F438987

General Info

Members Datasets Scaffolds Average Seq Length
417 183 834 345

Family's Representative Sequence

Representative Sequence 3300005440|Ga0070705_100010884|Ga0070705_1000108844
Length 394
Sequence MGETMFPPRAPFFSSNRLACGEDLKRGNLLVPLFPLPRRRLRWVSMMKRIVVAGAGAAGASVAYQLSELGAEDVVLCDRGSVAGGATAKAMGGVRQQFSTAAEVRLAQASIRFFEELGSPFFDQVGYLFLATTEAGLAELEERAELQRSLGVRVVATAPSPGVRSDDVVGAVVCWQDGVADPPAVAGELVRRAAAGGVEVREGKDATKLAADVFVIAAGPWSAEVGRELGIELPIRPLCRQLLETEPIAGLPPELPMTVEAESGFHFRRRGDRLVLAMSDPEPRWGFDEVVDESVFGDRLERLVRRFPAAAGTRIDRAWAGLYDMTPDAHPILGRVGEGVYAACGFSGHGFMQSPAVGRAVAEEILDLEPTFDLSPYRLDRFERGAIFPEQLVL

Samples

Sample ID Description Type Environment
1 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
32 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
33 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
34 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
35 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
36 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
37 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
38 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
39 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
47 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
48 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
63 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
64 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
65 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
92 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
94 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
95 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
96 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
97 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
98 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
99 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
100 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
101 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
102 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
103 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
104 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
105 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
106 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
107 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
108 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
109 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
110 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
111 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
112 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
113 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
114 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
115 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
116 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
117 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
118 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
119 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
120 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
121 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
122 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
123 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
124 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
125 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
126 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
127 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
128 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
129 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
130 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
131 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
132 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
133 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
134 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
135 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
136 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
137 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
138 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
139 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
140 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
141 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
142 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
143 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
144 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
145 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
146 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
147 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
148 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
149 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
150 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
151 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
152 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
153 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
154 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
155 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
156 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
157 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
