F439127
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 417 | 245 | 403 | 402 |
Family's Representative Sequence
| Representative Sequence | 3300044719|Ga0466971_0043587|Ga0466971_0043587_600_1991 |
| Length | 456 |
| Sequence | MKSPAGRRTQRIAVAALHLVVDENRSCHRECPSPATKTDRIGKRAFDNFDSQQAEPANSRYNARMSRKTKDLRRRVYLLLDQGVGVSRAGLMVDRLLIGLVSLETVPDLRARYGAIFAAVEFVSLFVFTVEYALRIWVAAEHGPHRHLHPMHARMKYILSAEGIVDLIAVLPFWLAALLPTELQVLQALRILRFFKIARYSPAMRSLLDVLYRERRALFGCLVITLGAGLLCGVLMHLAEGKIQPDKLGTIPDALWWAIVTIGTVGYGDVVPLTAIGKIIATGTIFVGLIMMALPVGIIATAFSEQVHRRDFIVTWSMIARVPLFAGLDASEINDIMQLLRAQVAEPGHVIVRAGEAAHSMYFIAAGEVEVALRNERVRLGLGQFFGEVAVLRRVRRSATATALTRTNLLVLDAQDLHALMQRSPRIAQRIKEVVEKRVGREVVSPKGDLVTEEIE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 2 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 3 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 4 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 5 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 6 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 7 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 8 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 9 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 10 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 11 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 12 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 13 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 14 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 15 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 37 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 44 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 45 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 46 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 47 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 48 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 49 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 50 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 51 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 52 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 53 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 54 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 56 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 60 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 61 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 62 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 63 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 109 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 110 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 111 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 112 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 113 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 114 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 115 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 116 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 117 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 118 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 119 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 120 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 121 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 122 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 123 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 124 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 125 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 126 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 127 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 128 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 129 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 130 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 131 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 132 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 133 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 134 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 135 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 136 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 137 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 138 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 139 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 140 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 141 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 142 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 143 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 144 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 145 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 146 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 147 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 148 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 149 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 150 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 151 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 152 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 153 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 154 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 155 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 200 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 201 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 202 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 203 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 204 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 205 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 206 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 207 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 208 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 209 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 210 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 211 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 212 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 213 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 214 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 215 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 216 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 217 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 218 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 219 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 220 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 221 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 222 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 223 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 224 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 225 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 226 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 227 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 228 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 229 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 230 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 231 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 232 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 233 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 234 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 239 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 240 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 241 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 242 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 243 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 244 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 245 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.64 |
| Metatranscriptomes | 0 |
| Isolates | 3.36 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.16 |
| Nodule | 2.16 |
| Rhizoplane | 7.91 |
| Rhizosphere | 85.85 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.92 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10007729 | 3300003203 | Bacteria | 4891 |
| 2 | rootH1_10171787 | 3300003323 | Bacteria | 4156 |
| 3 | Ga0065165_1001991 | 3300005262 | Bacteria | 19209 |
