 327
AF-A0A011NYG0-F1-model_v4 Protein involved in meta-pathway of phenol degradation 0.9676 53 330
AF-A0A523N781-F1-model_v4 Transporter 0.9554 102 327
AF-A0A3D3CVQ8-F1-model_v4 Transporter 0.9549 183 324

Map