F439127

General Info

Members Datasets Scaffolds Average Seq Length
417 245 403 402

Family's Representative Sequence

Representative Sequence 3300044719|Ga0466971_0043587|Ga0466971_0043587_600_1991
Length 456
Sequence MKSPAGRRTQRIAVAALHLVVDENRSCHRECPSPATKTDRIGKRAFDNFDSQQAEPANSRYNARMSRKTKDLRRRVYLLLDQGVGVSRAGLMVDRLLIGLVSLETVPDLRARYGAIFAAVEFVSLFVFTVEYALRIWVAAEHGPHRHLHPMHARMKYILSAEGIVDLIAVLPFWLAALLPTELQVLQALRILRFFKIARYSPAMRSLLDVLYRERRALFGCLVITLGAGLLCGVLMHLAEGKIQPDKLGTIPDALWWAIVTIGTVGYGDVVPLTAIGKIIATGTIFVGLIMMALPVGIIATAFSEQVHRRDFIVTWSMIARVPLFAGLDASEINDIMQLLRAQVAEPGHVIVRAGEAAHSMYFIAAGEVEVALRNERVRLGLGQFFGEVAVLRRVRRSATATALTRTNLLVLDAQDLHALMQRSPRIAQRIKEVVEKRVGREVVSPKGDLVTEEIE