158 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
159 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
160 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
161 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
162 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
163 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
164 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
165 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
168 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
169 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
170 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
171 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
172 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
173 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
174 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
175 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
176 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
177 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
178 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
179 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
180 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
181 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
182 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
183 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.2
Nodule 0
Rhizoplane 15.11
Rhizosphere 82.97
Stem 0
Stem Tuber 0
Unclassified 11.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070705_100010884 3300005440 Bacteria 4568
2 Ga0070676_10064194 3300005328 Bacteria 2189
3 Ga0070682_100013575 3300005337 Bacteria 4690
4 Ga0068868_100027534 3300005338 Bacteria 4337
5 Ga0070691_10072759 3300005341 Bacteria 1670
6 Ga0070692_10112496 3300005345 Bacteria 1508
7 Ga0070669_100102326 3300005353 Unclassified 2163
8 Ga0070674_100054194 3300005356 Bacteria 2772
9 Ga0070674_100218856 3300005356 Bacteria 1480
10 Ga0070709_10152633 3300005434 Bacteria 1598
11 Ga0070709_10163763 3300005434 Bacteria 1548
12 Ga0070714_100032907 3300005435 Bacteria 4331
13 Ga0070714_100326613 3300005435 Bacteria 1436
14 Ga0070713_100002531 3300005436 Bacteria 11952
15 Ga0070713_100097441 3300005436 Bacteria 2541
16 Ga0070710_10018889 3300005437 Bacteria 3553
17 Ga0070711_100095038 3300005439 Bacteria 2156
18 Ga0070705_100026485 3300005440 Unclassified 3156
19 Ga0070705_100058331 3300005440 Bacteria 2281
20 Ga0070708_100045537 3300005445 Bacteria 3865
21 Ga0070708_100278008 3300005445 Unclassified 1576
22 Ga0070678_100267632 3300005456 Bacteria 1440
23 Ga0068867_100054467 3300005459 Bacteria 2955
24 Ga0068867_100162762 3300005459 Bacteria 1761
25 Ga0070706_100095822 3300005467 Bacteria 2755
26 Ga0070707_100058143 3300005468 Bacteria 3709
27 Ga0070707_100073993 3300005468 Bacteria 3285
28 Ga0070707_100118546 3300005468 Bacteria 2569
29 Ga0070707_100134608 3300005468 Bacteria 2404
30 Ga0070698_100015608 3300005471 Bacteria 8022
31 Ga0070698_100016090 3300005471 Bacteria 7898
32 Ga0070698_100026449 3300005471 Bacteria 6040
33 Ga0070699_100090495 3300005518 Bacteria 2674
34 Ga0070699_100144888 3300005518 Bacteria 2099
35 Ga0070684_100011940 3300005535 Bacteria 6938
36 Ga0070695_100067754 3300005545 Bacteria 2328
37 Ga0070696_100088703 3300005546 Bacteria 2199
38 Ga0070693_100051718 3300005547 Unclassified 2353
39 Ga0070704_100008063 3300005549 Bacteria 6291
40 Ga0070704_100012668 3300005549 Bacteria 5217
41 Ga0068855_100009334 3300005563 Bacteria 11847
42 Ga0070664_100354514 3300005564 Unclassified 1335
43 Ga0068857_100001430 3300005577 Bacteria 18914
44 Ga0068856_100095988 3300005614 Bacteria 2953
45 Ga0081455_10006181 3300005937 Bacteria 12915
46 Ga0081455_10007421 3300005937 Bacteria 11550
47 Ga0081455_10106005 3300005937 Bacteria 2245
48 Ga0081455_10187688 3300005937 Bacteria 1560
49 Ga0081538_10004936 3300005981 Bacteria 12151
50 Ga0081538_10015080 3300005981 Bacteria 6005
51 Ga0081538_10081847 3300005981 Bacteria 1715
52 Ga0081540_1002206 3300005983 Bacteria 16084
53 Ga0081540_1004965 3300005983 Bacteria 10004
54 Ga0081539_10000583 3300005985 Bacteria 74948
55 Ga0081539_10004170 3300005985 Bacteria 16402
56 Ga0070717_10049690 3300006028 Bacteria 3444
57 Ga0070717_10090702 3300006028 Bacteria 2579
58 Ga0075364_10004821 3300006051 Bacteria 7809
59 Ga0075432_10016587 3300006058 Bacteria 2514
60 Ga0070716_100006144 3300006173 Bacteria 5861
61 Ga0070716_100022978 3300006173 Bacteria 3301
62 Ga0070716_100055828 3300006173 Bacteria 2262
63 Ga0070712_100004553 3300006175 Bacteria 8561
64 Ga0070712_100010492 3300006175 Bacteria 5848
65 Ga0070712_100073043 3300006175 Bacteria 2459
66 Ga0075367_10037626 3300006178 Bacteria 2813
67 Ga0097621_100204626 3300006237 Bacteria 1715
68 Ga0068871_100050403 3300006358 Bacteria 3367
69 Ga0075428_100029864 3300006844 Bacteria 6029
70 Ga0075428_100082841 3300006844 Bacteria 3500
71 Ga0075428_100180827 3300006844 Bacteria 2283
72 Ga0075431_100019160 3300006847 Bacteria 6973
73 Ga0075431_100044854 3300006847 Bacteria 4559
74 Ga0075431_100093715 3300006847 Archaea 3099
75 Ga0075431_100535114 3300006847 Bacteria 1160
76 Ga0075433_10013001 3300006852 Bacteria 6749
77 Ga0075433_10024583 3300006852 Bacteria 5087