| 4 | Ga0070658_10045199 | 3300005327 | Bacteria | 3560 |
| 5 | Ga0070658_10105821 | 3300005327 | Bacteria | 2327 |
| 6 | Ga0070658_10205460 | 3300005327 | Bacteria | 1663 |
| 7 | Ga0070683_100002377 | 3300005329 | Bacteria | 14932 |
| 8 | Ga0070683_100011979 | 3300005329 | Bacteria | 7523 |
| 9 | Ga0070683_100037543 | 3300005329 | Bacteria | 4435 |
| 10 | Ga0070690_100158158 | 3300005330 | Bacteria | 1551 |
| 11 | Ga0070680_100005151 | 3300005336 | Bacteria | 9881 |
| 12 | Ga0070680_100015209 | 3300005336 | Bacteria | 6029 |
| 13 | Ga0070680_100017684 | 3300005336 | Bacteria | 5624 |
| 14 | Ga0070680_100052589 | 3300005336 | Bacteria | 3324 |
| 15 | Ga0070682_100001226 | 3300005337 | Bacteria | 14606 |
| 16 | Ga0070660_100015394 | 3300005339 | Bacteria | 5521 |
| 17 | Ga0070689_100112390 | 3300005340 | Bacteria | 2168 |
| 18 | Ga0070675_100005321 | 3300005354 | Bacteria | 9834 |
| 19 | Ga0070674_100009396 | 3300005356 | Bacteria | 5854 |
| 20 | Ga0070709_10001922 | 3300005434 | Bacteria | 11290 |
| 21 | Ga0070714_100016450 | 3300005435 | Bacteria | 5974 |
| 22 | Ga0070713_100027748 | 3300005436 | Bacteria | 4462 |
| 23 | Ga0070713_100048268 | 3300005436 | Bacteria | 3504 |
| 24 | Ga0070694_100141393 | 3300005444 | Bacteria | 1749 |
| 25 | Ga0070663_100022775 | 3300005455 | Bacteria | 4192 |
| 26 | Ga0070678_100076551 | 3300005456 | Unclassified | 2521 |
| 27 | Ga0070681_10009623 | 3300005458 | Bacteria | 9504 |
| 28 | Ga0070681_10010680 | 3300005458 | Bacteria | 9077 |
| 29 | Ga0070681_10093820 | 3300005458 | Bacteria | 2950 |
| 30 | Ga0070681_10100918 | 3300005458 | Bacteria | 2831 |
| 31 | Ga0070681_10107512 | 3300005458 | Bacteria | 2730 |
| 32 | Ga0070707_100110470 | 3300005468 | Bacteria | 2666 |
| 33 | Ga0070698_100062429 | 3300005471 | Bacteria | 3759 |
| 34 | Ga0070698_100179795 | 3300005471 | Bacteria | 2054 |
| 35 | Ga0070698_100226141 | 3300005471 | Bacteria | 1804 |
| 36 | Ga0070679_100005313 | 3300005530 | Bacteria | 11919 |
| 37 | Ga0070679_100063159 | 3300005530 | Bacteria | 3692 |
| 38 | Ga0070679_100140458 | 3300005530 | Bacteria | 2395 |
| 39 | Ga0070679_100163260 | 3300005530 | Bacteria | 2201 |
| 40 | Ga0070684_100002193 | 3300005535 | Bacteria | 14395 |
| 41 | Ga0070697_100007834 | 3300005536 | Bacteria | 8316 |
| 42 | Ga0070697_100015365 | 3300005536 | Bacteria | 6009 |
| 43 | Ga0068853_100002253 | 3300005539 | Bacteria | 14417 |
| 44 | Ga0068853_100031984 | 3300005539 | Bacteria | 4454 |
| 45 | Ga0068853_100100635 | 3300005539 | Bacteria | 2555 |
| 46 | Ga0070672_100025625 | 3300005543 | Bacteria | 4377 |
| 47 | Ga0070686_100162229 | 3300005544 | Unclassified | 1575 |
| 48 | Ga0070695_100121857 | 3300005545 | Bacteria | 1785 |
| 49 | Ga0070696_100012023 | 3300005546 | Bacteria | 5799 |
| 50 | Ga0070696_100272961 | 3300005546 | Unclassified | 1286 |
| 51 | Ga0070693_100025386 | 3300005547 | Bacteria | 3189 |
| 52 | Ga0070693_100090048 | 3300005547 | Bacteria | 1848 |
| 53 | Ga0070693_100111432 | 3300005547 | Bacteria | 1684 |
| 54 | Ga0070704_100008566 | 3300005549 | Bacteria | 6142 |
| 55 | Ga0068855_100003579 | 3300005563 | Bacteria | 18982 |
| 56 | Ga0068855_100082683 | 3300005563 | Bacteria | 3721 |
| 57 | Ga0068855_100088337 | 3300005563 | Bacteria | 3580 |
| 58 | Ga0068855_100434054 | 3300005563 | Bacteria | 1435 |
| 59 | Ga0068857_100004018 | 3300005577 | Bacteria | 12388 |
| 60 | Ga0068857_100013736 | 3300005577 | Bacteria | 7055 |
| 61 | Ga0068857_100131926 | 3300005577 | Bacteria | 2253 |
| 62 | Ga0068854_100028602 | 3300005578 | Bacteria | 3853 |
| 63 | Ga0068856_100002518 | 3300005614 | Bacteria | 18872 |
| 64 | Ga0068856_100029866 | 3300005614 | Bacteria | 5327 |
| 65 | Ga0068852_100119190 | 3300005616 | Bacteria | 2413 |
| 66 | Ga0068851_10049508 | 3300005834 | Bacteria | 2131 |
| 67 | Ga0068860_100236048 | 3300005843 | Bacteria | 1778 |
| 68 | Ga0068862_100289103 | 3300005844 | Bacteria | 1505 |
| 69 | Ga0081455_10001183 | 3300005937 | Bacteria | 32679 |
| 70 | Ga0081455_10134884 | 3300005937 | Bacteria | 1925 |
| 71 | Ga0081540_1002375 | 3300005983 | Bacteria | 15373 |
| 72 | Ga0081539_10003358 | 3300005985 | Bacteria | 19831 |
| 73 | Ga0070717_10012911 | 3300006028 | Bacteria | 6380 |
| 74 | Ga0070717_10014675 | 3300006028 | Bacteria | 6028 |
| 75 | Ga0070717_10027800 | 3300006028 | Bacteria | 4522 |
| 76 | Ga0070717_10247901 | 3300006028 | Bacteria | 1572 |
| 77 | Ga0075365_10004633 | 3300006038 | Bacteria | 7319 |
| 78 | Ga0070715_10001361 | 3300006163 | Bacteria | 7050 |
| 79 | Ga0070716_100015393 | 3300006173 | Bacteria | 3929 |
| 80 | Ga0070712_100041113 | 3300006175 | Bacteria | 3172 |
| 81 | Ga0070712_100048383 | 3300006175 | Bacteria | 2947 |
| 82 | Ga0075366_10004889 | 3300006195 | Bacteria | 7229 |
| 83 | Ga0075428_100229637 | 3300006844 | Bacteria | 2003 |
| 84 | Ga0075431_100077544 | 3300006847 | Bacteria | 3429 |
| 85 | Ga0075435_100060126 | 3300007076 | Bacteria | 3080 |
| 86 | Ga0075435_100186729 | 3300007076 | Bacteria | 1753 |
| 87 | Ga0105240_10024396 | 3300009093 | Bacteria | 7970 |
| 88 | Ga0105240_10041160 | 3300009093 | Bacteria | 5901 |
| 89 | Ga0111539_10143884 | 3300009094 | Bacteria | 2791 |
| 90 | Ga0111539_10478194 | 3300009094 | Bacteria | 1451 |
| 91 | Ga0114129_10008525 | 3300009147 | Bacteria | 14611 |
| 92 | Ga0114129_10107219 | 3300009147 | Bacteria | 3859 |
| 93 | Ga0105241_10001591 | 3300009174 | Bacteria | 17365 |
| 94 | Ga0105241_10162773 | 3300009174 | Bacteria | 1836 |
| 95 | Ga0105242_10119913 | 3300009176 | Bacteria | 2255 |
| 96 | Ga0105237_10044506 | 3300009545 | Bacteria | 4470 |
| 97 | Ga0105237_10322493 | 3300009545 | Bacteria | 1548 |
| 98 | Ga0105238_10002564 | 3300009551 | Bacteria | 18151 |
| 99 | Ga0105238_10043840 | 3300009551 | Bacteria | 4525 |
| 100 | Ga0105238_10108852 | 3300009551 | Bacteria | 2752 |
| 101 | Ga0105238_10209103 | 3300009551 | Bacteria | 1927 |
| 102 | Ga0105249_10014660 | 3300009553 | Bacteria | 6928 |
| 103 | Ga0105239_10004312 | 3300010375 | Bacteria | 17058 |
| 104 | Ga0105246_10049426 | 3300011119 | Bacteria | 2880 |
| 105 | Ga0157373_10008606 | 3300013100 | Bacteria | 7578 |
| 106 | Ga0157373_10084237 | 3300013100 | Bacteria | 2241 |
| 107 | Ga0157370_10051882 | 3300013104 | Bacteria | 3916 |
| 108 | Ga0157369_10009818 | 3300013105 | Bacteria | 10946 |
| 109 | Ga0163162_10280009 | 3300013306 | Bacteria | 1800 |
| 110 | Ga0157372_10067626 | 3300013307 | Bacteria | 4015 |
| 111 | Ga0157372_10123683 | 3300013307 | Bacteria | 2974 |
| 112 | Ga0157376_10101018 | 3300014969 | Bacteria | 2520 |
| 113 | Ga0207656_10027319 | 3300025321 | Bacteria | 2333 |
| 114 | Ga0207647_10000650 | 3300025904 | Bacteria | 27172 |
| 115 | Ga0207685_10001106 | 3300025905 | Bacteria | 5347 |
| 116 | Ga0207699_10004541 | 3300025906 | Bacteria | 6632 |
| 117 | Ga0207699_10012419 | 3300025906 | Bacteria | 4333 |
| 118 | Ga0207684_10167749 | 3300025910 | Bacteria | 1892 |
| 119 | Ga0207654_10000525 | 3300025911 | Bacteria | 21963 |
| 120 | Ga0207654_10093240 | 3300025911 | Bacteria | 1841 |
| 121 | Ga0207707_10000315 | 3300025912 | Bacteria | 50982 |
| 122 | Ga0207707_10018340 | 3300025912 | Bacteria | 6098 |
| 123 | Ga0207707_10021258 | 3300025912 | Bacteria | 5672 |
| 124 | Ga0207707_10098655 | 3300025912 | Bacteria | 2553 |
| 125 | Ga0207695_10001482 | 3300025913 | Bacteria | 39262 |
| 126 | Ga0207695_10068935 | 3300025913 | Bacteria | 3622 |
| 127 | Ga0207695_10108944 | 3300025913 | Bacteria | 2753 |
| 128 | Ga0207693_10008545 | 3300025915 | Bacteria | 8381 |
| 129 | Ga0207663_10115872 | 3300025916 | Bacteria | 1826 |
| 130 | Ga0207660_10041005 | 3300025917 | Bacteria | 3243 |
| 131 | Ga0207657_10028909 | 3300025919 | Bacteria | 5050 |
| 132 | Ga0207657_10084515 | 3300025919 | Bacteria | 2659 |
| 133 | Ga0207657_10152086 | 3300025919 | Bacteria | 1884 |
| 134 | Ga0207652_10011743 | 3300025921 | Bacteria | 7069 |
| 135 | Ga0207652_10047676 | 3300025921 | Bacteria | 3660 |
| 136 | Ga0207652_10135775 | 3300025921 | Bacteria | 2197 |
| 137 | Ga0207652_10245615 | 3300025921 | Bacteria | 1614 |