Samples

Sample ID Description Type Environment
1 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
2 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
3 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
4 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
5 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
6 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
7 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
8 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
9 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
10 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
11 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
12 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
13 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
14 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
56 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
109 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
110 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
111 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
112 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
113 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
114 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
115 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
116 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
117 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
118 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
119 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
120 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
121 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
122 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
123 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
124 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
125 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
126 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
127 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
128 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
129 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
130 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
131 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
132 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
133 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
134 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
135 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
136 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
137 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
138 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
139 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
140 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
141 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
142 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
143 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
144 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
145 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
146 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
147 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
148 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
149 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
150 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
151 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
152 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
153 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
154 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
155 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
156 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
157 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
158 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
159 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
160 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
161 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
162 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
163 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
164 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
165 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
166 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
167 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
168 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
169 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
170 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
171 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
172 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
173 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
174 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
175 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
176 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
177 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
178 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
179 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
180 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
181 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
182 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
183 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
184 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
185 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
186 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
187 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
188 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
189 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
190 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
191 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
192 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
193 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
194 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
195 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
196 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
197 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
198 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
199 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
200 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
201 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
202 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
203 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
204 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
205 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
206 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
207 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
208 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
209 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
210 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
211 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
212 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
216 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
217 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
218 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
219 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
220 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
221 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
222 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
223 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
224 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
225 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
226 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
227 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
228 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
229 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
230 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
231 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
232 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
233 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
234 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
235 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
236 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
237 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
238 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
239 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
240 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
241 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
242 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
243 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
244 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
245 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.64
Metatranscriptomes 0
Isolates 3.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.16
Nodule 2.16
Rhizoplane 7.91
Rhizosphere 85.85
Stem 0
Stem Tuber 0
Unclassified 1.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10007729 3300003203 Bacteria 4891
2 rootH1_10171787 3300003323 Bacteria 4156
3 Ga0065165_1001991 3300005262 Bacteria 19209
4 Ga0070658_10045199 3300005327 Bacteria 3560
5 Ga0070658_10105821 3300005327 Bacteria 2327
6 Ga0070658_10205460 3300005327 Bacteria 1663
7 Ga0070683_100002377 3300005329 Bacteria 14932
8 Ga0070683_100011979 3300005329 Bacteria 7523
9 Ga0070683_100037543 3300005329 Bacteria 4435
10 Ga0070690_100158158 3300005330 Bacteria 1551
11 Ga0070680_100005151 3300005336 Bacteria 9881