78 Ga0075433_10051316 3300006852 Bacteria 3591
79 Ga0075434_100003843 3300006871 Bacteria 13426
80 Ga0075434_100034073 3300006871 Bacteria 5027
81 Ga0075434_100099979 3300006871 Bacteria 2906
82 Ga0075434_100287262 3300006871 Archaea 1665
83 Ga0075436_100013277 3300006914 Bacteria 5644
84 Ga0075436_100026033 3300006914 Bacteria 4027
85 Ga0075436_100071837 3300006914 Bacteria 2393
86 Ga0075435_100007853 3300007076 Bacteria 7632
87 Ga0075435_100040330 3300007076 Bacteria 3728
88 Ga0075435_100203731 3300007076 Bacteria 1677
89 Ga0105244_10122186 3300009036 Bacteria 1260
90 Ga0111539_10013906 3300009094 Bacteria 10063
91 Ga0111539_10044831 3300009094 Bacteria 5295
92 Ga0111539_10202588 3300009094 Bacteria 2314
93 Ga0105245_10013780 3300009098 Bacteria 7041
94 Ga0105245_10449801 3300009098 Bacteria 1296
95 Ga0114129_10000910 3300009147 Bacteria 38506
96 Ga0114129_10014972 3300009147 Bacteria 11049
97 Ga0114129_10020643 3300009147 Bacteria 9366
98 Ga0114129_10080297 3300009147 Bacteria 4533
99 Ga0114129_10131797 3300009147 Bacteria 3432
100 Ga0114129_10164872 3300009147 Bacteria 3025
101 Ga0114129_10214693 3300009147 Unclassified 2598
102 Ga0114129_10242792 3300009147 Unclassified 2421
103 Ga0114129_10361470 3300009147 Bacteria 1921
104 Ga0114129_10425789 3300009147 Unclassified 1745
105 Ga0114129_10674330 3300009147 Bacteria 1332
106 Ga0105243_10073149 3300009148 Bacteria 2777
107 Ga0105248_10345482 3300009177 Bacteria 1675
108 Ga0105249_10036463 3300009553 Bacteria 4461
109 Ga0105239_10064135 3300010375 Bacteria 4033
110 Ga0157370_10036740 3300013104 Archaea 4752
111 Ga0157369_10137579 3300013105 Bacteria 2585
112 Ga0163162_10323536 3300013306 Unclassified 1674
113 Ga0157372_10358803 3300013307 Archaea 1698
114 Ga0157375_10242941 3300013308 Unclassified 1960
115 Ga0163163_10433912 3300014325 Bacteria 1373
116 Ga0157380_10115292 3300014326 Unclassified 2265
117 Ga0182008_10062497 3300014497 Bacteria 1835
118 Ga0182008_10076291 3300014497 Unclassified 1649
119 Ga0163161_10222464 3300017792 Bacteria 1462
120 Ga0207653_10008028 3300025885 Bacteria 3290
121 Ga0207688_10157737 3300025901 Unclassified 1343
122 Ga0207645_10066177 3300025907 Bacteria 2310
123 Ga0207684_10054985 3300025910 Bacteria 3377
124 Ga0207693_10001465 3300025915 Bacteria 20855
125 Ga0207693_10002108 3300025915 Bacteria 17353
126 Ga0207693_10006282 3300025915 Bacteria 9856
127 Ga0207693_10007849 3300025915 Bacteria 8760
128 Ga0207693_10035014 3300025915 Bacteria 3960
129 Ga0207693_10037626 3300025915 Unclassified 3814
130 Ga0207693_10107331 3300025915 Bacteria 2190
131 Ga0207663_10111205 3300025916 Bacteria 1859
132 Ga0207660_10069980 3300025917 Unclassified 2550
133 Ga0207646_10009957 3300025922 Bacteria 9341
134 Ga0207646_10041460 3300025922 Bacteria 4139
135 Ga0207646_10157426 3300025922 Bacteria 2049
136 Ga0207646_10168100 3300025922 Unclassified 1980
137 Ga0207681_10018104 3300025923 Bacteria 4435
138 Ga0207687_10073173 3300025927 Bacteria 2453
139 Ga0207687_10073465 3300025927 Unclassified 2448
140 Ga0207687_10089471 3300025927 Bacteria 2242
141 Ga0207700_10000141 3300025928 Bacteria 43403
142 Ga0207700_10242534 3300025928 Bacteria 1537
143 Ga0207664_10209629 3300025929 Bacteria 1685
144 Ga0207664_10237078 3300025929 Unclassified 1587
145 Ga0207706_10022429 3300025933 Bacteria 5666
146 Ga0207704_10192379 3300025938 Unclassified 1485
147 Ga0207665_10009301 3300025939 Bacteria 6450
148 Ga0207665_10030446 3300025939 Bacteria 3566
149 Ga0207665_10070562 3300025939 Bacteria 2384
150 Ga0207661_10013023 3300025944 Bacteria 6069
151 Ga0207712_10036215 3300025961 Bacteria 3359
152 Ga0207712_10059963 3300025961 Bacteria 2696
153 Ga0207668_10006182 3300025972 Bacteria 7066
154 Ga0207703_10317001 3300026035 Bacteria 1427
155 Ga0207639_10149786 3300026041 Unclassified 1953
156 Ga0207639_10160757 3300026041 Bacteria 1892
157 Ga0207678_10007761 3300026067 Bacteria 9479
158 Ga0207702_10001160 3300026078 Bacteria 26852
159 Ga0207702_10089121 3300026078 Bacteria 2697
160 Ga0207702_10211187 3300026078 Bacteria 1804
161 Ga0207648_10021873 3300026089 Bacteria 5745
162 Ga0207648_10098425 3300026089 Bacteria 2561
163 Ga0207674_10007738 3300026116 Bacteria 12506
164 Ga0207674_10051800 3300026116 Bacteria 4188
165 Ga0207675_100002763 3300026118 Bacteria 17252
166 Ga0207675_100043272 3300026118 Bacteria 4206
167 Ga0207675_100128822 3300026118 Unclassified 2399
168 Ga0207683_10022052 3300026121 Bacteria 5464
169 Ga0207683_10144744 3300026121 Bacteria 2143
170 Ga0207683_10294339 3300026121 Bacteria 1485
171 Ga0207428_10013637 3300027907 Bacteria 7090
172 Ga0207428_10113309 3300027907 Bacteria 2085
173 Ga0268265_10333899 3300028380 Bacteria 1378
174 Ga0265338_10063077 3300028800 Bacteria 3234
175 Ga0265338_10281128 3300028800 Bacteria 1216
176 Ga0265327_10037995 3300031251 Bacteria 2630
177 Ga0307408_100048126 3300031548 Unclassified 3057
178 Ga0307413_10095014 3300031824 Unclassified 1953
179 Ga0307406_10004942 3300031901 Bacteria 7265
180 Ga0307416_100000522 3300032002 Bacteria 19598
181 Ga0307416_100238494 3300032002 Bacteria 1760
182 Ga0307415_100006289 3300032126 Bacteria 6384
183 Ga0373948_0000790 3300034817 Bacteria 4157
184 Ga0373958_0000564 3300034819 Bacteria 4599