| 138 | Ga0207652_10316222 | 3300025921 | Bacteria | 1409 |
| 139 | Ga0207646_10030668 | 3300025922 | Bacteria | 4872 |
| 140 | Ga0207646_10138211 | 3300025922 | Bacteria | 2194 |
| 141 | Ga0207694_10000952 | 3300025924 | Bacteria | 25574 |
| 142 | Ga0207694_10044635 | 3300025924 | Bacteria | 3422 |
| 143 | Ga0207694_10051091 | 3300025924 | Bacteria | 3204 |
| 144 | Ga0207694_10051176 | 3300025924 | Bacteria | 3201 |
| 145 | Ga0207694_10092713 | 3300025924 | Bacteria | 2385 |
| 146 | Ga0207700_10237148 | 3300025928 | Bacteria | 1553 |
| 147 | Ga0207664_10057844 | 3300025929 | Bacteria | 3083 |
| 148 | Ga0207665_10000206 | 3300025939 | Bacteria | 39664 |
| 149 | Ga0207665_10113035 | 3300025939 | Bacteria | 1910 |
| 150 | Ga0207691_10031319 | 3300025940 | Bacteria | 4965 |
| 151 | Ga0207661_10004979 | 3300025944 | Bacteria | 9317 |
| 152 | Ga0207661_10014383 | 3300025944 | Bacteria | 5799 |
| 153 | Ga0207667_10089356 | 3300025949 | Bacteria | 3184 |
| 154 | Ga0207667_10130414 | 3300025949 | Bacteria | 2589 |
| 155 | Ga0207667_10196048 | 3300025949 | Bacteria | 2072 |
| 156 | Ga0207712_10017842 | 3300025961 | Bacteria | 4616 |
| 157 | Ga0207639_10004947 | 3300026041 | Bacteria | 8977 |
| 158 | Ga0207639_10031164 | 3300026041 | Bacteria | 3917 |
| 159 | Ga0207678_10020879 | 3300026067 | Bacteria | 5740 |
| 160 | Ga0207702_10000093 | 3300026078 | Bacteria | 103678 |
| 161 | Ga0207702_10034420 | 3300026078 | Bacteria | 4234 |
| 162 | Ga0207674_10007699 | 3300026116 | Bacteria | 12542 |
| 163 | Ga0207674_10235643 | 3300026116 | Bacteria | 1778 |
| 164 | Ga0207683_10105231 | 3300026121 | Unclassified | 2522 |
| 165 | Ga0207698_10039781 | 3300026142 | Bacteria | 3486 |
| 166 | Ga0268264_10157992 | 3300028381 | Unclassified | 2039 |
| 167 | Ga0265337_1003149 | 3300028556 | Bacteria | 7260 |
| 168 | Ga0265336_10034716 | 3300028666 | Bacteria | 1558 |
| 169 | Ga0265338_10069727 | 3300028800 | Bacteria | 3018 |
| 170 | Ga0265330_10016592 | 3300031235 | Bacteria | 3395 |
| 171 | Ga0265330_10018921 | 3300031235 | Bacteria | 3160 |
| 172 | Ga0265332_10013548 | 3300031238 | Bacteria | 3612 |
| 173 | Ga0265320_10014147 | 3300031240 | Bacteria | 4559 |
| 174 | Ga0265325_10008308 | 3300031241 | Bacteria | 6132 |
| 175 | Ga0265325_10027625 | 3300031241 | Bacteria | 3065 |
| 176 | Ga0265325_10102961 | 3300031241 | Bacteria | 1395 |
| 177 | Ga0265329_10023908 | 3300031242 | Bacteria | 2030 |
| 178 | Ga0265340_10039154 | 3300031247 | Bacteria | 2341 |
| 179 | Ga0265340_10064710 | 3300031247 | Bacteria | 1742 |
| 180 | Ga0265340_10065777 | 3300031247 | Bacteria | 1726 |
| 181 | Ga0265339_10107416 | 3300031249 | Bacteria | 1447 |
| 182 | Ga0265313_10030189 | 3300031595 | Bacteria | 2793 |
| 183 | Ga0265313_10030192 | 3300031595 | Bacteria | 2793 |
| 184 | Ga0265314_10004578 | 3300031711 | Bacteria | 12768 |
| 185 | Ga0265314_10005600 | 3300031711 | Bacteria | 11288 |
| 186 | Ga0265314_10072539 | 3300031711 | Unclassified | 2300 |
| 187 | Ga0265314_10094220 | 3300031711 | Bacteria | 1942 |
| 188 | Ga0265342_10001581 | 3300031712 | Bacteria | 21006 |
| 189 | Ga0265342_10004577 | 3300031712 | Bacteria | 10806 |
| 190 | Ga0265342_10029058 | 3300031712 | Bacteria | 3436 |
| 191 | Ga0316583_10001297 | 3300032133 | Bacteria | 8279 |
| 192 | Ga0373926_0040593 | 3300035083 | Bacteria | 1661 |
| 193 | Ga0373926_0064725 | 3300035083 | Bacteria | 1336 |
| 194 | Ga0373934_0015869 | 3300035086 | Bacteria | 2862 |
| 195 | Ga0373944_0015560 | 3300035089 | Bacteria | 2136 |
| 196 | Ga0373923_0001362 | 3300035111 | Bacteria | 6955 |
| 197 | Ga0373923_0002723 | 3300035111 | Bacteria | 5512 |
| 198 | Ga0373936_0001298 | 3300035113 | Bacteria | 9044 |
| 199 | Ga0373936_0002022 | 3300035113 | Bacteria | 7505 |
| 200 | Ga0373939_0000927 | 3300035114 | Bacteria | 7278 |
| 201 | Ga0373945_0004349 | 3300035116 | Bacteria | 4498 |
| 202 | Ga0373945_0007516 | 3300035116 | Bacteria | 3532 |
| 203 | Ga0373945_0010872 | 3300035116 | Bacteria | 3001 |
| 204 | Ga0373953_0001436 | 3300035117 | Bacteria | 6901 |
| 205 | Ga0373953_0021415 | 3300035117 | Bacteria | 2426 |
| 206 | Ga0373953_0085448 | 3300035117 | Bacteria | 1316 |
| 207 | Ga0373954_0009580 | 3300035118 | Bacteria | 4262 |
| 208 | Ga0373957_0013516 | 3300035120 | Bacteria | 2771 |
| 209 | Ga0373957_0034394 | 3300035120 | Bacteria | 1876 |
| 210 | Ga0373943_0067772 | 3300035170 | Bacteria | 1800 |
| 211 | Ga0373946_0009974 | 3300035171 | Bacteria | 3512 |
| 212 | Ga0373946_0068874 | 3300035171 | Bacteria | 1523 |
| 213 | Ga0373955_0001156 | 3300035172 | Bacteria | 11200 |
| 214 | Ga0373955_0002479 | 3300035172 | Bacteria | 8066 |
| 215 | Ga0373955_0005630 | 3300035172 | Bacteria | 5637 |
| 216 | Ga0373924_0004253 | 3300035410 | Bacteria | 4987 |
| 217 | Ga0373931_0049271 | 3300035691 | Bacteria | 2236 |
| 218 | Ga0373935_0004684 | 3300035692 | Bacteria | 8048 |
| 219 | Ga0373935_0058857 | 3300035692 | Bacteria | 2454 |
| 220 | Ga0373935_0123257 | 3300035692 | Bacteria | 1734 |
| 221 | Ga0373935_0206216 | 3300035692 | Bacteria | 1360 |
| 222 | Ga0373927_0010704 | 3300035695 | Bacteria | 6110 |
| 223 | Ga0373927_0023671 | 3300035695 | Bacteria | 4020 |
| 224 | Ga0373927_0028334 | 3300035695 | Bacteria | 3652 |
| 225 | Ga0373927_0042424 | 3300035695 | Bacteria | 2947 |
| 226 | Ga0373933_0007385 | 3300035724 | Bacteria | 5993 |
| 227 | Ga0373933_0039872 | 3300035724 | Bacteria | 2764 |
| 228 | Ga0373947_0010510 | 3300035725 | Bacteria | 5309 |
| 229 | Ga0373947_0039996 | 3300035725 | Bacteria | 2792 |
| 230 | Ga0373947_0134710 | 3300035725 | Bacteria | 1580 |
| 231 | Ga0373937_0000070 | 3300036401 | Bacteria | 92587 |
| 232 | Ga0373937_0016518 | 3300036401 | Bacteria | 6558 |
| 233 | Ga0373937_0027827 | 3300036401 | Bacteria | 5114 |
| 234 | Ga0373937_0083868 | 3300036401 | Bacteria | 2948 |
| 235 | Ga0373937_0133075 | 3300036401 | Bacteria | 2324 |
| 236 | Ga0373925_0000012 | 3300037068 | Bacteria | 202139 |
| 237 | Ga0373925_0013371 | 3300037068 | Bacteria | 5939 |
| 238 | Ga0373925_0029922 | 3300037068 | Bacteria | 3994 |
| 239 | Ga0373925_0035319 | 3300037068 | Bacteria | 3687 |
| 240 | Ga0395899_0026446 | 3300037312 | Bacteria | 4379 |
| 241 | Ga0395900_0008884 | 3300037418 | Bacteria | 10317 |
| 242 | Ga0395898_0018570 | 3300037466 | Bacteria | 7089 |
| 243 | Ga0395898_0056296 | 3300037466 | Bacteria | 3833 |
| 244 | Ga0395901_0105519 | 3300038443 | Bacteria | 2957 |
| 245 | Ga0395901_0301888 | 3300038443 | Unclassified | 1660 |
| 246 | Ga0439453_0000460 | 3300041408 | Bacteria | 4434 |
| 247 | Ga0439443_002616 | 3300042003 | Bacteria | 2172 |
| 248 | Ga0466963_0251471 | 3300044694 | Bacteria | 1240 |
| 249 | Ga0466964_0025036 | 3300044706 | Bacteria | 2329 |
| 250 | Ga0466971_0043587 | 3300044719 | Bacteria | 2016 |
| 251 | Ga0466971_0068294 | 3300044719 | Bacteria | 1612 |
| 252 | Ga0466957_0020040 | 3300044842 | Bacteria | 3936 |
| 253 | Ga0466957_0095771 | 3300044842 | Bacteria | 1865 |
| 254 | Ga0466959_0037142 | 3300045049 | Bacteria | 3599 |
| 255 | Ga0466958_0019617 | 3300045836 | Bacteria | 3936 |
| 256 | Ga0495592_0000033 | 3300046454 | Bacteria | 127028 |
| 257 | Ga0495629_0014698 | 3300046459 | Bacteria | 5631 |
| 258 | Ga0495629_0057332 | 3300046459 | Bacteria | 2724 |
| 259 | Ga0495638_0013050 | 3300046460 | Bacteria | 5672 |
| 260 | Ga0495638_0085523 | 3300046460 | Bacteria | 1907 |
| 261 | Ga0495641_0009498 | 3300046461 | Bacteria | 5772 |
| 262 | Ga0495651_0002741 | 3300046462 | Bacteria | 13660 |
| 263 | Ga0495651_0014668 | 3300046462 | Bacteria | 6060 |
| 264 | Ga0495651_0061359 | 3300046462 | Bacteria | 2878 |
| 265 | Ga0495651_0094368 | 3300046462 | Bacteria | 2239 |
| 266 | Ga0495653_0000019 | 3300046463 | Bacteria | 178799 |
| 267 | Ga0495582_0020945 | 3300046473 | Bacteria | 3580 |
| 268 | Ga0495662_0018598 | 3300046476 | Bacteria | 3363 |
| 269 | Ga0495664_0000005 | 3300046477 | Bacteria | 439635 |
| 270 | Ga0495594_0043309 | 3300046499 | Bacteria | 2467 |
| 271 | Ga0495608_0000003 | 3300046511 | Bacteria | 369831 |
| 272 | Ga0495608_0034846 | 3300046511 | Bacteria | 3398 |
| 273 | Ga0495618_0000009 | 3300046514 | Bacteria | 200423 |