12 Ga0070680_100015209 3300005336 Bacteria 6029
13 Ga0070680_100017684 3300005336 Bacteria 5624
14 Ga0070680_100052589 3300005336 Bacteria 3324
15 Ga0070682_100001226 3300005337 Bacteria 14606
16 Ga0070660_100015394 3300005339 Bacteria 5521
17 Ga0070689_100112390 3300005340 Bacteria 2168
18 Ga0070675_100005321 3300005354 Bacteria 9834
19 Ga0070674_100009396 3300005356 Bacteria 5854
20 Ga0070709_10001922 3300005434 Bacteria 11290
21 Ga0070714_100016450 3300005435 Bacteria 5974
22 Ga0070713_100027748 3300005436 Bacteria 4462
23 Ga0070713_100048268 3300005436 Bacteria 3504
24 Ga0070694_100141393 3300005444 Bacteria 1749
25 Ga0070663_100022775 3300005455 Bacteria 4192
26 Ga0070678_100076551 3300005456 Unclassified 2521
27 Ga0070681_10009623 3300005458 Bacteria 9504
28 Ga0070681_10010680 3300005458 Bacteria 9077
29 Ga0070681_10093820 3300005458 Bacteria 2950
30 Ga0070681_10100918 3300005458 Bacteria 2831
31 Ga0070681_10107512 3300005458 Bacteria 2730
32 Ga0070707_100110470 3300005468 Bacteria 2666
33 Ga0070698_100062429 3300005471 Bacteria 3759
34 Ga0070698_100179795 3300005471 Bacteria 2054
35 Ga0070698_100226141 3300005471 Bacteria 1804
36 Ga0070679_100005313 3300005530 Bacteria 11919
37 Ga0070679_100063159 3300005530 Bacteria 3692
38 Ga0070679_100140458 3300005530 Bacteria 2395
39 Ga0070679_100163260 3300005530 Bacteria 2201
40 Ga0070684_100002193 3300005535 Bacteria 14395
41 Ga0070697_100007834 3300005536 Bacteria 8316
42 Ga0070697_100015365 3300005536 Bacteria 6009
43 Ga0068853_100002253 3300005539 Bacteria 14417
44 Ga0068853_100031984 3300005539 Bacteria 4454
45 Ga0068853_100100635 3300005539 Bacteria 2555
46 Ga0070672_100025625 3300005543 Bacteria 4377
47 Ga0070686_100162229 3300005544 Unclassified 1575
48 Ga0070695_100121857 3300005545 Bacteria 1785
49 Ga0070696_100012023 3300005546 Bacteria 5799
50 Ga0070696_100272961 3300005546 Unclassified 1286
51 Ga0070693_100025386 3300005547 Bacteria 3189
52 Ga0070693_100090048 3300005547 Bacteria 1848
53 Ga0070693_100111432 3300005547 Bacteria 1684
54 Ga0070704_100008566 3300005549 Bacteria 6142
55 Ga0068855_100003579 3300005563 Bacteria 18982
56 Ga0068855_100082683 3300005563 Bacteria 3721
57 Ga0068855_100088337 3300005563 Bacteria 3580
58 Ga0068855_100434054 3300005563 Bacteria 1435
59 Ga0068857_100004018 3300005577 Bacteria 12388
60 Ga0068857_100013736 3300005577 Bacteria 7055
61 Ga0068857_100131926 3300005577 Bacteria 2253
62 Ga0068854_100028602 3300005578 Bacteria 3853
63 Ga0068856_100002518 3300005614 Bacteria 18872
64 Ga0068856_100029866 3300005614 Bacteria 5327
65 Ga0068852_100119190 3300005616 Bacteria 2413
66 Ga0068851_10049508 3300005834 Bacteria 2131
67 Ga0068860_100236048 3300005843 Bacteria 1778
68 Ga0068862_100289103 3300005844 Bacteria 1505
69 Ga0081455_10001183 3300005937 Bacteria 32679
70 Ga0081455_10134884 3300005937 Bacteria 1925
71 Ga0081540_1002375 3300005983 Bacteria 15373
72 Ga0081539_10003358 3300005985 Bacteria 19831
73 Ga0070717_10012911 3300006028 Bacteria 6380
74 Ga0070717_10014675 3300006028 Bacteria 6028
75 Ga0070717_10027800 3300006028 Bacteria 4522
76 Ga0070717_10247901 3300006028 Bacteria 1572
77 Ga0075365_10004633 3300006038 Bacteria 7319
78 Ga0070715_10001361 3300006163 Bacteria 7050
79 Ga0070716_100015393 3300006173 Bacteria 3929
80 Ga0070712_100041113 3300006175 Bacteria 3172
81 Ga0070712_100048383 3300006175 Bacteria 2947
82 Ga0075366_10004889 3300006195 Bacteria 7229
83 Ga0075428_100229637 3300006844 Bacteria 2003
84 Ga0075431_100077544 3300006847 Bacteria 3429
85 Ga0075435_100060126 3300007076 Bacteria 3080
86 Ga0075435_100186729 3300007076 Bacteria 1753
87 Ga0105240_10024396 3300009093 Bacteria 7970
88 Ga0105240_10041160 3300009093 Bacteria 5901
89 Ga0111539_10143884 3300009094 Bacteria 2791
90 Ga0111539_10478194 3300009094 Bacteria 1451
91 Ga0114129_10008525 3300009147 Bacteria 14611
92 Ga0114129_10107219 3300009147 Bacteria 3859
93 Ga0105241_10001591 3300009174 Bacteria 17365
94 Ga0105241_10162773 3300009174 Bacteria 1836
95 Ga0105242_10119913 3300009176 Bacteria 2255
96 Ga0105237_10044506 3300009545 Bacteria 4470
97 Ga0105237_10322493 3300009545 Bacteria 1548
98 Ga0105238_10002564 3300009551 Bacteria 18151
99 Ga0105238_10043840 3300009551 Bacteria 4525
100 Ga0105238_10108852 3300009551 Bacteria 2752
101 Ga0105238_10209103 3300009551 Bacteria 1927
102 Ga0105249_10014660 3300009553 Bacteria 6928
103 Ga0105239_10004312 3300010375 Bacteria 17058
104 Ga0105246_10049426 3300011119 Bacteria 2880
105 Ga0157373_10008606 3300013100 Bacteria 7578
106 Ga0157373_10084237 3300013100 Bacteria 2241
107 Ga0157370_10051882 3300013104 Bacteria 3916
108 Ga0157369_10009818 3300013105 Bacteria 10946
109 Ga0163162_10280009 3300013306 Bacteria 1800
110 Ga0157372_10067626 3300013307 Bacteria 4015
111 Ga0157372_10123683 3300013307 Bacteria 2974
112 Ga0157376_10101018 3300014969 Bacteria 2520
113 Ga0207656_10027319 3300025321 Bacteria 2333
114 Ga0207647_10000650 3300025904 Bacteria 27172
115 Ga0207685_10001106 3300025905 Bacteria 5347
116 Ga0207699_10004541 3300025906 Bacteria 6632
117 Ga0207699_10012419 3300025906 Bacteria 4333
118 Ga0207684_10167749 3300025910 Bacteria 1892
119 Ga0207654_10000525 3300025911 Bacteria 21963
120 Ga0207654_10093240 3300025911 Bacteria 1841
121 Ga0207707_10000315 3300025912 Bacteria 50982
122 Ga0207707_10018340 3300025912 Bacteria 6098
123 Ga0207707_10021258 3300025912 Bacteria 5672
124 Ga0207707_10098655 3300025912 Bacteria 2553
125 Ga0207695_10001482 3300025913 Bacteria 39262
126 Ga0207695_10068935 3300025913 Bacteria 3622
127 Ga0207695_10108944 3300025913 Bacteria 2753
128 Ga0207693_10008545 3300025915 Bacteria 8381
129 Ga0207663_10115872 3300025916 Bacteria 1826
130 Ga0207660_10041005 3300025917 Bacteria 3243
131 Ga0207657_10028909 3300025919 Bacteria 5050
132 Ga0207657_10084515 3300025919 Bacteria 2659
133 Ga0207657_10152086 3300025919 Bacteria 1884
134 Ga0207652_10011743 3300025921 Bacteria 7069
135 Ga0207652_10047676 3300025921 Bacteria 3660
136 Ga0207652_10135775 3300025921 Bacteria 2197
137 Ga0207652_10245615 3300025921 Bacteria 1614
138 Ga0207652_10316222 3300025921 Bacteria 1409
139 Ga0207646_10030668 3300025922 Bacteria 4872
140 Ga0207646_10138211 3300025922 Bacteria 2194
141 Ga0207694_10000952 3300025924 Bacteria 25574
142 Ga0207694_10044635 3300025924 Bacteria 3422
143 Ga0207694_10051091 3300025924 Bacteria 3204
144 Ga0207694_10051176 3300025924 Bacteria 3201
145 Ga0207694_10092713 3300025924 Bacteria 2385
146 Ga0207700_10237148 3300025928 Bacteria 1553
147 Ga0207664_10057844 3300025929 Bacteria 3083
148 Ga0207665_10000206 3300025939 Bacteria 39664
149 Ga0207665_10113035 3300025939 Bacteria 1910
150 Ga0207691_10031319 3300025940 Bacteria 4965
151 Ga0207661_10004979 3300025944 Bacteria 9317
152 Ga0207661_10014383 3300025944 Bacteria 5799
153 Ga0207667_10089356 3300025949 Bacteria 3184
154 Ga0207667_10130414 3300025949 Bacteria 2589
155 Ga0207667_10196048 3300025949 Bacteria 2072
156 Ga0207712_10017842 3300025961 Bacteria 4616
157 Ga0207639_10004947 3300026041 Bacteria 8977
158 Ga0207639_10031164 3300026041 Bacteria 3917
159 Ga0207678_10020879 3300026067 Bacteria 5740
160 Ga0207702_10000093 3300026078 Bacteria 103678
161 Ga0207702_10034420 3300026078 Bacteria 4234
162 Ga0207674_10007699 3300026116 Bacteria 12542
163 Ga0207674_10235643 3300026116 Bacteria 1778
164 Ga0207683_10105231 3300026121 Unclassified 2522
165 Ga0207698_10039781 3300026142 Bacteria 3486
166 Ga0268264_10157992 3300028381 Unclassified 2039
167 Ga0265337_1003149 3300028556 Bacteria 7260
168 Ga0265336_10034716 3300028666 Bacteria 1558
169 Ga0265338_10069727 3300028800 Bacteria 3018
170 Ga0265330_10016592 3300031235 Bacteria 3395
171 Ga0265330_10018921 3300031235 Bacteria 3160
172 Ga0265332_10013548 3300031238 Bacteria 3612
173 Ga0265320_10014147 3300031240 Bacteria 4559
174 Ga0265325_10008308 3300031241 Bacteria 6132
175 Ga0265325_10027625 3300031241 Bacteria 3065
176 Ga0265325_10102961 3300031241 Bacteria 1395
177 Ga0265329_10023908 3300031242 Bacteria 2030
178 Ga0265340_10039154 3300031247 Bacteria 2341
179 Ga0265340_10064710 3300031247 Bacteria 1742
180 Ga0265340_10065777 3300031247 Bacteria 1726
181 Ga0265339_10107416 3300031249 Bacteria 1447
182 Ga0265313_10030189 3300031595 Bacteria 2793
183 Ga0265313_10030192 3300031595 Bacteria 2793
184 Ga0265314_10004578 3300031711 Bacteria 12768
185 Ga0265314_10005600 3300031711 Bacteria 11288
186 Ga0265314_10072539 3300031711 Unclassified 2300
187 Ga0265314_10094220 3300031711 Bacteria 1942
188 Ga0265342_10001581 3300031712 Bacteria 21006
189 Ga0265342_10004577 3300031712 Bacteria 10806
190 Ga0265342_10029058 3300031712 Bacteria 3436
191 Ga0316583_10001297 3300032133 Bacteria 8279
192 Ga0373926_0040593 3300035083 Bacteria 1661
193 Ga0373926_0064725 3300035083 Bacteria 1336
194 Ga0373934_0015869 3300035086 Bacteria 2862
195 Ga0373944_0015560 3300035089 Bacteria 2136
196 Ga0373923_0001362 3300035111 Bacteria 6955
197 Ga0373923_0002723 3300035111 Bacteria 5512
198 Ga0373936_0001298 3300035113 Bacteria 9044
199 Ga0373936_0002022 3300035113 Bacteria 7505
200 Ga0373939_0000927 3300035114 Bacteria 7278
201 Ga0373945_0004349 3300035116 Bacteria 4498
202 Ga0373945_0007516 3300035116 Bacteria 3532
203 Ga0373945_0010872 3300035116 Bacteria 3001
204 Ga0373953_0001436 3300035117 Bacteria 6901
205 Ga0373953_0021415 3300035117 Bacteria 2426
206 Ga0373953_0085448 3300035117 Bacteria 1316