185 Ga0373938_0001786 3300034957 Bacteria 3433
186 Ga0373928_0001680 3300035084 Bacteria 4293
187 Ga0373940_0052185 3300035088 Bacteria 1151
188 Ga0373944_0006284 3300035089 Bacteria 3150
189 Ga0373949_0015715 3300035090 Bacteria 1692
190 Ga0373949_0020158 3300035090 Bacteria 1524
191 Ga0373932_0000189 3300035112 Bacteria 17836
192 Ga0373939_0002912 3300035114 Bacteria 4021
193 Ga0373960_0001895 3300035121 Bacteria 4679
194 Ga0373943_0012237 3300035170 Bacteria 3861
195 Ga0373943_0059185 3300035170 Bacteria 1909
196 Ga0373946_0023430 3300035171 Bacteria 2412
197 Ga0373961_0004169 3300035241 Bacteria 3511
198 Ga0373961_0011219 3300035241 Bacteria 2221
199 Ga0373962_0000380 3300035242 Bacteria 9699
200 Ga0373931_0000374 3300035691 Bacteria 18399
201 Ga0373935_0012688 3300035692 Bacteria 5071
202 Ga0373927_0083779 3300035695 Bacteria 2068
203 Ga0373947_0000770 3300035725 Bacteria 19222
204 Ga0373925_0137918 3300037068 Bacteria 1907
205 Ga0373925_0201773 3300037068 Bacteria 1582
206 Ga0395899_0001548 3300037312 Bacteria 19416
207 Ga0395899_0003928 3300037312 Bacteria 11718
208 Ga0395899_0012011 3300037312 Bacteria 6635
209 Ga0395899_0028607 3300037312 Bacteria 4195
210 Ga0395899_0033760 3300037312 Bacteria 3843
211 Ga0395899_0035272 3300037312 Bacteria 3755
212 Ga0395899_0052413 3300037312 Unclassified 3024
213 Ga0395899_0066266 3300037312 Bacteria 2652
214 Ga0395899_0164919 3300037312 Bacteria 1563
215 Ga0395899_0279830 3300037312 Unclassified 1135
216 Ga0395900_0002122 3300037418 Bacteria 22181
217 Ga0395900_0003384 3300037418 Bacteria 17224
218 Ga0395900_0007338 3300037418 Bacteria 11406
219 Ga0395900_0008004 3300037418 Bacteria 10876
220 Ga0395900_0010335 3300037418 Bacteria 9550
221 Ga0395900_0012934 3300037418 Bacteria 8527
222 Ga0395900_0015067 3300037418 Bacteria 7881
223 Ga0395900_0019671 3300037418 Bacteria 6883
224 Ga0395900_0038518 3300037418 Bacteria 4928
225 Ga0395900_0039093 3300037418 Bacteria 4890
226 Ga0395900_0078021 3300037418 Bacteria 3403
227 Ga0395900_0101861 3300037418 Bacteria 2949
228 Ga0395900_0117438 3300037418 Unclassified 2729
229 Ga0395900_0125600 3300037418 Unclassified 2631
230 Ga0395900_0191168 3300037418 Unclassified 2076
231 Ga0395900_0240882 3300037418 Bacteria 1814
232 Ga0395898_0001249 3300037466 Bacteria 37850
233 Ga0395898_0002136 3300037466 Bacteria 24363
234 Ga0395898_0002238 3300037466 Bacteria 23529
235 Ga0395898_0002255 3300037466 Bacteria 23396
236 Ga0395898_0005375 3300037466 Bacteria 13842
237 Ga0395898_0007585 3300037466 Bacteria 11518
238 Ga0395898_0009213 3300037466 Bacteria 10386
239 Ga0395898_0014916 3300037466 Bacteria 7978
240 Ga0395898_0016210 3300037466 Bacteria 7631
241 Ga0395898_0032137 3300037466 Bacteria 5237
242 Ga0395898_0035980 3300037466 Bacteria 4921
243 Ga0395898_0036203 3300037466 Bacteria 4902
244 Ga0395898_0045148 3300037466 Unclassified 4332
245 Ga0395898_0063343 3300037466 Bacteria 3588
246 Ga0395898_0070573 3300037466 Bacteria 3377
247 Ga0395898_0076935 3300037466 Bacteria 3222
248 Ga0395898_0144163 3300037466 Unclassified 2280
249 Ga0395898_0191428 3300037466 Unclassified 1954
250 Ga0395898_0239446 3300037466 Bacteria 1731
251 Ga0395898_0281692 3300037466 Unclassified 1586
252 Ga0395898_0299672 3300037466 Bacteria 1534
253 Ga0395898_0300810 3300037466 Bacteria 1530
254 Ga0395905_0001065 3300037471 Bacteria 34603
255 Ga0395905_0004156 3300037471 Bacteria 15146
256 Ga0395905_0005503 3300037471 Bacteria 12920
257 Ga0395905_0006869 3300037471 Bacteria 11380
258 Ga0395905_0007429 3300037471 Bacteria 10895
259 Ga0395905_0008260 3300037471 Bacteria 10281
260 Ga0395905_0013006 3300037471 Bacteria 7998
261 Ga0395905_0021980 3300037471 Bacteria 6034
262 Ga0395905_0022437 3300037471 Bacteria 5970
263 Ga0395905_0024798 3300037471 Bacteria 5660
264 Ga0395905_0037126 3300037471 Bacteria 4575
265 Ga0395905_0048949 3300037471 Bacteria 3960
266 Ga0395905_0284688 3300037471 Bacteria 1539
267 Ga0395901_0001460 3300038443 Bacteria 24601
268 Ga0395901_0002614 3300038443 Bacteria 18225
269 Ga0395901_0002723 3300038443 Bacteria 17814
270 Ga0395901_0009589 3300038443 Bacteria 9821
271 Ga0395901_0014159 3300038443 Bacteria 8120
272 Ga0395901_0035317 3300038443 Bacteria 5163
273 Ga0395901_0037684 3300038443 Bacteria 5000
274 Ga0395901_0039351 3300038443 Bacteria 4893
275 Ga0395901_0042005 3300038443 Bacteria 4739
276 Ga0395901_0067702 3300038443 Bacteria 3719
277 Ga0395901_0086744 3300038443 Bacteria 3272
278 Ga0395901_0101934 3300038443 Bacteria 3012
279 Ga0395901_0138492 3300038443 Bacteria 2558
280 Ga0395901_0145754 3300038443 Bacteria 2488
281 Ga0395901_0259660 3300038443 Unclassified 1808
282 Ga0395901_0297444 3300038443 Bacteria 1674
283 Ga0395901_0439872 3300038443 Bacteria 1335
284 Ga0439439_0006211 3300041406 Bacteria 2759
285 Ga0439461_0014348 3300041410 Bacteria 1506
286 Ga0451853_1756748 3300041512 Bacteria 1963
287 Ga0451853_2113192 3300041512 Unclassified 1872
288 Ga0451853_4067866 3300041512 Bacteria 2465
289 Ga0439433_0001944 3300041999 Bacteria 4328
290 Ga0439442_011911 3300042002 Bacteria 1775
291 Ga0439462_0001658 3300042015 Bacteria 5006
292 Ga0439434_0011841 3300042435 Bacteria 2579
293 Ga0466963_0143872 3300044694 Bacteria 1653