| 274 | Ga0495618_0038850 | 3300046514 | Bacteria | 2992 |
| 275 | Ga0495628_0000010 | 3300046516 | Bacteria | 234932 |
| 276 | Ga0495628_0061379 | 3300046516 | Bacteria | 2948 |
| 277 | Ga0495628_0213473 | 3300046516 | Bacteria | 1451 |
| 278 | Ga0495630_0044765 | 3300046517 | Bacteria | 3307 |
| 279 | Ga0495630_0176901 | 3300046517 | Bacteria | 1626 |
| 280 | Ga0495630_0194284 | 3300046517 | Bacteria | 1548 |
| 281 | Ga0495630_0398677 | 3300046517 | Bacteria | 1054 |
| 282 | Ga0495637_0042729 | 3300046520 | Bacteria | 1938 |
| 283 | Ga0495666_0049014 | 3300046526 | Bacteria | 2032 |
| 284 | Ga0495666_0061278 | 3300046526 | Bacteria | 1798 |
| 285 | Ga0495652_0000016 | 3300046529 | Bacteria | 212723 |
| 286 | Ga0495665_0022760 | 3300046531 | Bacteria | 3366 |
| 287 | Ga0495640_0000015 | 3300046533 | Bacteria | 160055 |
| 288 | Ga0495640_0037168 | 3300046533 | Bacteria | 3437 |
| 289 | Ga0495640_0108322 | 3300046533 | Bacteria | 1817 |
| 290 | Ga0495587_0000009 | 3300046536 | Bacteria | 241480 |
| 291 | Ga0495587_0145965 | 3300046536 | Bacteria | 1349 |
| 292 | Ga0495645_0000005 | 3300046543 | Bacteria | 443917 |
| 293 | Ga0495667_0000073 | 3300046559 | Bacteria | 74946 |
| 294 | Ga0495668_0063892 | 3300046616 | Bacteria | 2027 |
| 295 | Ga0495634_0000170 | 3300046642 | Bacteria | 60197 |
| 296 | Ga0495634_0080642 | 3300046642 | Bacteria | 2129 |
| 297 | Ga0495635_0000013 | 3300046663 | Bacteria | 221753 |
| 298 | Ga0495588_0025428 | 3300046674 | Bacteria | 2949 |
| 299 | Ga0495657_0000066 | 3300046675 | Bacteria | 93382 |
| 300 | Ga0495657_0024928 | 3300046675 | Bacteria | 4251 |
| 301 | Ga0495657_0102765 | 3300046675 | Bacteria | 1819 |
| 302 | Ga0495599_0000011 | 3300046678 | Bacteria | 207639 |
| 303 | Ga0495599_0074515 | 3300046678 | Bacteria | 2119 |
| 304 | Ga0495623_0000005 | 3300046679 | Bacteria | 140586 |
| 305 | Ga0495646_0000011 | 3300046680 | Bacteria | 195220 |
| 306 | Ga0495647_0018643 | 3300046681 | Bacteria | 2473 |
| 307 | Ga0495647_0075590 | 3300046681 | Bacteria | 1356 |
| 308 | Ga0495658_0018827 | 3300046683 | Bacteria | 3596 |
| 309 | Ga0495658_0052964 | 3300046683 | Bacteria | 2303 |
| 310 | Ga0495613_0024648 | 3300046689 | Bacteria | 4483 |
| 311 | Ga0495624_0014482 | 3300046690 | Bacteria | 5351 |
| 312 | Ga0495624_0042226 | 3300046690 | Bacteria | 2914 |
| 313 | Ga0495600_0000004 | 3300046809 | Bacteria | 180417 |
| 314 | Ga0495600_0113629 | 3300046809 | Bacteria | 1763 |
| 315 | Ga0495581_0063952 | 3300047315 | Bacteria | 2125 |
| 316 | Ga0495604_0000006 | 3300047317 | Bacteria | 420480 |
| 317 | Ga0495604_0078484 | 3300047317 | Bacteria | 2478 |
| 318 | Ga0495674_0000005 | 3300047319 | Bacteria | 375129 |
| 319 | Ga0495674_0079076 | 3300047319 | Bacteria | 2824 |
| 320 | Ga0495676_0058221 | 3300047321 | Bacteria | 3041 |
| 321 | Ga0495680_0000141 | 3300047322 | Bacteria | 72373 |
| 322 | Ga0495675_0000070 | 3300047444 | Bacteria | 71129 |
| 323 | Ga0495684_0000001 | 3300047471 | Bacteria | 369809 |
| 324 | Ga0495684_0003897 | 3300047471 | Bacteria | 11626 |
| 325 | Ga0495593_0002024 | 3300047673 | Bacteria | 12088 |
| 326 | Ga0495593_0028002 | 3300047673 | Bacteria | 3098 |
| 327 | Ga0495593_0076303 | 3300047673 | Bacteria | 1737 |
| 328 | Ga0495602_0000003 | 3300048088 | Bacteria | 357240 |
| 329 | Ga0495602_0044759 | 3300048088 | Bacteria | 4011 |
| 330 | Ga0495602_0140282 | 3300048088 | Bacteria | 1914 |
| 331 | Ga0496101_0036496 | 3300048904 | Bacteria | 3482 |
| 332 | Ga0496104_0068777 | 3300048907 | Bacteria | 3365 |
| 333 | Ga0496104_0277904 | 3300048907 | Bacteria | 1587 |
| 334 | Ga0496104_0484734 | 3300048907 | Bacteria | 1148 |
| 335 | Ga0496105_0016094 | 3300048908 | Bacteria | 5965 |
| 336 | Ga0496106_0043991 | 3300048909 | Bacteria | 3352 |
| 337 | Ga0496106_0161382 | 3300048909 | Unclassified | 1773 |
| 338 | Ga0496107_0000784 | 3300048910 | Bacteria | 18363 |
| 339 | Ga0496108_0005770 | 3300048911 | Bacteria | 10030 |
| 340 | Ga0496108_0058247 | 3300048911 | Bacteria | 3246 |
| 341 | Ga0496108_0152827 | 3300048911 | Bacteria | 1992 |
| 342 | Ga0496109_0002750 | 3300048912 | Bacteria | 14751 |
| 343 | Ga0496109_0008901 | 3300048912 | Bacteria | 8553 |
| 344 | Ga0496109_0031355 | 3300048912 | Bacteria | 4770 |
| 345 | Ga0496109_0098316 | 3300048912 | Bacteria | 2713 |
| 346 | Ga0496109_0111157 | 3300048912 | Bacteria | 2548 |
| 347 | Ga0496110_0061426 | 3300048913 | Bacteria | 3316 |
| 348 | Ga0496110_0063482 | 3300048913 | Bacteria | 3264 |
| 349 | Ga0496110_0077956 | 3300048913 | Bacteria | 2949 |
| 350 | Ga0496110_0088090 | 3300048913 | Bacteria | 2772 |
| 351 | Ga0496110_0095111 | 3300048913 | Bacteria | 2668 |
| 352 | Ga0496111_0140226 | 3300048914 | Bacteria | 1791 |
| 353 | Ga0496111_0148523 | 3300048914 | Bacteria | 1738 |
| 354 | Ga0496112_0008195 | 3300048915 | Bacteria | 9343 |
| 355 | Ga0496112_0017462 | 3300048915 | Bacteria | 6741 |
| 356 | Ga0496112_0037338 | 3300048915 | Bacteria | 4742 |
| 357 | Ga0496112_0051740 | 3300048915 | Bacteria | 4029 |
| 358 | Ga0496114_0097827 | 3300048917 | Bacteria | 2501 |
| 359 | Ga0496114_0127865 | 3300048917 | Bacteria | 2192 |
| 360 | Ga0496114_0303216 | 3300048917 | Bacteria | 1410 |
| 361 | Ga0496115_0012076 | 3300048918 | Bacteria | 6495 |
| 362 | Ga0496115_0031539 | 3300048918 | Bacteria | 4177 |
| 363 | Ga0496115_0068538 | 3300048918 | Bacteria | 2873 |
| 364 | Ga0496126_0005282 | 3300048929 | Bacteria | 14826 |
| 365 | Ga0496126_0020578 | 3300048929 | Bacteria | 6461 |
| 366 | Ga0501034_0055043 | 3300049571 | Bacteria | 4004 |
| 367 | Ga0501034_0235818 | 3300049571 | Bacteria | 1777 |
| 368 | Ga0501046_0147674 | 3300049580 | Bacteria | 1775 |
| 369 | Ga0501047_0043667 | 3300049581 | Bacteria | 4330 |
| 370 | Ga0501070_0146837 | 3300049586 | Bacteria | 1946 |
| 371 | Ga0501072_0004457 | 3300049588 | Bacteria | 10639 |
| 372 | Ga0501074_0111034 | 3300049590 | Bacteria | 1962 |
| 373 | Ga0501075_0013209 | 3300049591 | Bacteria | 5890 |
| 374 | Ga0501077_0001847 | 3300049593 | Bacteria | 12803 |
| 375 | Ga0501079_0048095 | 3300049741 | Bacteria | 3291 |
| 376 | Ga0501080_0032811 | 3300049742 | Bacteria | 4844 |
| 377 | Ga0501081_0092415 | 3300049743 | Bacteria | 2129 |
| 378 | Ga0501083_0062484 | 3300049744 | Bacteria | 2485 |
| 379 | Ga0501035_0236911 | 3300049822 | Bacteria | 1554 |
| 380 | nmdc:mga03n38_13560_c1 | 3300050490 | Bacteria | 3100 |
| 381 | nmdc:mga0yw44_15757_c1 | 3300050492 | Bacteria | 4061 |
| 382 | nmdc:mga0k408_9989_c1 | 3300050493 | Bacteria | 5125 |
| 383 | nmdc:mga05p37_29702_c1 | 3300050507 | Bacteria | 6670 |
| 384 | nmdc:mga05p37_30491_c1 | 3300050507 | Bacteria | 6580 |
| 385 | nmdc:mga0qj67_269992_c1 | 3300050509 | Bacteria | 1379 |
| 386 | nmdc:mga06r32_11442_c1 | 3300050510 | Bacteria | 7991 |
| 387 | nmdc:mga0n895_35065_c1 | 3300050512 | Bacteria | 4835 |
| 388 | nmdc:mga0rr50_39405_c1 | 3300050513 | Bacteria | 3427 |
| 389 | nmdc:mga08x19_23_c1 | 3300050514 | Bacteria | 288286 |
| 390 | Ga0495601_0000005 | 3300053077 | Bacteria | 387079 |
| 391 | Ga0495601_0002836 | 3300053077 | Bacteria | 9837 |
| 392 | Ga0495601_0027385 | 3300053077 | Bacteria | 3524 |
| 393 | Ga0495612_0000001 | 3300053078 | Bacteria | 418244 |
| 394 | Ga0495595_0000030 | 3300053084 | Bacteria | 89992 |
| 395 | Ga0495595_0002509 | 3300053084 | Bacteria | 7194 |
| 396 | Ga0495619_0000007 | 3300053085 | Bacteria | 369936 |
| 397 | Ga0495619_0024429 | 3300053085 | Bacteria | 3876 |
| 398 | Ga0500566_0023613 | 3300053094 | Bacteria | 3611 |
| 399 | Ga0500562_000552 | 3300053108 | Bacteria | 9027 |
| 400 | Ga0500622_0000073 | 3300053156 | Bacteria | 111045 |
| 401 | Ga0501084_0006046 | 3300054114 | Bacteria | 9953 |
| 402 | Ga0501084_0075119 | 3300054114 | Bacteria | 2831 |
| 403 | Ga0501082_0015022 | 3300060353 | Bacteria | 6673 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046517 | Ga0495630_0398677 | Ga0495630_0398677_17_1039 | 340 |
| 2 | 3300047471 | Ga0495684_0003897 | Ga0495684_0003897_19_1056 | 345 |
| 3 | 3300048907 | Ga0496104_0484734 | Ga0496104_0484734_12_1109 | 355 |