207 Ga0373954_0009580 3300035118 Bacteria 4262
208 Ga0373957_0013516 3300035120 Bacteria 2771
209 Ga0373957_0034394 3300035120 Bacteria 1876
210 Ga0373943_0067772 3300035170 Bacteria 1800
211 Ga0373946_0009974 3300035171 Bacteria 3512
212 Ga0373946_0068874 3300035171 Bacteria 1523
213 Ga0373955_0001156 3300035172 Bacteria 11200
214 Ga0373955_0002479 3300035172 Bacteria 8066
215 Ga0373955_0005630 3300035172 Bacteria 5637
216 Ga0373924_0004253 3300035410 Bacteria 4987
217 Ga0373931_0049271 3300035691 Bacteria 2236
218 Ga0373935_0004684 3300035692 Bacteria 8048
219 Ga0373935_0058857 3300035692 Bacteria 2454
220 Ga0373935_0123257 3300035692 Bacteria 1734
221 Ga0373935_0206216 3300035692 Bacteria 1360
222 Ga0373927_0010704 3300035695 Bacteria 6110
223 Ga0373927_0023671 3300035695 Bacteria 4020
224 Ga0373927_0028334 3300035695 Bacteria 3652
225 Ga0373927_0042424 3300035695 Bacteria 2947
226 Ga0373933_0007385 3300035724 Bacteria 5993
227 Ga0373933_0039872 3300035724 Bacteria 2764
228 Ga0373947_0010510 3300035725 Bacteria 5309
229 Ga0373947_0039996 3300035725 Bacteria 2792
230 Ga0373947_0134710 3300035725 Bacteria 1580
231 Ga0373937_0000070 3300036401 Bacteria 92587
232 Ga0373937_0016518 3300036401 Bacteria 6558
233 Ga0373937_0027827 3300036401 Bacteria 5114
234 Ga0373937_0083868 3300036401 Bacteria 2948
235 Ga0373937_0133075 3300036401 Bacteria 2324
236 Ga0373925_0000012 3300037068 Bacteria 202139
237 Ga0373925_0013371 3300037068 Bacteria 5939
238 Ga0373925_0029922 3300037068 Bacteria 3994
239 Ga0373925_0035319 3300037068 Bacteria 3687
240 Ga0395899_0026446 3300037312 Bacteria 4379
241 Ga0395900_0008884 3300037418 Bacteria 10317
242 Ga0395898_0018570 3300037466 Bacteria 7089
243 Ga0395898_0056296 3300037466 Bacteria 3833
244 Ga0395901_0105519 3300038443 Bacteria 2957
245 Ga0395901_0301888 3300038443 Unclassified 1660
246 Ga0439453_0000460 3300041408 Bacteria 4434
247 Ga0439443_002616 3300042003 Bacteria 2172
248 Ga0466963_0251471 3300044694 Bacteria 1240
249 Ga0466964_0025036 3300044706 Bacteria 2329
250 Ga0466971_0043587 3300044719 Bacteria 2016
251 Ga0466971_0068294 3300044719 Bacteria 1612
252 Ga0466957_0020040 3300044842 Bacteria 3936
253 Ga0466957_0095771 3300044842 Bacteria 1865
254 Ga0466959_0037142 3300045049 Bacteria 3599
255 Ga0466958_0019617 3300045836 Bacteria 3936
256 Ga0495592_0000033 3300046454 Bacteria 127028
257 Ga0495629_0014698 3300046459 Bacteria 5631
258 Ga0495629_0057332 3300046459 Bacteria 2724
259 Ga0495638_0013050 3300046460 Bacteria 5672
260 Ga0495638_0085523 3300046460 Bacteria 1907
261 Ga0495641_0009498 3300046461 Bacteria 5772
262 Ga0495651_0002741 3300046462 Bacteria 13660
263 Ga0495651_0014668 3300046462 Bacteria 6060
264 Ga0495651_0061359 3300046462 Bacteria 2878
265 Ga0495651_0094368 3300046462 Bacteria 2239
266 Ga0495653_0000019 3300046463 Bacteria 178799
267 Ga0495582_0020945 3300046473 Bacteria 3580
268 Ga0495662_0018598 3300046476 Bacteria 3363
269 Ga0495664_0000005 3300046477 Bacteria 439635
270 Ga0495594_0043309 3300046499 Bacteria 2467
271 Ga0495608_0000003 3300046511 Bacteria 369831
272 Ga0495608_0034846 3300046511 Bacteria 3398
273 Ga0495618_0000009 3300046514 Bacteria 200423
274 Ga0495618_0038850 3300046514 Bacteria 2992
275 Ga0495628_0000010 3300046516 Bacteria 234932
276 Ga0495628_0061379 3300046516 Bacteria 2948
277 Ga0495628_0213473 3300046516 Bacteria 1451
278 Ga0495630_0044765 3300046517 Bacteria 3307
279 Ga0495630_0176901 3300046517 Bacteria 1626
280 Ga0495630_0194284 3300046517 Bacteria 1548
281 Ga0495630_0398677 3300046517 Bacteria 1054
282 Ga0495637_0042729 3300046520 Bacteria 1938
283 Ga0495666_0049014 3300046526 Bacteria 2032
284 Ga0495666_0061278 3300046526 Bacteria 1798
285 Ga0495652_0000016 3300046529 Bacteria 212723
286 Ga0495665_0022760 3300046531 Bacteria 3366
287 Ga0495640_0000015 3300046533 Bacteria 160055
288 Ga0495640_0037168 3300046533 Bacteria 3437
289 Ga0495640_0108322 3300046533 Bacteria 1817
290 Ga0495587_0000009 3300046536 Bacteria 241480
291 Ga0495587_0145965 3300046536 Bacteria 1349
292 Ga0495645_0000005 3300046543 Bacteria 443917
293 Ga0495667_0000073 3300046559 Bacteria 74946
294 Ga0495668_0063892 3300046616 Bacteria 2027
295 Ga0495634_0000170 3300046642 Bacteria 60197
296 Ga0495634_0080642 3300046642 Bacteria 2129
297 Ga0495635_0000013 3300046663 Bacteria 221753
298 Ga0495588_0025428 3300046674 Bacteria 2949
299 Ga0495657_0000066 3300046675 Bacteria 93382
300 Ga0495657_0024928 3300046675 Bacteria 4251
301 Ga0495657_0102765 3300046675 Bacteria 1819
302 Ga0495599_0000011 3300046678 Bacteria 207639
303 Ga0495599_0074515 3300046678 Bacteria 2119
304 Ga0495623_0000005 3300046679 Bacteria 140586
305 Ga0495646_0000011 3300046680 Bacteria 195220
306 Ga0495647_0018643 3300046681 Bacteria 2473
307 Ga0495647_0075590 3300046681 Bacteria 1356
308 Ga0495658_0018827 3300046683 Bacteria 3596
309 Ga0495658_0052964 3300046683 Bacteria 2303
310 Ga0495613_0024648 3300046689 Bacteria 4483
311 Ga0495624_0014482 3300046690 Bacteria 5351
312 Ga0495624_0042226 3300046690 Bacteria 2914
313 Ga0495600_0000004 3300046809 Bacteria 180417
314 Ga0495600_0113629 3300046809 Bacteria 1763
315 Ga0495581_0063952 3300047315 Bacteria 2125
316 Ga0495604_0000006 3300047317 Bacteria 420480
317 Ga0495604_0078484 3300047317 Bacteria 2478
318 Ga0495674_0000005 3300047319 Bacteria 375129
319 Ga0495674_0079076 3300047319 Bacteria 2824
320 Ga0495676_0058221 3300047321 Bacteria 3041
321 Ga0495680_0000141 3300047322 Bacteria 72373
322 Ga0495675_0000070 3300047444 Bacteria 71129
323 Ga0495684_0000001 3300047471 Bacteria 369809
324 Ga0495684_0003897 3300047471 Bacteria 11626
325 Ga0495593_0002024 3300047673 Bacteria 12088
326 Ga0495593_0028002 3300047673 Bacteria 3098
327 Ga0495593_0076303 3300047673 Bacteria 1737
328 Ga0495602_0000003 3300048088 Bacteria 357240
329 Ga0495602_0044759 3300048088 Bacteria 4011
330 Ga0495602_0140282 3300048088 Bacteria 1914
331 Ga0496101_0036496 3300048904 Bacteria 3482
332 Ga0496104_0068777 3300048907 Bacteria 3365
333 Ga0496104_0277904 3300048907 Bacteria 1587
334 Ga0496104_0484734 3300048907 Bacteria 1148
335 Ga0496105_0016094 3300048908 Bacteria 5965
336 Ga0496106_0043991 3300048909 Bacteria 3352
337 Ga0496106_0161382 3300048909 Unclassified 1773
338 Ga0496107_0000784 3300048910 Bacteria 18363
339 Ga0496108_0005770 3300048911 Bacteria 10030
340 Ga0496108_0058247 3300048911 Bacteria 3246
341 Ga0496108_0152827 3300048911 Bacteria 1992
342 Ga0496109_0002750 3300048912 Bacteria 14751
343 Ga0496109_0008901 3300048912 Bacteria 8553
344 Ga0496109_0031355 3300048912 Bacteria 4770
345 Ga0496109_0098316 3300048912 Bacteria 2713
346 Ga0496109_0111157 3300048912 Bacteria 2548
347 Ga0496110_0061426 3300048913 Bacteria 3316
348 Ga0496110_0063482 3300048913 Bacteria 3264
349 Ga0496110_0077956 3300048913 Bacteria 2949
350 Ga0496110_0088090 3300048913 Bacteria 2772
351 Ga0496110_0095111 3300048913 Bacteria 2668
352 Ga0496111_0140226 3300048914 Bacteria 1791
353 Ga0496111_0148523 3300048914 Bacteria 1738
354 Ga0496112_0008195 3300048915 Bacteria 9343
355 Ga0496112_0017462 3300048915 Bacteria 6741
356 Ga0496112_0037338 3300048915 Bacteria 4742
357 Ga0496112_0051740 3300048915 Bacteria 4029
358 Ga0496114_0097827 3300048917 Bacteria 2501
359 Ga0496114_0127865 3300048917 Bacteria 2192
360 Ga0496114_0303216 3300048917 Bacteria 1410
361 Ga0496115_0012076 3300048918 Bacteria 6495
362 Ga0496115_0031539 3300048918 Bacteria 4177
363 Ga0496115_0068538 3300048918 Bacteria 2873
364 Ga0496126_0005282 3300048929 Bacteria 14826
365 Ga0496126_0020578 3300048929 Bacteria 6461
366 Ga0501034_0055043 3300049571 Bacteria 4004
367 Ga0501034_0235818 3300049571 Bacteria 1777
368 Ga0501046_0147674 3300049580 Bacteria 1775
369 Ga0501047_0043667 3300049581 Bacteria 4330
370 Ga0501070_0146837 3300049586 Bacteria 1946
371 Ga0501072_0004457 3300049588 Bacteria 10639
372 Ga0501074_0111034 3300049590 Bacteria 1962
373 Ga0501075_0013209 3300049591 Bacteria 5890
374 Ga0501077_0001847 3300049593 Bacteria 12803
375 Ga0501079_0048095 3300049741 Bacteria 3291
376 Ga0501080_0032811 3300049742 Bacteria 4844
377 Ga0501081_0092415 3300049743 Bacteria 2129
378 Ga0501083_0062484 3300049744 Bacteria 2485
379 Ga0501035_0236911 3300049822 Bacteria 1554
380 nmdc:mga03n38_13560_c1 3300050490 Bacteria 3100
381 nmdc:mga0yw44_15757_c1 3300050492 Bacteria 4061
382 nmdc:mga0k408_9989_c1 3300050493 Bacteria 5125
383 nmdc:mga05p37_29702_c1 3300050507 Bacteria 6670
384 nmdc:mga05p37_30491_c1 3300050507 Bacteria 6580
385 nmdc:mga0qj67_269992_c1 3300050509 Bacteria 1379
386 nmdc:mga06r32_11442_c1 3300050510 Bacteria 7991
387 nmdc:mga0n895_35065_c1 3300050512 Bacteria 4835
388 nmdc:mga0rr50_39405_c1 3300050513 Bacteria 3427
389 nmdc:mga08x19_23_c1 3300050514 Bacteria 288286
390 Ga0495601_0000005 3300053077 Bacteria 387079
391 Ga0495601_0002836 3300053077 Bacteria 9837
392 Ga0495601_0027385 3300053077 Bacteria 3524
393 Ga0495612_0000001 3300053078 Bacteria 418244
394 Ga0495595_0000030 3300053084 Bacteria 89992
395 Ga0495595_0002509 3300053084 Bacteria 7194
396 Ga0495619_0000007 3300053085 Bacteria 369936
397 Ga0495619_0024429 3300053085 Bacteria 3876
398 Ga0500566_0023613 3300053094 Bacteria 3611
399 Ga0500562_000552 3300053108 Bacteria 9027
400 Ga0500622_0000073 3300053156 Bacteria 111045
401 Ga0501084_0006046 3300054114 Bacteria 9953
402 Ga0501084_0075119 3300054114 Bacteria 2831
403 Ga0501082_0015022 3300060353 Bacteria 6673