294 Ga0466964_0048616 3300044706 Bacteria 1735
295 Ga0466968_0062668 3300044735 Unclassified 1606
296 Ga0466957_0200031 3300044842 Bacteria 1312
297 Ga0451576_0066955 3300045051 Bacteria 3738
298 Ga0466967_0005413 3300045976 Bacteria 8843
299 Ga0466967_0065444 3300045976 Bacteria 3235
300 Ga0466967_0113345 3300045976 Bacteria 2494
301 Ga0495603_0001930 3300046455 Bacteria 12224
302 Ga0495641_0000786 3300046461 Bacteria 26874
303 Ga0495582_0010387 3300046473 Bacteria 5123
304 Ga0495594_0000915 3300046499 Bacteria 15329
305 Ga0495630_0013516 3300046517 Bacteria 5937
306 Ga0495630_0020008 3300046517 Bacteria 4929
307 Ga0495666_0023176 3300046526 Bacteria 3071
308 Ga0495586_0007367 3300046535 Bacteria 5872
309 Ga0495634_0060022 3300046642 Bacteria 2532
310 Ga0495588_0000409 3300046674 Bacteria 23658
311 Ga0495613_0074076 3300046689 Bacteria 2480
312 Ga0495581_0070785 3300047315 Unclassified 2018
313 Ga0495676_0002605 3300047321 Bacteria 16101
314 Ga0495676_0041250 3300047321 Bacteria 3801
315 Ga0495676_0041921 3300047321 Bacteria 3763
316 Ga0496100_0003327 3300048903 Bacteria 8370
317 Ga0496100_0177664 3300048903 Bacteria 1538
318 Ga0496100_0255028 3300048903 Bacteria 1299
319 Ga0496101_0009143 3300048904 Bacteria 6503
320 Ga0496101_0019329 3300048904 Bacteria 4650
321 Ga0496101_0031469 3300048904 Bacteria 3730
322 Ga0496102_0010801 3300048905 Bacteria 7865
323 Ga0496102_0152459 3300048905 Bacteria 2172
324 Ga0496102_0157324 3300048905 Bacteria 2136
325 Ga0496103_0016540 3300048906 Bacteria 4402
326 Ga0496103_0023867 3300048906 Bacteria 3689
327 Ga0496103_0069053 3300048906 Unclassified 2209
328 Ga0496104_0003324 3300048907 Bacteria 13881
329 Ga0496104_0007406 3300048907 Bacteria 9696
330 Ga0496104_0012289 3300048907 Bacteria 7697
331 Ga0496104_0051079 3300048907 Bacteria 3901
332 Ga0496105_0001205 3300048908 Bacteria 18016
333 Ga0496105_0002977 3300048908 Bacteria 12447
334 Ga0496105_0066590 3300048908 Bacteria 2974
335 Ga0496105_0395785 3300048908 Unclassified 1097
336 Ga0496106_0029056 3300048909 Bacteria 4119
337 Ga0496106_0094990 3300048909 Bacteria 2305
338 Ga0496106_0115393 3300048909 Unclassified 2094
339 Ga0496106_0119453 3300048909 Bacteria 2059
340 Ga0496106_0122770 3300048909 Unclassified 2032
341 Ga0496107_0006565 3300048910 Bacteria 8003
342 Ga0496107_0075903 3300048910 Unclassified 2447
343 Ga0496107_0335698 3300048910 Bacteria 1124
344 Ga0496108_0019950 3300048911 Bacteria 5505
345 Ga0496108_0131274 3300048911 Unclassified 2153
346 Ga0496108_0315402 3300048911 Bacteria 1363
347 Ga0496108_0319755 3300048911 Bacteria 1353
348 Ga0496109_0004587 3300048912 Bacteria 11535
349 Ga0496109_0008605 3300048912 Bacteria 8687
350 Ga0496109_0017569 3300048912 Bacteria 6272
351 Ga0496109_0027881 3300048912 Bacteria 5047
352 Ga0496109_0036245 3300048912 Bacteria 4453
353 Ga0496109_0109028 3300048912 Bacteria 2574
354 Ga0496110_0002261 3300048913 Bacteria 14390
355 Ga0496110_0003921 3300048913 Bacteria 11446
356 Ga0496110_0006909 3300048913 Bacteria 9026
357 Ga0496111_0004077 3300048914 Bacteria 9174
358 Ga0496111_0006329 3300048914 Bacteria 7675
359 Ga0496111_0081509 3300048914 Bacteria 2362
360 Ga0496111_0130545 3300048914 Bacteria 1859
361 Ga0496111_0170395 3300048914 Bacteria 1618
362 Ga0496112_0002763 3300048915 Bacteria 14236
363 Ga0496112_0031925 3300048915 Bacteria 5111
364 Ga0496112_0036941 3300048915 Bacteria 4767
365 Ga0496112_0044602 3300048915 Bacteria 4345
366 Ga0496112_0046394 3300048915 Bacteria 4261
367 Ga0496112_0196310 3300048915 Bacteria 1978
368 Ga0496112_0206865 3300048915 Bacteria 1920
369 Ga0496112_0253212 3300048915 Bacteria 1712
370 Ga0496112_0362709 3300048915 Bacteria 1391
371 Ga0496113_0000346 3300048916 Bacteria 22110
372 Ga0496113_0001255 3300048916 Bacteria 13985
373 Ga0496113_0132539 3300048916 Unclassified 1956
374 Ga0496114_0005241 3300048917 Bacteria 10132
375 Ga0496114_0051043 3300048917 Bacteria 3443
376 Ga0496115_0001996 3300048918 Bacteria 14585
377 Ga0496115_0008562 3300048918 Bacteria 7574
378 Ga0496115_0034692 3300048918 Bacteria 3987
379 Ga0501040_0034376 3300049576 Bacteria 3434
380 Ga0501041_0025165 3300049577 Bacteria 3578
381 Ga0501069_0020492 3300049585 Bacteria 3582
382 Ga0501071_0021310 3300049587 Bacteria 4511
383 Ga0501077_0047495 3300049593 Bacteria 2728
384 Ga0501045_0069923 3300049824 Bacteria 2582
385 nmdc:mga00v17_45227_c1 3300050491 Archaea 2659
386 nmdc:mga0yw44_82322_c1 3300050492 Archaea 2019
387 nmdc:mga06z11_27658_c1 3300050494 Bacteria 2712
388 nmdc:mga05p37_209527_c1 3300050507 Unclassified 2357
389 nmdc:mga05p37_24223_c1 3300050507 Bacteria 7375
390 nmdc:mga05p37_56830_c1 3300050507 Bacteria 4818
391 nmdc:mga05p37_597915_c1 3300050507 Unclassified 1246
392 nmdc:mga05p37_599715_c1 3300050507 Bacteria 1243
393 nmdc:mga06r32_125037_c1 3300050510 Unclassified 2539
394 nmdc:mga06r32_17990_c1 3300050510 Bacteria 6461
395 nmdc:mga06r32_267475_c1 3300050510 Bacteria 1697
396 nmdc:mga08y16_236999_c1 3300050511 Bacteria 1887
397 nmdc:mga08y16_317704_c1 3300050511 Bacteria 1603
398 nmdc:mga0n895_238486_c1 3300050512 Unclassified 1845
399 nmdc:mga0n895_26127_c1 3300050512 Bacteria 5525
400 nmdc:mga0n895_30952_c1 3300050512 Bacteria 5119