| 4 | 3300005545 | Ga0070695_100121857 | Ga0070695_1001218572 | 365 |
| 5 | 3300005546 | Ga0070696_100012023 | Ga0070696_1000120232 | 365 |
| 6 | 3300005549 | Ga0070704_100008566 | Ga0070704_1000085662 | 365 |
| 7 | 3300009553 | Ga0105249_10014660 | Ga0105249_100146603 | 365 |
| 8 | 3300025961 | Ga0207712_10017842 | Ga0207712_100178422 | 365 |
| 9 | 3300049593 | Ga0501077_0001847 | Ga0501077_0001847_65_1210 | 365 |
| 10 | 3300049743 | Ga0501081_0092415 | Ga0501081_0092415_966_2111 | 365 |
| 11 | 3300035117 | Ga0373953_0085448 | Ga0373953_0085448_65_1213 | 368 |
| 12 | 3300035692 | Ga0373935_0206216 | Ga0373935_0206216_198_1346 | 368 |
| 13 | 3300046531 | Ga0495665_0022760 | Ga0495665_0022760_65_1213 | 368 |
| 14 | 3300006847 | Ga0075431_100077544 | Ga0075431_1000775442 | 371 |
| 15 | 3300047673 | Ga0495593_0076303 | Ga0495593_0076303_333_1538 | 371 |
| 16 | 3300050507 | nmdc:mga05p37_30491_c1 | nmdc:mga05p37_30491_c1_2812_3975 | 371 |
| 17 | 3300050509 | nmdc:mga0qj67_269992_c1 | nmdc:mga0qj67_269992_c1_205_1368 | 371 |
| 18 | 3300050510 | nmdc:mga06r32_11442_c1 | nmdc:mga06r32_11442_c1_4944_6107 | 371 |
| 19 | 3300028666 | Ga0265336_10034716 | Ga0265336_100347162 | 372 |
| 20 | 3300028800 | Ga0265338_10069727 | Ga0265338_100697272 | 372 |
| 21 | 3300031235 | Ga0265330_10016592 | Ga0265330_100165922 | 372 |
| 22 | 3300031241 | Ga0265325_10102961 | Ga0265325_101029612 | 372 |
| 23 | 3300031247 | Ga0265340_10064710 | Ga0265340_100647102 | 372 |
| 24 | 3300031712 | Ga0265342_10029058 | Ga0265342_100290582 | 372 |
| 25 | 3300048918 | Ga0496115_0031539 | Ga0496115_0031539_2808_3929 | 373 |
| 26 | 3300046683 | Ga0495658_0052964 | Ga0495658_0052964_737_1912 | 377 |
| 27 | 3300037466 | Ga0395898_0056296 | Ga0395898_0056296_1339_2547 | 378 |
| 28 | 3300031247 | Ga0265340_10065777 | Ga0265340_100657772 | 382 |
| 29 | 3300035083 | Ga0373926_0064725 | Ga0373926_0064725_167_1315 | 382 |
| 30 | 3300037312 | Ga0395899_0026446 | Ga0395899_0026446_445_1653 | 382 |
| 31 | 3300037418 | Ga0395900_0008884 | Ga0395900_0008884_4909_6117 | 382 |
| 32 | 3300037466 | Ga0395898_0018570 | Ga0395898_0018570_4333_5541 | 382 |
| 33 | 3300038443 | Ga0395901_0105519 | Ga0395901_0105519_660_1868 | 382 |
| 34 | 3300005536 | Ga0070697_100007834 | Ga0070697_1000078343 | 383 |
| 35 | 3300007076 | Ga0075435_100060126 | Ga0075435_1000601262 | 383 |
| 36 | 3300025939 | Ga0207665_10113035 | Ga0207665_101130352 | 383 |
| 37 | 3300050514 | nmdc:mga08x19_23_c1 | nmdc:mga08x19_23_c1_243408_244559 | 383 |
| 38 | 3300005444 | Ga0070694_100141393 | Ga0070694_1001413932 | 385 |
| 39 | 3300005546 | Ga0070696_100272961 | Ga0070696_1002729611 | 385 |
| 40 | 3300048929 | Ga0496126_0020578 | Ga0496126_0020578_3317_4474 | 385 |
| 41 | 3300025921 | Ga0207652_10245615 | Ga0207652_102456151 | 387 |
| 42 | 3300046462 | Ga0495651_0094368 | Ga0495651_0094368_497_1729 | 387 |
| 43 | 3300046514 | Ga0495618_0038850 | Ga0495618_0038850_1121_2353 | 387 |
| 44 | 3300046516 | Ga0495628_0213473 | Ga0495628_0213473_138_1370 | 387 |
| 45 | 3300046536 | Ga0495587_0145965 | Ga0495587_0145965_51_1283 | 387 |
| 46 | 3300053077 | Ga0495601_0027385 | Ga0495601_0027385_28_1260 | 387 |
| 47 | 3300005340 | Ga0070689_100112390 | Ga0070689_1001123902 | 388 |
| 48 | 3300011119 | Ga0105246_10049426 | Ga0105246_100494263 | 388 |
| 49 | 3300013306 | Ga0163162_10280009 | Ga0163162_102800091 | 388 |
| 50 | 3300048907 | Ga0496104_0068777 | Ga0496104_0068777_1069_2316 | 388 |
| 51 | 3300048912 | Ga0496109_0031355 | Ga0496109_0031355_3087_4334 | 388 |
| 52 | 3300048913 | Ga0496110_0061426 | Ga0496110_0061426_212_1459 | 388 |
| 53 | 3300048915 | Ga0496112_0037338 | Ga0496112_0037338_2224_3471 | 388 |
| 54 | 3300053108 | Ga0500562_000552 | Ga0500562_000552_2726_3937 | 389 |
| 55 | 3300053156 | Ga0500622_0000073 | Ga0500622_0000073_67705_68916 | 389 |
| 56 | 3300005937 | Ga0081455_10134884 | Ga0081455_101348842 | 390 |
| 57 | iso_pu_bacteria | 2824704595 | 2824713963 | 390 |
| 58 | iso_pu_bacteria | 2824753945 | 2824763520 | 390 |
| 59 | iso_pu_bacteria | 2824763712 | 2824766076 | 390 |
| 60 | iso_pu_bacteria | 2904711408 | 2904718572 | 390 |
| 61 | 3300005327 | Ga0070658_10045199 | Ga0070658_100451993 | 391 |
| 62 | 3300005327 | Ga0070658_10105821 | Ga0070658_101058213 | 391 |
| 63 | 3300005327 | Ga0070658_10205460 | Ga0070658_102054601 | 391 |
| 64 | 3300005336 | Ga0070680_100005151 | Ga0070680_1000051514 | 391 |
| 65 | 3300005336 | Ga0070680_100017684 | Ga0070680_1000176845 | 391 |
| 66 | 3300005337 | Ga0070682_100001226 | Ga0070682_1000012269 | 391 |
| 67 | 3300005339 | Ga0070660_100015394 | Ga0070660_1000153944 | 391 |
| 68 | 3300005458 | Ga0070681_10009623 | Ga0070681_100096238 | 391 |
| 69 | 3300005458 | Ga0070681_10100918 | Ga0070681_101009182 | 391 |
| 70 | 3300005530 | Ga0070679_100163260 | Ga0070679_1001632602 | 391 |
| 71 | 3300005539 | Ga0068853_100002253 | Ga0068853_1000022536 | 391 |
| 72 | 3300005563 | Ga0068855_100082683 | Ga0068855_1000826832 | 391 |
| 73 | 3300005577 | Ga0068857_100013736 | Ga0068857_1000137368 | 391 |
| 74 | 3300009093 | Ga0105240_10041160 | Ga0105240_100411604 | 391 |
| 75 | 3300009545 | Ga0105237_10322493 | Ga0105237_103224932 | 391 |
| 76 | 3300013100 | Ga0157373_10008606 | Ga0157373_100086065 | 391 |
| 77 | 3300013104 | Ga0157370_10051882 | Ga0157370_100518822 | 391 |
| 78 | 3300025912 | Ga0207707_10021258 | Ga0207707_100212582 | 391 |
| 79 | 3300025912 | Ga0207707_10098655 | Ga0207707_100986553 | 391 |
| 80 | 3300025919 | Ga0207657_10028909 | Ga0207657_100289094 | 391 |
| 81 | 3300025919 | Ga0207657_10084515 | Ga0207657_100845152 | 391 |
| 82 | 3300025919 | Ga0207657_10152086 | Ga0207657_101520861 | 391 |
| 83 | 3300025921 | Ga0207652_10011743 | Ga0207652_100117435 | 391 |
| 84 | 3300025949 | Ga0207667_10196048 | Ga0207667_101960482 | 391 |
| 85 | 3300026041 | Ga0207639_10004947 | Ga0207639_100049472 | 391 |
| 86 | 3300031595 | Ga0265313_10030192 | Ga0265313_100301922 | 391 |
| 87 | 3300031711 | Ga0265314_10094220 | Ga0265314_100942202 | 391 |
| 88 | 3300031712 | Ga0265342_10001581 | Ga0265342_1000158118 | 391 |
| 89 | 3300048908 | Ga0496105_0016094 | Ga0496105_0016094_4014_5222 | 391 |
| 90 | 3300048911 | Ga0496108_0058247 | Ga0496108_0058247_1758_2966 | 391 |
| 91 | 3300048912 | Ga0496109_0002750 | Ga0496109_0002750_7893_9101 | 391 |
| 92 | 3300048913 | Ga0496110_0088090 | Ga0496110_0088090_436_1644 | 391 |
| 93 | 3300048914 | Ga0496111_0140226 | Ga0496111_0140226_125_1333 | 391 |
| 94 | 3300048915 | Ga0496112_0017462 | Ga0496112_0017462_2661_3869 | 391 |
| 95 | iso_pu_bacteria | 2643221547 | 2643755484 | 391 |
| 96 | 3300009174 | Ga0105241_10162773 | Ga0105241_101627732 | 392 |
| 97 | 3300009551 | Ga0105238_10108852 | Ga0105238_101088522 | 392 |
| 98 | 3300009551 | Ga0105238_10209103 | Ga0105238_102091031 | 392 |
| 99 | 3300025911 | Ga0207654_10093240 | Ga0207654_100932402 | 392 |
| 100 | 3300025912 | Ga0207707_10000315 | Ga0207707_1000031531 | 392 |
| 101 | 3300025917 | Ga0207660_10041005 | Ga0207660_100410053 | 392 |
| 102 | 3300025921 | Ga0207652_10047676 | Ga0207652_100476761 | 392 |
| 103 | 3300025921 | Ga0207652_10135775 | Ga0207652_101357752 | 392 |
| 104 | 3300025924 | Ga0207694_10051091 | Ga0207694_100510913 | 392 |
| 105 | 3300025924 | Ga0207694_10092713 | Ga0207694_100927132 | 392 |
| 106 | 3300044694 | Ga0466963_0251471 | Ga0466963_0251471_20_1219 | 392 |
| 107 | 3300044706 | Ga0466964_0025036 | Ga0466964_0025036_228_1427 | 392 |
| 108 | 3300044719 | Ga0466971_0043587 | Ga0466971_0043587_600_1991 | 392 |
| 109 | 3300044842 | Ga0466957_0020040 | Ga0466957_0020040_1082_2281 | 392 |
| 110 | 3300045049 | Ga0466959_0037142 | Ga0466959_0037142_443_1642 | 392 |
| 111 | 3300045836 | Ga0466958_0019617 | Ga0466958_0019617_37_1236 | 392 |
| 112 | 3300048910 | Ga0496107_0000784 | Ga0496107_0000784_8872_10089 | 392 |
| 113 | 3300048911 | Ga0496108_0005770 | Ga0496108_0005770_6170_7387 | 392 |
| 114 | 3300048912 | Ga0496109_0008901 | Ga0496109_0008901_3719_4936 | 392 |
| 115 | 3300048913 | Ga0496110_0077956 | Ga0496110_0077956_166_1383 | 392 |
| 116 | 3300048913 | Ga0496110_0095111 | Ga0496110_0095111_151_1398 | 392 |