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046517 Ga0495630_0398677 Ga0495630_0398677_17_1039 340
2 3300047471 Ga0495684_0003897 Ga0495684_0003897_19_1056 345
3 3300048907 Ga0496104_0484734 Ga0496104_0484734_12_1109 355
4 3300005545 Ga0070695_100121857 Ga0070695_1001218572 365
5 3300005546 Ga0070696_100012023 Ga0070696_1000120232 365
6 3300005549 Ga0070704_100008566 Ga0070704_1000085662 365
7 3300009553 Ga0105249_10014660 Ga0105249_100146603 365
8 3300025961 Ga0207712_10017842 Ga0207712_100178422 365
9 3300049593 Ga0501077_0001847 Ga0501077_0001847_65_1210 365
10 3300049743 Ga0501081_0092415 Ga0501081_0092415_966_2111 365
11 3300035117 Ga0373953_0085448 Ga0373953_0085448_65_1213 368
12 3300035692 Ga0373935_0206216 Ga0373935_0206216_198_1346 368
13 3300046531 Ga0495665_0022760 Ga0495665_0022760_65_1213 368
14 3300006847 Ga0075431_100077544 Ga0075431_1000775442 371
15 3300047673 Ga0495593_0076303 Ga0495593_0076303_333_1538 371
16 3300050507 nmdc:mga05p37_30491_c1 nmdc:mga05p37_30491_c1_2812_3975 371
17 3300050509 nmdc:mga0qj67_269992_c1 nmdc:mga0qj67_269992_c1_205_1368 371
18 3300050510 nmdc:mga06r32_11442_c1 nmdc:mga06r32_11442_c1_4944_6107 371
19 3300028666 Ga0265336_10034716 Ga0265336_100347162 372
20 3300028800 Ga0265338_10069727 Ga0265338_100697272 372
21 3300031235 Ga0265330_10016592 Ga0265330_100165922 372
22 3300031241 Ga0265325_10102961 Ga0265325_101029612 372
23 3300031247 Ga0265340_10064710 Ga0265340_100647102 372
24 3300031712 Ga0265342_10029058 Ga0265342_100290582 372
25 3300048918 Ga0496115_0031539 Ga0496115_0031539_2808_3929 373
26 3300046683 Ga0495658_0052964 Ga0495658_0052964_737_1912 377
27 3300037466 Ga0395898_0056296 Ga0395898_0056296_1339_2547 378
28 3300031247 Ga0265340_10065777 Ga0265340_100657772 382
29 3300035083 Ga0373926_0064725 Ga0373926_0064725_167_1315 382
30 3300037312 Ga0395899_0026446 Ga0395899_0026446_445_1653 382
31 3300037418 Ga0395900_0008884 Ga0395900_0008884_4909_6117 382
32 3300037466 Ga0395898_0018570 Ga0395898_0018570_4333_5541 382
33 3300038443 Ga0395901_0105519 Ga0395901_0105519_660_1868 382
34 3300005536 Ga0070697_100007834 Ga0070697_1000078343 383
35 3300007076 Ga0075435_100060126 Ga0075435_1000601262 383
36 3300025939 Ga0207665_10113035 Ga0207665_101130352 383
37 3300050514 nmdc:mga08x19_23_c1 nmdc:mga08x19_23_c1_243408_244559 383
38 3300005444 Ga0070694_100141393 Ga0070694_1001413932 385
39 3300005546 Ga0070696_100272961 Ga0070696_1002729611 385
40 3300048929 Ga0496126_0020578 Ga0496126_0020578_3317_4474 385
41 3300025921 Ga0207652_10245615 Ga0207652_102456151 387
42 3300046462 Ga0495651_0094368 Ga0495651_0094368_497_1729 387
43 3300046514 Ga0495618_0038850 Ga0495618_0038850_1121_2353 387
44 3300046516 Ga0495628_0213473 Ga0495628_0213473_138_1370 387
45 3300046536 Ga0495587_0145965 Ga0495587_0145965_51_1283 387
46 3300053077 Ga0495601_0027385 Ga0495601_0027385_28_1260 387
47 3300005340 Ga0070689_100112390 Ga0070689_1001123902 388
48 3300011119 Ga0105246_10049426 Ga0105246_100494263 388
49 3300013306 Ga0163162_10280009 Ga0163162_102800091 388
50 3300048907 Ga0496104_0068777 Ga0496104_0068777_1069_2316 388
51 3300048912 Ga0496109_0031355 Ga0496109_0031355_3087_4334 388
52 3300048913 Ga0496110_0061426 Ga0496110_0061426_212_1459 388
53 3300048915 Ga0496112_0037338 Ga0496112_0037338_2224_3471 388
54 3300053108 Ga0500562_000552 Ga0500562_000552_2726_3937 389
55 3300053156 Ga0500622_0000073 Ga0500622_0000073_67705_68916 389
56 3300005937 Ga0081455_10134884 Ga0081455_101348842 390
57 iso_pu_bacteria 2824704595 2824713963 390
58 iso_pu_bacteria 2824753945 2824763520 390
59 iso_pu_bacteria 2824763712 2824766076 390
60 iso_pu_bacteria 2904711408 2904718572 390
61 3300005327 Ga0070658_10045199 Ga0070658_100451993 391
62 3300005327 Ga0070658_10105821 Ga0070658_101058213 391
63 3300005327 Ga0070658_10205460 Ga0070658_102054601 391
64 3300005336 Ga0070680_100005151 Ga0070680_1000051514 391
65 3300005336 Ga0070680_100017684 Ga0070680_1000176845 391
66 3300005337 Ga0070682_100001226 Ga0070682_1000012269 391
67 3300005339 Ga0070660_100015394 Ga0070660_1000153944 391
68 3300005458 Ga0070681_10009623 Ga0070681_100096238 391
69 3300005458 Ga0070681_10100918 Ga0070681_101009182 391
70 3300005530 Ga0070679_100163260 Ga0070679_1001632602 391
71 3300005539 Ga0068853_100002253 Ga0068853_1000022536 391
72 3300005563 Ga0068855_100082683 Ga0068855_1000826832 391
73 3300005577 Ga0068857_100013736 Ga0068857_1000137368 391
74 3300009093 Ga0105240_10041160 Ga0105240_100411604 391
75 3300009545 Ga0105237_10322493 Ga0105237_103224932 391
76 3300013100 Ga0157373_10008606 Ga0157373_100086065 391
77 3300013104 Ga0157370_10051882 Ga0157370_100518822 391
78 3300025912 Ga0207707_10021258 Ga0207707_100212582 391
79 3300025912 Ga0207707_10098655 Ga0207707_100986553 391
80 3300025919 Ga0207657_10028909 Ga0207657_100289094 391
81 3300025919 Ga0207657_10084515 Ga0207657_100845152 391
82 3300025919 Ga0207657_10152086 Ga0207657_101520861 391
83 3300025921 Ga0207652_10011743 Ga0207652_100117435 391
84 3300025949 Ga0207667_10196048 Ga0207667_101960482 391
85 3300026041 Ga0207639_10004947 Ga0207639_100049472 391
86 3300031595 Ga0265313_10030192 Ga0265313_100301922 391
87 3300031711 Ga0265314_10094220 Ga0265314_100942202 391
88 3300031712 Ga0265342_10001581 Ga0265342_1000158118 391
89 3300048908 Ga0496105_0016094 Ga0496105_0016094_4014_5222 391
90 3300048911 Ga0496108_0058247 Ga0496108_0058247_1758_2966 391
91 3300048912 Ga0496109_0002750 Ga0496109_0002750_7893_9101 391
92 3300048913 Ga0496110_0088090 Ga0496110_0088090_436_1644 391
93 3300048914 Ga0496111_0140226 Ga0496111_0140226_125_1333 391
94 3300048915 Ga0496112_0017462 Ga0496112_0017462_2661_3869 391
95 iso_pu_bacteria 2643221547 2643755484 391
96 3300009174 Ga0105241_10162773 Ga0105241_101627732 392
97 3300009551 Ga0105238_10108852 Ga0105238_101088522 392
98 3300009551 Ga0105238_10209103 Ga0105238_102091031 392
99 3300025911 Ga0207654_10093240 Ga0207654_100932402 392
100 3300025912 Ga0207707_10000315 Ga0207707_1000031531 392
101 3300025917 Ga0207660_10041005 Ga0207660_100410053 392
102 3300025921 Ga0207652_10047676 Ga0207652_100476761 392
103 3300025921 Ga0207652_10135775 Ga0207652_101357752 392
104 3300025924 Ga0207694_10051091 Ga0207694_100510913 392
105 3300025924 Ga0207694_10092713 Ga0207694_100927132 392
106 3300044694 Ga0466963_0251471 Ga0466963_0251471_20_1219 392
107 3300044706 Ga0466964_0025036 Ga0466964_0025036_228_1427 392
108 3300044719 Ga0466971_0043587 Ga0466971_0043587_600_1991 392
109 3300044842 Ga0466957_0020040 Ga0466957_0020040_1082_2281 392
110 3300045049 Ga0466959_0037142 Ga0466959_0037142_443_1642 392
111 3300045836 Ga0466958_0019617 Ga0466958_0019617_37_1236 392
112 3300048910 Ga0496107_0000784 Ga0496107_0000784_8872_10089 392
113 3300048911 Ga0496108_0005770 Ga0496108_0005770_6170_7387 392
114 3300048912 Ga0496109_0008901 Ga0496109_0008901_3719_4936 392
115 3300048913 Ga0496110_0077956 Ga0496110_0077956_166_1383 392
116 3300048913 Ga0496110_0095111 Ga0496110_0095111_151_1398 392
117 3300048915 Ga0496112_0008195 Ga0496112_0008195_4180_5397 392
118 3300048918 Ga0496115_0068538 Ga0496115_0068538_188_1405 392
119 3300035691 Ga0373931_0049271 Ga0373931_0049271_663_1922 393
120 3300048909 Ga0496106_0043991 Ga0496106_0043991_2001_3248 393
121 3300048918 Ga0496115_0012076 Ga0496115_0012076_2885_4132 393
122 3300005329 Ga0070683_100002377 Ga0070683_10000237715 394
123 3300005330 Ga0070690_100158158 Ga0070690_1001581582 394
124 3300005336 Ga0070680_100015209 Ga0070680_1000152097 394
125 3300005458 Ga0070681_10107512 Ga0070681_101075123 394
126 3300005530 Ga0070679_100005313 Ga0070679_10000531317 394
127 3300005535 Ga0070684_100002193 Ga0070684_10000219317 394
128 3300005547 Ga0070693_100090048 Ga0070693_1000900481 394
129 3300006195 Ga0075366_10004889 Ga0075366_100048897 394
130 3300007076 Ga0075435_100186729 Ga0075435_1001867292 394
131 3300013105 Ga0157369_10009818 Ga0157369_100098185 394
132 3300013307 Ga0157372_10123683 Ga0157372_101236833 394
133 3300025912 Ga0207707_10018340 Ga0207707_100183405 394
134 3300025944 Ga0207661_10004979 Ga0207661_100049797 394
135 3300026116 Ga0207674_10235643 Ga0207674_102356432 394
136 3300035111 Ga0373923_0001362 Ga0373923_0001362_4011_5237 394
137 3300035113 Ga0373936_0002022 Ga0373936_0002022_388_1614 394
138 3300035116 Ga0373945_0007516 Ga0373945_0007516_46_1272 394
139 3300035170 Ga0373943_0067772 Ga0373943_0067772_431_1657 394
140 3300035171 Ga0373946_0068874 Ga0373946_0068874_196_1422 394
141 3300035172 Ga0373955_0005630 Ga0373955_0005630_977_2203 394