401 nmdc:mga0n895_6658_c1 3300050512 Bacteria 9846
402 nmdc:mga0n895_96174_c1 3300050512 Bacteria 2967
403 nmdc:mga0rr50_128003_c1 3300050513 Bacteria 2030
404 nmdc:mga0rr50_293020_c1 3300050513 Bacteria 1360
405 nmdc:mga08x19_11506_c1 3300050514 Bacteria 5325
406 nmdc:mga08x19_29384_c1 3300050514 Bacteria 3447
407 nmdc:mga08x19_43968_c1 3300050514 Bacteria 2851
408 nmdc:mga0a205_17444_c1 3300050515 Bacteria 6732
409 nmdc:mga0a205_292_c2 3300050515 Bacteria 7073
410 nmdc:mga0a205_31308_c1 3300050515 Bacteria 5097
411 nmdc:mga0a205_330124_c1 3300050515 Unclassified 1395
412 nmdc:mga0a205_62735_c1 3300050515 Bacteria 3591
413 Ga0501084_0134064 3300054114 Bacteria 2085
414 Ga0501084_0184262 3300054114 Bacteria 1762
415 Ga0501084_0300954 3300054114 Bacteria 1355
416 Ga0501082_0109843 3300060353 Bacteria 2387
417 Ga0530510_0011164 3300061734 Bacteria 6301
418 Ga0070705_100010884
419 Ga0070676_10064194
420 Ga0070682_100013575
421 Ga0068868_100027534
422 Ga0070691_10072759
423 Ga0070692_10112496
424 Ga0070669_100102326
425 Ga0070674_100054194
426 Ga0070674_100218856
427 Ga0070709_10152633
428 Ga0070709_10163763
429 Ga0070714_100032907
430 Ga0070714_100326613
431 Ga0070713_100002531
432 Ga0070713_100097441
433 Ga0070710_10018889
434 Ga0070711_100095038
435 Ga0070705_100026485
436 Ga0070705_100058331
437 Ga0070708_100045537
438 Ga0070708_100278008
439 Ga0070678_100267632
440 Ga0068867_100054467
441 Ga0068867_100162762
442 Ga0070706_100095822
443 Ga0070707_100058143
444 Ga0070707_100073993
445 Ga0070707_100118546
446 Ga0070707_100134608
447 Ga0070698_100015608
448 Ga0070698_100016090
449 Ga0070698_100026449
450 Ga0070699_100090495
451 Ga0070699_100144888
452 Ga0070684_100011940
453 Ga0070695_100067754
454 Ga0070696_100088703
455 Ga0070693_100051718
456 Ga0070704_100008063
457 Ga0070704_100012668
458 Ga0068855_100009334
459 Ga0070664_100354514
460 Ga0068857_100001430
461 Ga0068856_100095988
462 Ga0081455_10006181
463 Ga0081455_10007421
464 Ga0081455_10106005
465 Ga0081455_10187688
466 Ga0081538_10004936
467 Ga0081538_10015080
468 Ga0081538_10081847
469 Ga0081540_1002206
470 Ga0081540_1004965
471 Ga0081539_10000583
472 Ga0081539_10004170
473 Ga0070717_10049690
474 Ga0070717_10090702
475 Ga0075364_10004821
476 Ga0075432_10016587
477 Ga0070716_100006144
478 Ga0070716_100022978
479 Ga0070716_100055828
480 Ga0070712_100004553
481 Ga0070712_100010492
482 Ga0070712_100073043
483 Ga0075367_10037626
484 Ga0097621_100204626
485 Ga0068871_100050403
486 Ga0075428_100029864
487 Ga0075428_100082841
488 Ga0075428_100180827
489 Ga0075431_100019160
490 Ga0075431_100044854
491 Ga0075431_100093715
492 Ga0075431_100535114
493 Ga0075433_10013001
494 Ga0075433_10024583
495 Ga0075433_10051316
496 Ga0075434_100003843
497 Ga0075434_100034073
498 Ga0075434_100099979
499 Ga0075434_100287262
500 Ga0075436_100013277
501 Ga0075436_100026033
502 Ga0075436_100071837
503 Ga0075435_100007853
504 Ga0075435_100040330
505 Ga0075435_100203731
506 Ga0105244_10122186
507 Ga0111539_10013906
508 Ga0111539_10044831
509 Ga0111539_10202588
510 Ga0105245_10013780
511 Ga0105245_10449801
512 Ga0114129_10000910
513 Ga0114129_10014972
514 Ga0114129_10020643
515 Ga0114129_10080297
516 Ga0114129_10131797
517 Ga0114129_10164872
518 Ga0114129_10214693
519 Ga0114129_10242792
520 Ga0114129_10361470
521 Ga0114129_10425789
522 Ga0114129_10674330
523 Ga0105243_10073149
524 Ga0105248_10345482
525 Ga0105249_10036463
526 Ga0105239_10064135
527 Ga0157370_10036740
528 Ga0157369_10137579
529 Ga0163162_10323536
530 Ga0157372_10358803
531 Ga0157375_10242941
532 Ga0163163_10433912
533 Ga0157380_10115292
534 Ga0182008_10062497
535 Ga0182008_10076291
536 Ga0163161_10222464
537 Ga0207653_10008028
538 Ga0207688_10157737
539 Ga0207645_10066177
540 Ga0207684_10054985
541 Ga0207693_10001465
542 Ga0207693_10002108
543 Ga0207693_10006282
544 Ga0207693_10007849
545 Ga0207693_10035014
546 Ga0207693_10037626
547 Ga0207693_10107331
548 Ga0207663_10111205
549 Ga0207660_10069980
550 Ga0207646_10009957
551 Ga0207646_10041460
552 Ga0207646_10157426
553 Ga0207646_10168100
554 Ga0207681_10018104
555 Ga0207687_10073173
556 Ga0207687_10073465
557 Ga0207687_10089471
558 Ga0207700_10000141
559 Ga0207700_10242534
560 Ga0207664_10209629
561 Ga0207664_10237078
562 Ga0207706_10022429
563 Ga0207704_10192379
564 Ga0207665_10009301
565 Ga0207665_10030446
566 Ga0207665_10070562
567 Ga0207661_10013023
568 Ga0207712_10036215
569 Ga0207712_10059963
570 Ga0207668_10006182
571 Ga0207703_10317001
572 Ga0207639_10149786
573 Ga0207639_10160757
574 Ga0207678_10007761
575 Ga0207702_10001160
576 Ga0207702_10089121
577 Ga0207702_10211187
578 Ga0207648_10021873
579 Ga0207648_10098425
580 Ga0207674_10007738
581 Ga0207674_10051800
582 Ga0207675_100002763
583 Ga0207675_100043272
584 Ga0207675_100128822
585 Ga0207683_10022052
586 Ga0207683_10144744
587 Ga0207683_10294339
588 Ga0207428_10013637
589 Ga0207428_10113309
590 Ga0268265_10333899
591 Ga0265338_10063077
592 Ga0265338_10281128
593 Ga0265327_10037995
594 Ga0307408_100048126
595 Ga0307413_10095014
596 Ga0307406_10004942
597 Ga0307416_100000522
598 Ga0307416_100238494
599 Ga0307415_100006289
600 Ga0373948_0000790
601 Ga0373958_0000564
602 Ga0373938_0001786
603 Ga0373928_0001680
604 Ga0373940_0052185