| 117 | 3300048915 | Ga0496112_0008195 | Ga0496112_0008195_4180_5397 | 392 |
| 118 | 3300048918 | Ga0496115_0068538 | Ga0496115_0068538_188_1405 | 392 |
| 119 | 3300035691 | Ga0373931_0049271 | Ga0373931_0049271_663_1922 | 393 |
| 120 | 3300048909 | Ga0496106_0043991 | Ga0496106_0043991_2001_3248 | 393 |
| 121 | 3300048918 | Ga0496115_0012076 | Ga0496115_0012076_2885_4132 | 393 |
| 122 | 3300005329 | Ga0070683_100002377 | Ga0070683_10000237715 | 394 |
| 123 | 3300005330 | Ga0070690_100158158 | Ga0070690_1001581582 | 394 |
| 124 | 3300005336 | Ga0070680_100015209 | Ga0070680_1000152097 | 394 |
| 125 | 3300005458 | Ga0070681_10107512 | Ga0070681_101075123 | 394 |
| 126 | 3300005530 | Ga0070679_100005313 | Ga0070679_10000531317 | 394 |
| 127 | 3300005535 | Ga0070684_100002193 | Ga0070684_10000219317 | 394 |
| 128 | 3300005547 | Ga0070693_100090048 | Ga0070693_1000900481 | 394 |
| 129 | 3300006195 | Ga0075366_10004889 | Ga0075366_100048897 | 394 |
| 130 | 3300007076 | Ga0075435_100186729 | Ga0075435_1001867292 | 394 |
| 131 | 3300013105 | Ga0157369_10009818 | Ga0157369_100098185 | 394 |
| 132 | 3300013307 | Ga0157372_10123683 | Ga0157372_101236833 | 394 |
| 133 | 3300025912 | Ga0207707_10018340 | Ga0207707_100183405 | 394 |
| 134 | 3300025944 | Ga0207661_10004979 | Ga0207661_100049797 | 394 |
| 135 | 3300026116 | Ga0207674_10235643 | Ga0207674_102356432 | 394 |
| 136 | 3300035111 | Ga0373923_0001362 | Ga0373923_0001362_4011_5237 | 394 |
| 137 | 3300035113 | Ga0373936_0002022 | Ga0373936_0002022_388_1614 | 394 |
| 138 | 3300035116 | Ga0373945_0007516 | Ga0373945_0007516_46_1272 | 394 |
| 139 | 3300035170 | Ga0373943_0067772 | Ga0373943_0067772_431_1657 | 394 |
| 140 | 3300035171 | Ga0373946_0068874 | Ga0373946_0068874_196_1422 | 394 |
| 141 | 3300035172 | Ga0373955_0005630 | Ga0373955_0005630_977_2203 | 394 |
| 142 | 3300035725 | Ga0373947_0010510 | Ga0373947_0010510_1078_2304 | 394 |
| 143 | 3300036401 | Ga0373937_0027827 | Ga0373937_0027827_733_1959 | 394 |
| 144 | 3300046459 | Ga0495629_0057332 | Ga0495629_0057332_96_1322 | 394 |
| 145 | 3300046516 | Ga0495628_0061379 | Ga0495628_0061379_1424_2650 | 394 |
| 146 | 3300046517 | Ga0495630_0176901 | Ga0495630_0176901_310_1536 | 394 |
| 147 | 3300046533 | Ga0495640_0108322 | Ga0495640_0108322_156_1382 | 394 |
| 148 | 3300046642 | Ga0495634_0080642 | Ga0495634_0080642_278_1504 | 394 |
| 149 | 3300046678 | Ga0495599_0074515 | Ga0495599_0074515_104_1330 | 394 |
| 150 | 3300046681 | Ga0495647_0075590 | Ga0495647_0075590_89_1315 | 394 |
| 151 | 3300046689 | Ga0495613_0024648 | Ga0495613_0024648_343_1569 | 394 |
| 152 | 3300047315 | Ga0495581_0063952 | Ga0495581_0063952_278_1504 | 394 |
| 153 | 3300047319 | Ga0495674_0079076 | Ga0495674_0079076_500_1726 | 394 |
| 154 | 3300047673 | Ga0495593_0028002 | Ga0495593_0028002_128_1354 | 394 |
| 155 | 3300050490 | nmdc:mga03n38_13560_c1 | nmdc:mga03n38_13560_c1_1513_2697 | 394 |
| 156 | 3300050513 | nmdc:mga0rr50_39405_c1 | nmdc:mga0rr50_39405_c1_1920_3122 | 394 |
| 157 | 3300009094 | Ga0111539_10478194 | Ga0111539_104781941 | 395 |
| 158 | 3300032133 | Ga0316583_10001297 | Ga0316583_100012974 | 395 |
| 159 | 3300031711 | Ga0265314_10005600 | Ga0265314_100056003 | 396 |
| 160 | 3300049571 | Ga0501034_0235818 | Ga0501034_0235818_255_1469 | 396 |
| 161 | 3300049744 | Ga0501083_0062484 | Ga0501083_0062484_1146_2390 | 396 |
| 162 | 3300049822 | Ga0501035_0236911 | Ga0501035_0236911_157_1371 | 396 |
| 163 | 3300048909 | Ga0496106_0161382 | Ga0496106_0161382_285_1532 | 397 |
| 164 | 3300005329 | Ga0070683_100011979 | Ga0070683_1000119791 | 398 |
| 165 | 3300005336 | Ga0070680_100052589 | Ga0070680_1000525893 | 398 |
| 166 | 3300005434 | Ga0070709_10001922 | Ga0070709_1000192211 | 398 |
| 167 | 3300005435 | Ga0070714_100016450 | Ga0070714_1000164504 | 398 |
| 168 | 3300005458 | Ga0070681_10093820 | Ga0070681_100938202 | 398 |
| 169 | 3300005547 | Ga0070693_100025386 | Ga0070693_1000253862 | 398 |
| 170 | 3300005563 | Ga0068855_100088337 | Ga0068855_1000883372 | 398 |
| 171 | 3300006175 | Ga0070712_100048383 | Ga0070712_1000483832 | 398 |
| 172 | 3300013100 | Ga0157373_10084237 | Ga0157373_100842372 | 398 |
| 173 | 3300013307 | Ga0157372_10067626 | Ga0157372_100676263 | 398 |
| 174 | 3300025906 | Ga0207699_10012419 | Ga0207699_100124193 | 398 |
| 175 | 3300025913 | Ga0207695_10108944 | Ga0207695_101089442 | 398 |
| 176 | 3300025915 | Ga0207693_10008545 | Ga0207693_100085458 | 398 |
| 177 | 3300025916 | Ga0207663_10115872 | Ga0207663_101158722 | 398 |
| 178 | 3300025929 | Ga0207664_10057844 | Ga0207664_100578442 | 398 |
| 179 | 3300025949 | Ga0207667_10130414 | Ga0207667_101304143 | 398 |
| 180 | 3300026078 | Ga0207702_10034420 | Ga0207702_100344203 | 398 |
| 181 | 3300031241 | Ga0265325_10027625 | Ga0265325_100276252 | 398 |
| 182 | 3300005937 | Ga0081455_10001183 | Ga0081455_1000118312 | 399 |
| 183 | 3300044719 | Ga0466971_0068294 | Ga0466971_0068294_380_1579 | 399 |
| 184 | 3300044842 | Ga0466957_0095771 | Ga0466957_0095771_439_1638 | 399 |
| 185 | 3300009147 | Ga0114129_10107219 | Ga0114129_101072192 | 400 |
| 186 | 3300028556 | Ga0265337_1003149 | Ga0265337_10031491 | 400 |
| 187 | 3300035086 | Ga0373934_0015869 | Ga0373934_0015869_1529_2731 | 400 |
| 188 | 3300035114 | Ga0373939_0000927 | Ga0373939_0000927_3059_4261 | 400 |
| 189 | 3300035117 | Ga0373953_0021415 | Ga0373953_0021415_195_1397 | 400 |
| 190 | 3300035120 | Ga0373957_0013516 | Ga0373957_0013516_858_2060 | 400 |
| 191 | 3300035172 | Ga0373955_0001156 | Ga0373955_0001156_9252_10454 | 400 |
| 192 | 3300035724 | Ga0373933_0039872 | Ga0373933_0039872_233_1435 | 400 |
| 193 | 3300036401 | Ga0373937_0083868 | Ga0373937_0083868_60_1262 | 400 |
| 194 | 3300036401 | Ga0373937_0133075 | Ga0373937_0133075_42_1244 | 400 |
| 195 | 3300046462 | Ga0495651_0061359 | Ga0495651_0061359_794_1996 | 400 |
| 196 | 3300046511 | Ga0495608_0034846 | Ga0495608_0034846_1487_2689 | 400 |
| 197 | 3300046675 | Ga0495657_0024928 | Ga0495657_0024928_2507_3709 | 400 |
| 198 | 3300046809 | Ga0495600_0113629 | Ga0495600_0113629_175_1377 | 400 |
| 199 | 3300047317 | Ga0495604_0078484 | Ga0495604_0078484_1038_2240 | 400 |
| 200 | 3300048088 | Ga0495602_0140282 | Ga0495602_0140282_620_1822 | 400 |
| 201 | 3300053077 | Ga0495601_0002836 | Ga0495601_0002836_6564_7766 | 400 |
| 202 | 3300053084 | Ga0495595_0002509 | Ga0495595_0002509_233_1435 | 400 |
| 203 | 3300053085 | Ga0495619_0024429 | Ga0495619_0024429_37_1239 | 400 |
| 204 | 3300005329 | Ga0070683_100037543 | Ga0070683_1000375431 | 401 |
| 205 | 3300025944 | Ga0207661_10014383 | Ga0207661_100143834 | 401 |
| 206 | 3300031238 | Ga0265332_10013548 | Ga0265332_100135482 | 401 |
| 207 | 3300031711 | Ga0265314_10004578 | Ga0265314_100045782 | 401 |
| 208 | 3300049571 | Ga0501034_0055043 | Ga0501034_0055043_546_1757 | 401 |
| 209 | 3300049586 | Ga0501070_0146837 | Ga0501070_0146837_107_1318 | 401 |
| 210 | 3300009093 | Ga0105240_10024396 | Ga0105240_100243964 | 402 |
| 211 | 3300009174 | Ga0105241_10001591 | Ga0105241_1000159111 | 402 |
| 212 | 3300009545 | Ga0105237_10044506 | Ga0105237_100445063 | 402 |
| 213 | 3300009551 | Ga0105238_10002564 | Ga0105238_100025645 | 402 |
| 214 | 3300010375 | Ga0105239_10004312 | Ga0105239_1000431215 | 402 |
| 215 | 3300049591 | Ga0501075_0013209 | Ga0501075_0013209_378_1637 | 402 |
| 216 | 3300049741 | Ga0501079_0048095 | Ga0501079_0048095_149_1411 | 402 |
| 217 | 3300054114 | Ga0501084_0006046 | Ga0501084_0006046_8569_9828 | 402 |
| 218 | 3300060353 | Ga0501082_0015022 | Ga0501082_0015022_5241_6503 | 402 |
| 219 | iso_pu_bacteria | 2935769743 | 2935776200 | 402 |
| 220 | iso_pu_bacteria | 2935785616 | 2935792106 | 402 |
| 221 | iso_pu_bacteria | 3005594810 | 3005597380 | 402 |
| 222 | 3300005262 | Ga0065165_1001991 | Ga0065165_100199112 | 403 |
| 223 | 3300005436 | Ga0070713_100027748 | Ga0070713_1000277486 | 403 |
| 224 | 3300006028 | Ga0070717_10014675 | Ga0070717_100146757 | 403 |
| 225 | 3300006173 | Ga0070716_100015393 | Ga0070716_1000153936 | 403 |
| 226 | 3300036401 | Ga0373937_0016518 | Ga0373937_0016518_870_2129 | 403 |