142 3300035725 Ga0373947_0010510 Ga0373947_0010510_1078_2304 394
143 3300036401 Ga0373937_0027827 Ga0373937_0027827_733_1959 394
144 3300046459 Ga0495629_0057332 Ga0495629_0057332_96_1322 394
145 3300046516 Ga0495628_0061379 Ga0495628_0061379_1424_2650 394
146 3300046517 Ga0495630_0176901 Ga0495630_0176901_310_1536 394
147 3300046533 Ga0495640_0108322 Ga0495640_0108322_156_1382 394
148 3300046642 Ga0495634_0080642 Ga0495634_0080642_278_1504 394
149 3300046678 Ga0495599_0074515 Ga0495599_0074515_104_1330 394
150 3300046681 Ga0495647_0075590 Ga0495647_0075590_89_1315 394
151 3300046689 Ga0495613_0024648 Ga0495613_0024648_343_1569 394
152 3300047315 Ga0495581_0063952 Ga0495581_0063952_278_1504 394
153 3300047319 Ga0495674_0079076 Ga0495674_0079076_500_1726 394
154 3300047673 Ga0495593_0028002 Ga0495593_0028002_128_1354 394
155 3300050490 nmdc:mga03n38_13560_c1 nmdc:mga03n38_13560_c1_1513_2697 394
156 3300050513 nmdc:mga0rr50_39405_c1 nmdc:mga0rr50_39405_c1_1920_3122 394
157 3300009094 Ga0111539_10478194 Ga0111539_104781941 395
158 3300032133 Ga0316583_10001297 Ga0316583_100012974 395
159 3300031711 Ga0265314_10005600 Ga0265314_100056003 396
160 3300049571 Ga0501034_0235818 Ga0501034_0235818_255_1469 396
161 3300049744 Ga0501083_0062484 Ga0501083_0062484_1146_2390 396
162 3300049822 Ga0501035_0236911 Ga0501035_0236911_157_1371 396
163 3300048909 Ga0496106_0161382 Ga0496106_0161382_285_1532 397
164 3300005329 Ga0070683_100011979 Ga0070683_1000119791 398
165 3300005336 Ga0070680_100052589 Ga0070680_1000525893 398
166 3300005434 Ga0070709_10001922 Ga0070709_1000192211 398
167 3300005435 Ga0070714_100016450 Ga0070714_1000164504 398
168 3300005458 Ga0070681_10093820 Ga0070681_100938202 398
169 3300005547 Ga0070693_100025386 Ga0070693_1000253862 398
170 3300005563 Ga0068855_100088337 Ga0068855_1000883372 398
171 3300006175 Ga0070712_100048383 Ga0070712_1000483832 398
172 3300013100 Ga0157373_10084237 Ga0157373_100842372 398
173 3300013307 Ga0157372_10067626 Ga0157372_100676263 398
174 3300025906 Ga0207699_10012419 Ga0207699_100124193 398
175 3300025913 Ga0207695_10108944 Ga0207695_101089442 398
176 3300025915 Ga0207693_10008545 Ga0207693_100085458 398
177 3300025916 Ga0207663_10115872 Ga0207663_101158722 398
178 3300025929 Ga0207664_10057844 Ga0207664_100578442 398
179 3300025949 Ga0207667_10130414 Ga0207667_101304143 398
180 3300026078 Ga0207702_10034420 Ga0207702_100344203 398
181 3300031241 Ga0265325_10027625 Ga0265325_100276252 398
182 3300005937 Ga0081455_10001183 Ga0081455_1000118312 399
183 3300044719 Ga0466971_0068294 Ga0466971_0068294_380_1579 399
184 3300044842 Ga0466957_0095771 Ga0466957_0095771_439_1638 399
185 3300009147 Ga0114129_10107219 Ga0114129_101072192 400
186 3300028556 Ga0265337_1003149 Ga0265337_10031491 400
187 3300035086 Ga0373934_0015869 Ga0373934_0015869_1529_2731 400
188 3300035114 Ga0373939_0000927 Ga0373939_0000927_3059_4261 400
189 3300035117 Ga0373953_0021415 Ga0373953_0021415_195_1397 400
190 3300035120 Ga0373957_0013516 Ga0373957_0013516_858_2060 400
191 3300035172 Ga0373955_0001156 Ga0373955_0001156_9252_10454 400
192 3300035724 Ga0373933_0039872 Ga0373933_0039872_233_1435 400
193 3300036401 Ga0373937_0083868 Ga0373937_0083868_60_1262 400
194 3300036401 Ga0373937_0133075 Ga0373937_0133075_42_1244 400
195 3300046462 Ga0495651_0061359 Ga0495651_0061359_794_1996 400
196 3300046511 Ga0495608_0034846 Ga0495608_0034846_1487_2689 400
197 3300046675 Ga0495657_0024928 Ga0495657_0024928_2507_3709 400
198 3300046809 Ga0495600_0113629 Ga0495600_0113629_175_1377 400
199 3300047317 Ga0495604_0078484 Ga0495604_0078484_1038_2240 400
200 3300048088 Ga0495602_0140282 Ga0495602_0140282_620_1822 400
201 3300053077 Ga0495601_0002836 Ga0495601_0002836_6564_7766 400
202 3300053084 Ga0495595_0002509 Ga0495595_0002509_233_1435 400
203 3300053085 Ga0495619_0024429 Ga0495619_0024429_37_1239 400
204 3300005329 Ga0070683_100037543 Ga0070683_1000375431 401
205 3300025944 Ga0207661_10014383 Ga0207661_100143834 401
206 3300031238 Ga0265332_10013548 Ga0265332_100135482 401
207 3300031711 Ga0265314_10004578 Ga0265314_100045782 401
208 3300049571 Ga0501034_0055043 Ga0501034_0055043_546_1757 401
209 3300049586 Ga0501070_0146837 Ga0501070_0146837_107_1318 401
210 3300009093 Ga0105240_10024396 Ga0105240_100243964 402
211 3300009174 Ga0105241_10001591 Ga0105241_1000159111 402
212 3300009545 Ga0105237_10044506 Ga0105237_100445063 402
213 3300009551 Ga0105238_10002564 Ga0105238_100025645 402
214 3300010375 Ga0105239_10004312 Ga0105239_1000431215 402
215 3300049591 Ga0501075_0013209 Ga0501075_0013209_378_1637 402
216 3300049741 Ga0501079_0048095 Ga0501079_0048095_149_1411 402
217 3300054114 Ga0501084_0006046 Ga0501084_0006046_8569_9828 402
218 3300060353 Ga0501082_0015022 Ga0501082_0015022_5241_6503 402
219 iso_pu_bacteria 2935769743 2935776200 402
220 iso_pu_bacteria 2935785616 2935792106 402
221 iso_pu_bacteria 3005594810 3005597380 402
222 3300005262 Ga0065165_1001991 Ga0065165_100199112 403
223 3300005436 Ga0070713_100027748 Ga0070713_1000277486 403
224 3300006028 Ga0070717_10014675 Ga0070717_100146757 403
225 3300006173 Ga0070716_100015393 Ga0070716_1000153936 403
226 3300036401 Ga0373937_0016518 Ga0373937_0016518_870_2129 403
227 3300046460 Ga0495638_0013050 Ga0495638_0013050_3131_4348 403
228 3300046462 Ga0495651_0014668 Ga0495651_0014668_3365_4624 403
229 3300049580 Ga0501046_0147674 Ga0501046_0147674_104_1315 403
230 3300049581 Ga0501047_0043667 Ga0501047_0043667_2013_3224 403
231 3300049590 Ga0501074_0111034 Ga0501074_0111034_462_1673 403
232 3300049742 Ga0501080_0032811 Ga0501080_0032811_222_1433 403
233 3300009176 Ga0105242_10119913 Ga0105242_101199131 404
234 3300031711 Ga0265314_10072539 Ga0265314_100725393 404
235 3300046520 Ga0495637_0042729 Ga0495637_0042729_208_1437 404
236 3300046616 Ga0495668_0063892 Ga0495668_0063892_210_1439 404
237 3300048917 Ga0496114_0127865 Ga0496114_0127865_294_1511 404
238 3300048929 Ga0496126_0005282 Ga0496126_0005282_9070_10287 404
239 3300050492 nmdc:mga0yw44_15757_c1 nmdc:mga0yw44_15757_c1_2330_3559 404
240 3300003323 rootH1_10171787 rootH1_101717872 405
241 3300005458 Ga0070681_10010680 Ga0070681_100106804 405
242 3300005530 Ga0070679_100140458 Ga0070679_1001404584 405
243 3300038443 Ga0395901_0301888 Ga0395901_0301888_340_1569 405
244 3300048907 Ga0496104_0277904 Ga0496104_0277904_63_1310 405
245 3300048911 Ga0496108_0152827 Ga0496108_0152827_638_1885 405
246 3300048912 Ga0496109_0098316 Ga0496109_0098316_1020_2267 405
247 3300048915 Ga0496112_0051740 Ga0496112_0051740_234_1481 405
248 3300053094 Ga0500566_0023613 Ga0500566_0023613_2216_3439 405
249 3300046460 Ga0495638_0085523 Ga0495638_0085523_451_1671 406
250 iso_pu_bacteria 2935777560 2935784938 406
251 iso_pu_bacteria 2935793552 2935798053 406
252 iso_pu_bacteria 2941531003 2941537129 406
253 iso_pu_bacteria 8016622563 8016630719 406
254 iso_pu_bacteria 8019538911 8019542208 406
255 iso_pu_bacteria 8019547302 8019547416 406
256 3300035695 Ga0373927_0042424 Ga0373927_0042424_1613_2839 407
257 3300037068 Ga0373925_0013371 Ga0373925_0013371_2093_3319 407
258 3300048912 Ga0496109_0111157 Ga0496109_0111157_684_1937 407
259 3300048914 Ga0496111_0148523 Ga0496111_0148523_332_1585 407
260 3300048917 Ga0496114_0097827 Ga0496114_0097827_837_2090 407
261 3300005354 Ga0070675_100005321 Ga0070675_1000053217 408
262 3300005356 Ga0070674_100009396 Ga0070674_1000093963 408
263 3300005456 Ga0070678_100076551 Ga0070678_1000765512 408
264 3300005543 Ga0070672_100025625 Ga0070672_1000256252 408
265 3300005544 Ga0070686_100162229 Ga0070686_1001622292 408
266 3300025940 Ga0207691_10031319 Ga0207691_100313193 408
267 3300026121 Ga0207683_10105231 Ga0207683_101052312 408
268 3300035725 Ga0373947_0134710 Ga0373947_0134710_217_1443 408
269 3300005468 Ga0070707_100110470 Ga0070707_1001104702 409
270 3300005471 Ga0070698_100062429 Ga0070698_1000624293 409
271 3300005530 Ga0070679_100063159 Ga0070679_1000631593 409
272 3300005536 Ga0070697_100015365 Ga0070697_1000153657 409
273 3300005843 Ga0068860_100236048 Ga0068860_1002360482 409
274 3300005844 Ga0068862_100289103 Ga0068862_1002891032 409
275 3300006028 Ga0070717_10012911 Ga0070717_100129119 409
276 3300006038 Ga0075365_10004633 Ga0075365_100046335 409
277 3300006844 Ga0075428_100229637 Ga0075428_1002296372 409
278 3300009094 Ga0111539_10143884 Ga0111539_101438842 409
279 3300009551 Ga0105238_10043840 Ga0105238_100438403 409
280 3300025921 Ga0207652_10316222 Ga0207652_103162222 409
281 3300025922 Ga0207646_10030668 Ga0207646_100306685 409
282 3300025924 Ga0207694_10044635 Ga0207694_100446353 409