605 Ga0373944_0006284
606 Ga0373949_0015715
607 Ga0373949_0020158
608 Ga0373932_0000189
609 Ga0373939_0002912
610 Ga0373960_0001895
611 Ga0373943_0012237
612 Ga0373943_0059185
613 Ga0373946_0023430
614 Ga0373961_0004169
615 Ga0373961_0011219
616 Ga0373962_0000380
617 Ga0373931_0000374
618 Ga0373935_0012688
619 Ga0373927_0083779
620 Ga0373947_0000770
621 Ga0373925_0137918
622 Ga0373925_0201773
623 Ga0395899_0001548
624 Ga0395899_0003928
625 Ga0395899_0012011
626 Ga0395899_0028607
627 Ga0395899_0033760
628 Ga0395899_0035272
629 Ga0395899_0052413
630 Ga0395899_0066266
631 Ga0395899_0164919
632 Ga0395899_0279830
633 Ga0395900_0002122
634 Ga0395900_0003384
635 Ga0395900_0007338
636 Ga0395900_0008004
637 Ga0395900_0010335
638 Ga0395900_0012934
639 Ga0395900_0015067
640 Ga0395900_0019671
641 Ga0395900_0038518
642 Ga0395900_0039093
643 Ga0395900_0078021
644 Ga0395900_0101861
645 Ga0395900_0117438
646 Ga0395900_0125600
647 Ga0395900_0191168
648 Ga0395900_0240882
649 Ga0395898_0001249
650 Ga0395898_0002136
651 Ga0395898_0002238
652 Ga0395898_0002255
653 Ga0395898_0005375
654 Ga0395898_0007585
655 Ga0395898_0009213
656 Ga0395898_0014916
657 Ga0395898_0016210
658 Ga0395898_0032137
659 Ga0395898_0035980
660 Ga0395898_0036203
661 Ga0395898_0045148
662 Ga0395898_0063343
663 Ga0395898_0070573
664 Ga0395898_0076935
665 Ga0395898_0144163
666 Ga0395898_0191428
667 Ga0395898_0239446
668 Ga0395898_0281692
669 Ga0395898_0299672
670 Ga0395898_0300810
671 Ga0395905_0001065
672 Ga0395905_0004156
673 Ga0395905_0005503
674 Ga0395905_0006869
675 Ga0395905_0007429
676 Ga0395905_0008260
677 Ga0395905_0013006
678 Ga0395905_0021980
679 Ga0395905_0022437
680 Ga0395905_0024798
681 Ga0395905_0037126
682 Ga0395905_0048949
683 Ga0395905_0284688
684 Ga0395901_0001460
685 Ga0395901_0002614
686 Ga0395901_0002723
687 Ga0395901_0009589
688 Ga0395901_0014159
689 Ga0395901_0035317
690 Ga0395901_0037684
691 Ga0395901_0039351
692 Ga0395901_0042005
693 Ga0395901_0067702
694 Ga0395901_0086744
695 Ga0395901_0101934
696 Ga0395901_0138492
697 Ga0395901_0145754
698 Ga0395901_0259660
699 Ga0395901_0297444
700 Ga0395901_0439872
701 Ga0439439_0006211
702 Ga0439461_0014348
703 Ga0451853_1756748
704 Ga0451853_2113192
705 Ga0451853_4067866
706 Ga0439433_0001944
707 Ga0439442_011911
708 Ga0439462_0001658
709 Ga0439434_0011841
710 Ga0466963_0143872
711 Ga0466964_0048616
712 Ga0466968_0062668
713 Ga0466957_0200031
714 Ga0451576_0066955
715 Ga0466967_0005413
716 Ga0466967_0065444
717 Ga0466967_0113345
718 Ga0495603_0001930
719 Ga0495641_0000786
720 Ga0495582_0010387
721 Ga0495594_0000915
722 Ga0495630_0013516
723 Ga0495630_0020008
724 Ga0495666_0023176
725 Ga0495586_0007367
726 Ga0495634_0060022
727 Ga0495588_0000409
728 Ga0495613_0074076
729 Ga0495581_0070785
730 Ga0495676_0002605
731 Ga0495676_0041250
732 Ga0495676_0041921
733 Ga0496100_0003327
734 Ga0496100_0177664
735 Ga0496100_0255028
736 Ga0496101_0009143
737 Ga0496101_0019329
738 Ga0496101_0031469
739 Ga0496102_0010801
740 Ga0496102_0152459
741 Ga0496102_0157324
742 Ga0496103_0016540
743 Ga0496103_0023867
744 Ga0496103_0069053
745 Ga0496104_0003324
746 Ga0496104_0007406
747 Ga0496104_0012289
748 Ga0496104_0051079
749 Ga0496105_0001205
750 Ga0496105_0002977
751 Ga0496105_0066590
752 Ga0496105_0395785
753 Ga0496106_0029056
754 Ga0496106_0094990
755 Ga0496106_0115393
756 Ga0496106_0119453
757 Ga0496106_0122770
758 Ga0496107_0006565
759 Ga0496107_0075903
760 Ga0496107_0335698
761 Ga0496108_0019950
762 Ga0496108_0131274
763 Ga0496108_0315402
764 Ga0496108_0319755
765 Ga0496109_0004587
766 Ga0496109_0008605
767 Ga0496109_0017569
768 Ga0496109_0027881
769 Ga0496109_0036245
770 Ga0496109_0109028
771 Ga0496110_0002261
772 Ga0496110_0003921
773 Ga0496110_0006909
774 Ga0496111_0004077
775 Ga0496111_0006329
776 Ga0496111_0081509
777 Ga0496111_0130545
778 Ga0496111_0170395
779 Ga0496112_0002763
780 Ga0496112_0031925
781 Ga0496112_0036941
782 Ga0496112_0044602
783 Ga0496112_0046394
784 Ga0496112_0196310
785 Ga0496112_0206865
786 Ga0496112_0253212
787 Ga0496112_0362709
788 Ga0496113_0000346
789 Ga0496113_0001255
790 Ga0496113_0132539
791 Ga0496114_0005241
792 Ga0496114_0051043
793 Ga0496115_0001996
794 Ga0496115_0008562
795 Ga0496115_0034692
796 Ga0501040_0034376
797 Ga0501041_0025165
798 Ga0501069_0020492
799 Ga0501071_0021310
800 Ga0501077_0047495
801 Ga0501045_0069923
802 nmdc:mga00v17_45227_c1
803 nmdc:mga0yw44_82322_c1
804 nmdc:mga06z11_27658_c1
805 nmdc:mga05p37_209527_c1
806 nmdc:mga05p37_24223_c1
807 nmdc:mga05p37_56830_c1
808 nmdc:mga05p37_597915_c1
809 nmdc:mga05p37_599715_c1
810 nmdc:mga06r32_125037_c1
811 nmdc:mga06r32_17990_c1
812 nmdc:mga06r32_267475_c1
813 nmdc:mga08y16_236999_c1
814 nmdc:mga08y16_317704_c1
815 nmdc:mga0n895_238486_c1
816 nmdc:mga0n895_26127_c1
817 nmdc:mga0n895_30952_c1
818 nmdc:mga0n895_6658_c1
819 nmdc:mga0n895_96174_c1
820 nmdc:mga0rr50_128003_c1
821 nmdc:mga0rr50_293020_c1
822 nmdc:mga08x19_11506_c1
823 nmdc:mga08x19_29384_c1
824 nmdc:mga08x19_43968_c1
825 nmdc:mga0a205_17444_c1
826 nmdc:mga0a205_292_c2
827 nmdc:mga0a205_31308_c1
828 nmdc:mga0a205_330124_c1
829 nmdc:mga0a205_62735_c1
830 Ga0501084_0134064
831 Ga0501084_0184262
832 Ga0501084_0300954
833 Ga0501082_0109843
834 Ga0530510_0011164