| 227 | 3300046460 | Ga0495638_0013050 | Ga0495638_0013050_3131_4348 | 403 |
| 228 | 3300046462 | Ga0495651_0014668 | Ga0495651_0014668_3365_4624 | 403 |
| 229 | 3300049580 | Ga0501046_0147674 | Ga0501046_0147674_104_1315 | 403 |
| 230 | 3300049581 | Ga0501047_0043667 | Ga0501047_0043667_2013_3224 | 403 |
| 231 | 3300049590 | Ga0501074_0111034 | Ga0501074_0111034_462_1673 | 403 |
| 232 | 3300049742 | Ga0501080_0032811 | Ga0501080_0032811_222_1433 | 403 |
| 233 | 3300009176 | Ga0105242_10119913 | Ga0105242_101199131 | 404 |
| 234 | 3300031711 | Ga0265314_10072539 | Ga0265314_100725393 | 404 |
| 235 | 3300046520 | Ga0495637_0042729 | Ga0495637_0042729_208_1437 | 404 |
| 236 | 3300046616 | Ga0495668_0063892 | Ga0495668_0063892_210_1439 | 404 |
| 237 | 3300048917 | Ga0496114_0127865 | Ga0496114_0127865_294_1511 | 404 |
| 238 | 3300048929 | Ga0496126_0005282 | Ga0496126_0005282_9070_10287 | 404 |
| 239 | 3300050492 | nmdc:mga0yw44_15757_c1 | nmdc:mga0yw44_15757_c1_2330_3559 | 404 |
| 240 | 3300003323 | rootH1_10171787 | rootH1_101717872 | 405 |
| 241 | 3300005458 | Ga0070681_10010680 | Ga0070681_100106804 | 405 |
| 242 | 3300005530 | Ga0070679_100140458 | Ga0070679_1001404584 | 405 |
| 243 | 3300038443 | Ga0395901_0301888 | Ga0395901_0301888_340_1569 | 405 |
| 244 | 3300048907 | Ga0496104_0277904 | Ga0496104_0277904_63_1310 | 405 |
| 245 | 3300048911 | Ga0496108_0152827 | Ga0496108_0152827_638_1885 | 405 |
| 246 | 3300048912 | Ga0496109_0098316 | Ga0496109_0098316_1020_2267 | 405 |
| 247 | 3300048915 | Ga0496112_0051740 | Ga0496112_0051740_234_1481 | 405 |
| 248 | 3300053094 | Ga0500566_0023613 | Ga0500566_0023613_2216_3439 | 405 |
| 249 | 3300046460 | Ga0495638_0085523 | Ga0495638_0085523_451_1671 | 406 |
| 250 | iso_pu_bacteria | 2935777560 | 2935784938 | 406 |
| 251 | iso_pu_bacteria | 2935793552 | 2935798053 | 406 |
| 252 | iso_pu_bacteria | 2941531003 | 2941537129 | 406 |
| 253 | iso_pu_bacteria | 8016622563 | 8016630719 | 406 |
| 254 | iso_pu_bacteria | 8019538911 | 8019542208 | 406 |
| 255 | iso_pu_bacteria | 8019547302 | 8019547416 | 406 |
| 256 | 3300035695 | Ga0373927_0042424 | Ga0373927_0042424_1613_2839 | 407 |
| 257 | 3300037068 | Ga0373925_0013371 | Ga0373925_0013371_2093_3319 | 407 |
| 258 | 3300048912 | Ga0496109_0111157 | Ga0496109_0111157_684_1937 | 407 |
| 259 | 3300048914 | Ga0496111_0148523 | Ga0496111_0148523_332_1585 | 407 |
| 260 | 3300048917 | Ga0496114_0097827 | Ga0496114_0097827_837_2090 | 407 |
| 261 | 3300005354 | Ga0070675_100005321 | Ga0070675_1000053217 | 408 |
| 262 | 3300005356 | Ga0070674_100009396 | Ga0070674_1000093963 | 408 |
| 263 | 3300005456 | Ga0070678_100076551 | Ga0070678_1000765512 | 408 |
| 264 | 3300005543 | Ga0070672_100025625 | Ga0070672_1000256252 | 408 |
| 265 | 3300005544 | Ga0070686_100162229 | Ga0070686_1001622292 | 408 |
| 266 | 3300025940 | Ga0207691_10031319 | Ga0207691_100313193 | 408 |
| 267 | 3300026121 | Ga0207683_10105231 | Ga0207683_101052312 | 408 |
| 268 | 3300035725 | Ga0373947_0134710 | Ga0373947_0134710_217_1443 | 408 |
| 269 | 3300005468 | Ga0070707_100110470 | Ga0070707_1001104702 | 409 |
| 270 | 3300005471 | Ga0070698_100062429 | Ga0070698_1000624293 | 409 |
| 271 | 3300005530 | Ga0070679_100063159 | Ga0070679_1000631593 | 409 |
| 272 | 3300005536 | Ga0070697_100015365 | Ga0070697_1000153657 | 409 |
| 273 | 3300005843 | Ga0068860_100236048 | Ga0068860_1002360482 | 409 |
| 274 | 3300005844 | Ga0068862_100289103 | Ga0068862_1002891032 | 409 |
| 275 | 3300006028 | Ga0070717_10012911 | Ga0070717_100129119 | 409 |
| 276 | 3300006038 | Ga0075365_10004633 | Ga0075365_100046335 | 409 |
| 277 | 3300006844 | Ga0075428_100229637 | Ga0075428_1002296372 | 409 |
| 278 | 3300009094 | Ga0111539_10143884 | Ga0111539_101438842 | 409 |
| 279 | 3300009551 | Ga0105238_10043840 | Ga0105238_100438403 | 409 |
| 280 | 3300025921 | Ga0207652_10316222 | Ga0207652_103162222 | 409 |
| 281 | 3300025922 | Ga0207646_10030668 | Ga0207646_100306685 | 409 |
| 282 | 3300025924 | Ga0207694_10044635 | Ga0207694_100446353 | 409 |
| 283 | 3300028381 | Ga0268264_10157992 | Ga0268264_101579922 | 409 |
| 284 | 3300041408 | Ga0439453_0000460 | Ga0439453_0000460_1872_3101 | 409 |
| 285 | 3300042003 | Ga0439443_002616 | Ga0439443_002616_145_1374 | 409 |
| 286 | 3300048913 | Ga0496110_0063482 | Ga0496110_0063482_1852_3102 | 409 |
| 287 | 3300050493 | nmdc:mga0k408_9989_c1 | nmdc:mga0k408_9989_c1_2981_4210 | 409 |
| 288 | 3300005471 | Ga0070698_100179795 | Ga0070698_1001797952 | 410 |
| 289 | 3300005471 | Ga0070698_100226141 | Ga0070698_1002261412 | 410 |
| 290 | 3300005547 | Ga0070693_100111432 | Ga0070693_1001114321 | 410 |
| 291 | 3300006028 | Ga0070717_10247901 | Ga0070717_102479012 | 410 |
| 292 | 3300006175 | Ga0070712_100041113 | Ga0070712_1000411132 | 410 |
| 293 | 3300025910 | Ga0207684_10167749 | Ga0207684_101677492 | 410 |
| 294 | 3300025922 | Ga0207646_10138211 | Ga0207646_101382112 | 410 |
| 295 | 3300031235 | Ga0265330_10018921 | Ga0265330_100189214 | 410 |
| 296 | 3300031240 | Ga0265320_10014147 | Ga0265320_100141474 | 410 |
| 297 | 3300031241 | Ga0265325_10008308 | Ga0265325_100083085 | 410 |
| 298 | 3300031242 | Ga0265329_10023908 | Ga0265329_100239082 | 410 |
| 299 | 3300031247 | Ga0265340_10039154 | Ga0265340_100391542 | 410 |
| 300 | 3300031595 | Ga0265313_10030189 | Ga0265313_100301894 | 410 |
| 301 | 3300031712 | Ga0265342_10004577 | Ga0265342_100045775 | 410 |
| 302 | 3300035692 | Ga0373935_0123257 | Ga0373935_0123257_129_1379 | 410 |
| 303 | 3300035695 | Ga0373927_0023671 | Ga0373927_0023671_814_2064 | 410 |
| 304 | 3300035725 | Ga0373947_0039996 | Ga0373947_0039996_865_2115 | 410 |
| 305 | 3300046526 | Ga0495666_0061278 | Ga0495666_0061278_14_1264 | 410 |
| 306 | 3300049588 | Ga0501072_0004457 | Ga0501072_0004457_4195_5427 | 410 |
| 307 | 3300003203 | JGI25406J46586_10007729 | JGI25406J46586_100077293 | 411 |
| 308 | 3300005436 | Ga0070713_100048268 | Ga0070713_1000482681 | 411 |
| 309 | 3300005455 | Ga0070663_100022775 | Ga0070663_1000227753 | 411 |
| 310 | 3300005539 | Ga0068853_100031984 | Ga0068853_1000319845 | 411 |
| 311 | 3300005539 | Ga0068853_100100635 | Ga0068853_1001006351 | 411 |
| 312 | 3300005563 | Ga0068855_100003579 | Ga0068855_1000035794 | 411 |
| 313 | 3300005563 | Ga0068855_100434054 | Ga0068855_1004340541 | 411 |
| 314 | 3300005577 | Ga0068857_100004018 | Ga0068857_1000040185 | 411 |
| 315 | 3300005577 | Ga0068857_100131926 | Ga0068857_1001319261 | 411 |
| 316 | 3300005578 | Ga0068854_100028602 | Ga0068854_1000286021 | 411 |
| 317 | 3300005614 | Ga0068856_100002518 | Ga0068856_10000251820 | 411 |
| 318 | 3300005614 | Ga0068856_100029866 | Ga0068856_1000298665 | 411 |
| 319 | 3300005616 | Ga0068852_100119190 | Ga0068852_1001191902 | 411 |
| 320 | 3300005834 | Ga0068851_10049508 | Ga0068851_100495081 | 411 |
| 321 | 3300005983 | Ga0081540_1002375 | Ga0081540_10023754 | 411 |
| 322 | 3300005985 | Ga0081539_10003358 | Ga0081539_100033587 | 411 |
| 323 | 3300006028 | Ga0070717_10027800 | Ga0070717_100278003 | 411 |
| 324 | 3300006163 | Ga0070715_10001361 | Ga0070715_100013613 | 411 |
| 325 | 3300009147 | Ga0114129_10008525 | Ga0114129_1000852515 | 411 |
| 326 | 3300014969 | Ga0157376_10101018 | Ga0157376_101010184 | 411 |
| 327 | 3300025321 | Ga0207656_10027319 | Ga0207656_100273192 | 411 |
| 328 | 3300025904 | Ga0207647_10000650 | Ga0207647_1000065018 | 411 |
| 329 | 3300025905 | Ga0207685_10001106 | Ga0207685_100011065 | 411 |
| 330 | 3300025906 | Ga0207699_10004541 | Ga0207699_100045416 | 411 |
| 331 | 3300025911 | Ga0207654_10000525 | Ga0207654_1000052521 | 411 |
| 332 | 3300025913 | Ga0207695_10001482 | Ga0207695_1000148214 | 411 |
| 333 | 3300025913 | Ga0207695_10068935 | Ga0207695_100689354 | 411 |
| 334 | 3300025924 | Ga0207694_10000952 | Ga0207694_1000095219 | 411 |
| 335 | 3300025924 | Ga0207694_10051176 | Ga0207694_100511762 | 411 |
| 336 | 3300025928 | Ga0207700_10237148 | Ga0207700_102371481 | 411 |
| 337 | 3300025939 | Ga0207665_10000206 | Ga0207665_1000020625 | 411 |
| 338 | 3300025949 | Ga0207667_10089356 | Ga0207667_100893562 | 411 |