283 3300028381 Ga0268264_10157992 Ga0268264_101579922 409
284 3300041408 Ga0439453_0000460 Ga0439453_0000460_1872_3101 409
285 3300042003 Ga0439443_002616 Ga0439443_002616_145_1374 409
286 3300048913 Ga0496110_0063482 Ga0496110_0063482_1852_3102 409
287 3300050493 nmdc:mga0k408_9989_c1 nmdc:mga0k408_9989_c1_2981_4210 409
288 3300005471 Ga0070698_100179795 Ga0070698_1001797952 410
289 3300005471 Ga0070698_100226141 Ga0070698_1002261412 410
290 3300005547 Ga0070693_100111432 Ga0070693_1001114321 410
291 3300006028 Ga0070717_10247901 Ga0070717_102479012 410
292 3300006175 Ga0070712_100041113 Ga0070712_1000411132 410
293 3300025910 Ga0207684_10167749 Ga0207684_101677492 410
294 3300025922 Ga0207646_10138211 Ga0207646_101382112 410
295 3300031235 Ga0265330_10018921 Ga0265330_100189214 410
296 3300031240 Ga0265320_10014147 Ga0265320_100141474 410
297 3300031241 Ga0265325_10008308 Ga0265325_100083085 410
298 3300031242 Ga0265329_10023908 Ga0265329_100239082 410
299 3300031247 Ga0265340_10039154 Ga0265340_100391542 410
300 3300031595 Ga0265313_10030189 Ga0265313_100301894 410
301 3300031712 Ga0265342_10004577 Ga0265342_100045775 410
302 3300035692 Ga0373935_0123257 Ga0373935_0123257_129_1379 410
303 3300035695 Ga0373927_0023671 Ga0373927_0023671_814_2064 410
304 3300035725 Ga0373947_0039996 Ga0373947_0039996_865_2115 410
305 3300046526 Ga0495666_0061278 Ga0495666_0061278_14_1264 410
306 3300049588 Ga0501072_0004457 Ga0501072_0004457_4195_5427 410
307 3300003203 JGI25406J46586_10007729 JGI25406J46586_100077293 411
308 3300005436 Ga0070713_100048268 Ga0070713_1000482681 411
309 3300005455 Ga0070663_100022775 Ga0070663_1000227753 411
310 3300005539 Ga0068853_100031984 Ga0068853_1000319845 411
311 3300005539 Ga0068853_100100635 Ga0068853_1001006351 411
312 3300005563 Ga0068855_100003579 Ga0068855_1000035794 411
313 3300005563 Ga0068855_100434054 Ga0068855_1004340541 411
314 3300005577 Ga0068857_100004018 Ga0068857_1000040185 411
315 3300005577 Ga0068857_100131926 Ga0068857_1001319261 411
316 3300005578 Ga0068854_100028602 Ga0068854_1000286021 411
317 3300005614 Ga0068856_100002518 Ga0068856_10000251820 411
318 3300005614 Ga0068856_100029866 Ga0068856_1000298665 411
319 3300005616 Ga0068852_100119190 Ga0068852_1001191902 411
320 3300005834 Ga0068851_10049508 Ga0068851_100495081 411
321 3300005983 Ga0081540_1002375 Ga0081540_10023754 411
322 3300005985 Ga0081539_10003358 Ga0081539_100033587 411
323 3300006028 Ga0070717_10027800 Ga0070717_100278003 411
324 3300006163 Ga0070715_10001361 Ga0070715_100013613 411
325 3300009147 Ga0114129_10008525 Ga0114129_1000852515 411
326 3300014969 Ga0157376_10101018 Ga0157376_101010184 411
327 3300025321 Ga0207656_10027319 Ga0207656_100273192 411
328 3300025904 Ga0207647_10000650 Ga0207647_1000065018 411
329 3300025905 Ga0207685_10001106 Ga0207685_100011065 411
330 3300025906 Ga0207699_10004541 Ga0207699_100045416 411
331 3300025911 Ga0207654_10000525 Ga0207654_1000052521 411
332 3300025913 Ga0207695_10001482 Ga0207695_1000148214 411
333 3300025913 Ga0207695_10068935 Ga0207695_100689354 411
334 3300025924 Ga0207694_10000952 Ga0207694_1000095219 411
335 3300025924 Ga0207694_10051176 Ga0207694_100511762 411
336 3300025928 Ga0207700_10237148 Ga0207700_102371481 411
337 3300025939 Ga0207665_10000206 Ga0207665_1000020625 411
338 3300025949 Ga0207667_10089356 Ga0207667_100893562 411
339 3300026041 Ga0207639_10031164 Ga0207639_100311644 411
340 3300026067 Ga0207678_10020879 Ga0207678_100208796 411
341 3300026078 Ga0207702_10000093 Ga0207702_1000009398 411
342 3300026116 Ga0207674_10007699 Ga0207674_100076995 411
343 3300026142 Ga0207698_10039781 Ga0207698_100397814 411
344 3300031249 Ga0265339_10107416 Ga0265339_101074161 411
345 3300035083 Ga0373926_0040593 Ga0373926_0040593_233_1486 411
346 3300035089 Ga0373944_0015560 Ga0373944_0015560_238_1491 411
347 3300035111 Ga0373923_0002723 Ga0373923_0002723_3819_5060 411
348 3300035113 Ga0373936_0001298 Ga0373936_0001298_4427_5668 411
349 3300035116 Ga0373945_0004349 Ga0373945_0004349_3028_4269 411
350 3300035116 Ga0373945_0010872 Ga0373945_0010872_705_1958 411
351 3300035117 Ga0373953_0001436 Ga0373953_0001436_4868_6109 411
352 3300035118 Ga0373954_0009580 Ga0373954_0009580_201_1442 411
353 3300035120 Ga0373957_0034394 Ga0373957_0034394_456_1697 411
354 3300035171 Ga0373946_0009974 Ga0373946_0009974_1816_3069 411
355 3300035172 Ga0373955_0002479 Ga0373955_0002479_2095_3336 411
356 3300035410 Ga0373924_0004253 Ga0373924_0004253_3162_4403 411
357 3300035692 Ga0373935_0004684 Ga0373935_0004684_3989_5230 411
358 3300035692 Ga0373935_0058857 Ga0373935_0058857_357_1610 411
359 3300035695 Ga0373927_0010704 Ga0373927_0010704_1211_2452 411
360 3300035695 Ga0373927_0028334 Ga0373927_0028334_863_2116 411
361 3300035724 Ga0373933_0007385 Ga0373933_0007385_2692_3933 411
362 3300036401 Ga0373937_0000070 Ga0373937_0000070_17160_18401 411
363 3300037068 Ga0373925_0000012 Ga0373925_0000012_44809_46050 411
364 3300037068 Ga0373925_0029922 Ga0373925_0029922_2281_3534 411
365 3300037068 Ga0373925_0035319 Ga0373925_0035319_229_1482 411
366 3300046454 Ga0495592_0000033 Ga0495592_0000033_80716_81957 411
367 3300046459 Ga0495629_0014698 Ga0495629_0014698_606_1847 411
368 3300046461 Ga0495641_0009498 Ga0495641_0009498_3529_4782 411
369 3300046462 Ga0495651_0002741 Ga0495651_0002741_7216_8457 411
370 3300046463 Ga0495653_0000019 Ga0495653_0000019_14088_15329 411
371 3300046473 Ga0495582_0020945 Ga0495582_0020945_1775_3028 411
372 3300046476 Ga0495662_0018598 Ga0495662_0018598_507_1760 411
373 3300046477 Ga0495664_0000005 Ga0495664_0000005_380772_382013 411
374 3300046499 Ga0495594_0043309 Ga0495594_0043309_156_1469 411
375 3300046511 Ga0495608_0000003 Ga0495608_0000003_57565_58806 411
376 3300046514 Ga0495618_0000009 Ga0495618_0000009_141630_142871 411
377 3300046516 Ga0495628_0000010 Ga0495628_0000010_156722_157963 411
378 3300046517 Ga0495630_0044765 Ga0495630_0044765_989_2230 411
379 3300046517 Ga0495630_0194284 Ga0495630_0194284_237_1490 411
380 3300046526 Ga0495666_0049014 Ga0495666_0049014_690_2003 411
381 3300046529 Ga0495652_0000016 Ga0495652_0000016_153825_155066 411
382 3300046533 Ga0495640_0000015 Ga0495640_0000015_101171_102412 411
383 3300046533 Ga0495640_0037168 Ga0495640_0037168_1140_2453 411
384 3300046536 Ga0495587_0000009 Ga0495587_0000009_76982_78223 411
385 3300046543 Ga0495645_0000005 Ga0495645_0000005_380743_381984 411
386 3300046559 Ga0495667_0000073 Ga0495667_0000073_57647_58888 411
387 3300046642 Ga0495634_0000170 Ga0495634_0000170_1308_2549 411
388 3300046663 Ga0495635_0000013 Ga0495635_0000013_57618_58859 411
389 3300046674 Ga0495588_0025428 Ga0495588_0025428_806_2059 411
390 3300046675 Ga0495657_0000066 Ga0495657_0000066_78033_79274 411
391 3300046675 Ga0495657_0102765 Ga0495657_0102765_281_1534 411
392 3300046678 Ga0495599_0000011 Ga0495599_0000011_148826_150067 411
393 3300046679 Ga0495623_0000005 Ga0495623_0000005_85130_86371 411
394 3300046680 Ga0495646_0000011 Ga0495646_0000011_148721_149962 411
395 3300046681 Ga0495647_0018643 Ga0495647_0018643_910_2163 411
396 3300046683 Ga0495658_0018827 Ga0495658_0018827_2113_3366 411
397 3300046690 Ga0495624_0014482 Ga0495624_0014482_3522_4763 411
398 3300046690 Ga0495624_0042226 Ga0495624_0042226_703_1956 411
399 3300046809 Ga0495600_0000004 Ga0495600_0000004_57582_58823 411
400 3300047317 Ga0495604_0000006 Ga0495604_0000006_141645_142886 411
401 3300047319 Ga0495674_0000005 Ga0495674_0000005_62859_64100 411
402 3300047321 Ga0495676_0058221 Ga0495676_0058221_386_1639 411
403 3300047322 Ga0495680_0000141 Ga0495680_0000141_57495_58736 411
404 3300047444 Ga0495675_0000070 Ga0495675_0000070_12446_13687 411
405 3300047471 Ga0495684_0000001 Ga0495684_0000001_311006_312247 411
406 3300047673 Ga0495593_0002024 Ga0495593_0002024_6641_7882 411
407 3300048088 Ga0495602_0000003 Ga0495602_0000003_45102_46343 411
408 3300048088 Ga0495602_0044759 Ga0495602_0044759_514_1767 411
409 3300048904 Ga0496101_0036496 Ga0496101_0036496_1075_2322 411
410 3300048917 Ga0496114_0303216 Ga0496114_0303216_153_1394 411
411 3300050507 nmdc:mga05p37_29702_c1 nmdc:mga05p37_29702_c1_1291_2538 411
412 3300050512 nmdc:mga0n895_35065_c1 nmdc:mga0n895_35065_c1_1247_2506 411
413 3300053077 Ga0495601_0000005 Ga0495601_0000005_308910_310151 411
414 3300053078 Ga0495612_0000001 Ga0495612_0000001_105974_107215 411
415 3300053084 Ga0495595_0000030 Ga0495595_0000030_81747_82988 411
416 3300053085 Ga0495619_0000007 Ga0495619_0000007_311030_312271 411
417 3300054114 Ga0501084_0075119 Ga0501084_0075119_446_1684 411

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00027

cNMP_binding

Cyclic nucleotide-binding domain

342

424

0.94

PF00520

Ion_trans

Ion transport protein

96

311

0.9

PF07885

Ion_trans_2

Ion channel

221

305

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ffq-assembly1.cif.gz_A hcn2i 443-640 apo-state 0.921 263 380
1q3e-assembly1.cif.gz_A hcn2j 443-645 in the presence of cgmp 0.9092 263 385
3etq-assembly1.cif.gz_B x-ray structure of cysteine-free fragment of mhcn2 c-terminal region from amino acids 443-630 including c508n, c584s, and c601s mutations 0.9085 263 385
3ffq-assembly2.cif.gz_B hcn2i 443-640 apo-state 0.9074 263 382
4ev0-assembly1.cif.gz_A crystal structure of thermus thermophilus catabolite activator protein 0.9073 268 390
ID Description Score Start End Superfamily
3behA02 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9392 161 254 1.10.287.70
3behC02 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9353 161 254 1.10.287.70
af_D3ZZR6_410_519_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9249 146 251 1.10.287.70
af_Q8CFS6_411_520_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9232 146 251 1.10.287.70
af_J3K003_426_535_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9231 146 254 1.10.287.70
ID Description Score Start End GO Terms
AF-A0A1Q3NPE7-F1-model_v4 Cyclic nucleotide-binding protein 0.9514 262 383 GO:0004622
GO:0016020
GO:0016042
GO:0046470
AF-A0A812RIZ9-F1-model_v4 Egl-4 protein 0.9418 262 365 GO:0004674
GO:0005524
GO:0005829
GO:0046872
AF-A0A536P6M3-F1-model_v4 Cyclic nucleotide-binding domain-containing protein 0.9378 263 392 GO:0004862
GO:0005829
GO:0005952
GO:0030552
GO:0034236
AF-A0A6M1YJX6-F1-model_v4 Cyclic nucleotide-binding domain-containing protein 0.9378 263 383
AF-A0A2V7UZQ1-F1-model_v4 Crp/Fnr family transcriptional regulator 0.9375 262 379 GO:0003677
GO:0003700
GO:0005829

Feature Viewer

pLDDT pTM Quality
77.8 0.54 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map