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01266

DAO

FAD dependent oxidoreductase

49

364

0.89

PF00890

FAD_binding_2

FAD binding domain

49

224

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
7by8-assembly1.cif.gz_B malate dehydrogenase from geobacillus stearothermophilus (gs-mdh) 0.9482 4 32
7by8-assembly1.cif.gz_C malate dehydrogenase from geobacillus stearothermophilus (gs-mdh) 0.9464 4 32
7by8-assembly1.cif.gz_D malate dehydrogenase from geobacillus stearothermophilus (gs-mdh) 0.9444 4 32
7x1l-assembly1.cif.gz_E malate dehydrogenase from geobacillus stearothermophilus (gs-mdh) delta e311 mutant complexed with nicotinamide adenine dinucleotide (nad+) 0.9375 4 32
7bya-assembly1.cif.gz_C malate dehydrogenase from geobacillus stearothermophilus (gs-mdh) complexed with oxaloacetic acid (oaa) and adenosine 5'-diphosphoribose (apr) 0.9374 4 32
ID Description Score Start End Superfamily
2ivdA01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9466 4 34 3.50.50.60
af_P9WHH5_150_268_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9347 4 34 3.50.50.60
af_Q5AMP2_2_178_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9231 2 32 3.40.50.720
af_Q07589_1_199_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9183 1 31 3.40.50.720
af_Q5AA38_4_182_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9173 1 31 3.40.50.720
ID Description Score Start End GO Terms
AF-Q1ILF6-F1-model_v4 FAD dependent oxidoreductase 0.9378 2 339 GO:0005737
AF-A0A538TEN8-F1-model_v4 FAD-binding oxidoreductase 0.9368 2 339 GO:0005737
AF-A0A101FN33-F1-model_v4 FAD dependent oxidoreductase 0.9364 2 339 GO:0005737
AF-G2LDU0-F1-model_v4 Glycine/D-amino acid oxidases (Deaminating) 0.9316 2 339 GO:0005737
GO:0016020
AF-A0A1G2ZKQ5-F1-model_v4 FAD dependent oxidoreductase domain-containing protein 0.9309 2 339 GO:0005737
GO:0016020

Map