| 339 | 3300026041 | Ga0207639_10031164 | Ga0207639_100311644 | 411 |
| 340 | 3300026067 | Ga0207678_10020879 | Ga0207678_100208796 | 411 |
| 341 | 3300026078 | Ga0207702_10000093 | Ga0207702_1000009398 | 411 |
| 342 | 3300026116 | Ga0207674_10007699 | Ga0207674_100076995 | 411 |
| 343 | 3300026142 | Ga0207698_10039781 | Ga0207698_100397814 | 411 |
| 344 | 3300031249 | Ga0265339_10107416 | Ga0265339_101074161 | 411 |
| 345 | 3300035083 | Ga0373926_0040593 | Ga0373926_0040593_233_1486 | 411 |
| 346 | 3300035089 | Ga0373944_0015560 | Ga0373944_0015560_238_1491 | 411 |
| 347 | 3300035111 | Ga0373923_0002723 | Ga0373923_0002723_3819_5060 | 411 |
| 348 | 3300035113 | Ga0373936_0001298 | Ga0373936_0001298_4427_5668 | 411 |
| 349 | 3300035116 | Ga0373945_0004349 | Ga0373945_0004349_3028_4269 | 411 |
| 350 | 3300035116 | Ga0373945_0010872 | Ga0373945_0010872_705_1958 | 411 |
| 351 | 3300035117 | Ga0373953_0001436 | Ga0373953_0001436_4868_6109 | 411 |
| 352 | 3300035118 | Ga0373954_0009580 | Ga0373954_0009580_201_1442 | 411 |
| 353 | 3300035120 | Ga0373957_0034394 | Ga0373957_0034394_456_1697 | 411 |
| 354 | 3300035171 | Ga0373946_0009974 | Ga0373946_0009974_1816_3069 | 411 |
| 355 | 3300035172 | Ga0373955_0002479 | Ga0373955_0002479_2095_3336 | 411 |
| 356 | 3300035410 | Ga0373924_0004253 | Ga0373924_0004253_3162_4403 | 411 |
| 357 | 3300035692 | Ga0373935_0004684 | Ga0373935_0004684_3989_5230 | 411 |
| 358 | 3300035692 | Ga0373935_0058857 | Ga0373935_0058857_357_1610 | 411 |
| 359 | 3300035695 | Ga0373927_0010704 | Ga0373927_0010704_1211_2452 | 411 |
| 360 | 3300035695 | Ga0373927_0028334 | Ga0373927_0028334_863_2116 | 411 |
| 361 | 3300035724 | Ga0373933_0007385 | Ga0373933_0007385_2692_3933 | 411 |
| 362 | 3300036401 | Ga0373937_0000070 | Ga0373937_0000070_17160_18401 | 411 |
| 363 | 3300037068 | Ga0373925_0000012 | Ga0373925_0000012_44809_46050 | 411 |
| 364 | 3300037068 | Ga0373925_0029922 | Ga0373925_0029922_2281_3534 | 411 |
| 365 | 3300037068 | Ga0373925_0035319 | Ga0373925_0035319_229_1482 | 411 |
| 366 | 3300046454 | Ga0495592_0000033 | Ga0495592_0000033_80716_81957 | 411 |
| 367 | 3300046459 | Ga0495629_0014698 | Ga0495629_0014698_606_1847 | 411 |
| 368 | 3300046461 | Ga0495641_0009498 | Ga0495641_0009498_3529_4782 | 411 |
| 369 | 3300046462 | Ga0495651_0002741 | Ga0495651_0002741_7216_8457 | 411 |
| 370 | 3300046463 | Ga0495653_0000019 | Ga0495653_0000019_14088_15329 | 411 |
| 371 | 3300046473 | Ga0495582_0020945 | Ga0495582_0020945_1775_3028 | 411 |
| 372 | 3300046476 | Ga0495662_0018598 | Ga0495662_0018598_507_1760 | 411 |
| 373 | 3300046477 | Ga0495664_0000005 | Ga0495664_0000005_380772_382013 | 411 |
| 374 | 3300046499 | Ga0495594_0043309 | Ga0495594_0043309_156_1469 | 411 |
| 375 | 3300046511 | Ga0495608_0000003 | Ga0495608_0000003_57565_58806 | 411 |
| 376 | 3300046514 | Ga0495618_0000009 | Ga0495618_0000009_141630_142871 | 411 |
| 377 | 3300046516 | Ga0495628_0000010 | Ga0495628_0000010_156722_157963 | 411 |
| 378 | 3300046517 | Ga0495630_0044765 | Ga0495630_0044765_989_2230 | 411 |
| 379 | 3300046517 | Ga0495630_0194284 | Ga0495630_0194284_237_1490 | 411 |
| 380 | 3300046526 | Ga0495666_0049014 | Ga0495666_0049014_690_2003 | 411 |
| 381 | 3300046529 | Ga0495652_0000016 | Ga0495652_0000016_153825_155066 | 411 |
| 382 | 3300046533 | Ga0495640_0000015 | Ga0495640_0000015_101171_102412 | 411 |
| 383 | 3300046533 | Ga0495640_0037168 | Ga0495640_0037168_1140_2453 | 411 |
| 384 | 3300046536 | Ga0495587_0000009 | Ga0495587_0000009_76982_78223 | 411 |
| 385 | 3300046543 | Ga0495645_0000005 | Ga0495645_0000005_380743_381984 | 411 |
| 386 | 3300046559 | Ga0495667_0000073 | Ga0495667_0000073_57647_58888 | 411 |
| 387 | 3300046642 | Ga0495634_0000170 | Ga0495634_0000170_1308_2549 | 411 |
| 388 | 3300046663 | Ga0495635_0000013 | Ga0495635_0000013_57618_58859 | 411 |
| 389 | 3300046674 | Ga0495588_0025428 | Ga0495588_0025428_806_2059 | 411 |
| 390 | 3300046675 | Ga0495657_0000066 | Ga0495657_0000066_78033_79274 | 411 |
| 391 | 3300046675 | Ga0495657_0102765 | Ga0495657_0102765_281_1534 | 411 |
| 392 | 3300046678 | Ga0495599_0000011 | Ga0495599_0000011_148826_150067 | 411 |
| 393 | 3300046679 | Ga0495623_0000005 | Ga0495623_0000005_85130_86371 | 411 |
| 394 | 3300046680 | Ga0495646_0000011 | Ga0495646_0000011_148721_149962 | 411 |
| 395 | 3300046681 | Ga0495647_0018643 | Ga0495647_0018643_910_2163 | 411 |
| 396 | 3300046683 | Ga0495658_0018827 | Ga0495658_0018827_2113_3366 | 411 |
| 397 | 3300046690 | Ga0495624_0014482 | Ga0495624_0014482_3522_4763 | 411 |
| 398 | 3300046690 | Ga0495624_0042226 | Ga0495624_0042226_703_1956 | 411 |
| 399 | 3300046809 | Ga0495600_0000004 | Ga0495600_0000004_57582_58823 | 411 |
| 400 | 3300047317 | Ga0495604_0000006 | Ga0495604_0000006_141645_142886 | 411 |
| 401 | 3300047319 | Ga0495674_0000005 | Ga0495674_0000005_62859_64100 | 411 |
| 402 | 3300047321 | Ga0495676_0058221 | Ga0495676_0058221_386_1639 | 411 |
| 403 | 3300047322 | Ga0495680_0000141 | Ga0495680_0000141_57495_58736 | 411 |
| 404 | 3300047444 | Ga0495675_0000070 | Ga0495675_0000070_12446_13687 | 411 |
| 405 | 3300047471 | Ga0495684_0000001 | Ga0495684_0000001_311006_312247 | 411 |
| 406 | 3300047673 | Ga0495593_0002024 | Ga0495593_0002024_6641_7882 | 411 |
| 407 | 3300048088 | Ga0495602_0000003 | Ga0495602_0000003_45102_46343 | 411 |
| 408 | 3300048088 | Ga0495602_0044759 | Ga0495602_0044759_514_1767 | 411 |
| 409 | 3300048904 | Ga0496101_0036496 | Ga0496101_0036496_1075_2322 | 411 |
| 410 | 3300048917 | Ga0496114_0303216 | Ga0496114_0303216_153_1394 | 411 |
| 411 | 3300050507 | nmdc:mga05p37_29702_c1 | nmdc:mga05p37_29702_c1_1291_2538 | 411 |
| 412 | 3300050512 | nmdc:mga0n895_35065_c1 | nmdc:mga0n895_35065_c1_1247_2506 | 411 |
| 413 | 3300053077 | Ga0495601_0000005 | Ga0495601_0000005_308910_310151 | 411 |
| 414 | 3300053078 | Ga0495612_0000001 | Ga0495612_0000001_105974_107215 | 411 |
| 415 | 3300053084 | Ga0495595_0000030 | Ga0495595_0000030_81747_82988 | 411 |
| 416 | 3300053085 | Ga0495619_0000007 | Ga0495619_0000007_311030_312271 | 411 |
| 417 | 3300054114 | Ga0501084_0075119 | Ga0501084_0075119_446_1684 | 411 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3ffq-assembly1.cif.gz_A | hcn2i 443-640 apo-state | 0.921 | 263 | 380 |
| 1q3e-assembly1.cif.gz_A | hcn2j 443-645 in the presence of cgmp | 0.9092 | 263 | 385 |
| 3etq-assembly1.cif.gz_B | x-ray structure of cysteine-free fragment of mhcn2 c-terminal region from amino acids 443-630 including c508n, c584s, and c601s mutations | 0.9085 | 263 | 385 |
| 3ffq-assembly2.cif.gz_B | hcn2i 443-640 apo-state | 0.9074 | 263 | 382 |
| 4ev0-assembly1.cif.gz_A | crystal structure of thermus thermophilus catabolite activator protein | 0.9073 | 268 | 390 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3behA02 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.9392 | 161 | 254 | 1.10.287.70 |
| 3behC02 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.9353 | 161 | 254 | 1.10.287.70 |
| af_D3ZZR6_410_519_1.10.287.70 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.9249 | 146 | 251 | 1.10.287.70 |
| af_Q8CFS6_411_520_1.10.287.70 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.9232 | 146 | 251 | 1.10.287.70 |
| af_J3K003_426_535_1.10.287.70 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.9231 | 146 | 254 | 1.10.287.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1Q3NPE7-F1-model_v4 | Cyclic nucleotide-binding protein | 0.9514 | 262 | 383 |
GO:0004622
GO:0016020 GO:0016042 GO:0046470 |
| AF-A0A812RIZ9-F1-model_v4 | Egl-4 protein | 0.9418 | 262 | 365 |
GO:0004674
GO:0005524 GO:0005829 GO:0046872 |
| AF-A0A536P6M3-F1-model_v4 | Cyclic nucleotide-binding domain-containing protein | 0.9378 | 263 | 392 |
GO:0004862
GO:0005829 GO:0005952 GO:0030552 GO:0034236 |
| AF-A0A6M1YJX6-F1-model_v4 | Cyclic nucleotide-binding domain-containing protein | 0.9378 | 263 | 383 |
|
| AF-A0A2V7UZQ1-F1-model_v4 | Crp/Fnr family transcriptional regulator | 0.9375 | 262 | 379 |
GO:0003677
GO:0003700 GO:0005829 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar