F438920

General Info

Members Datasets Scaffolds Average Seq Length
416 216 832 302

Family's Representative Sequence

Representative Sequence 3300050511|nmdc:mga08y16_88216_c1|nmdc:mga08y16_88216_c1_1617_2651
Length 344
Sequence MPTSETTPYFIIDSEQVHARVFFSLGGLARSSLEQKRLGNRNAGAILERMRNRVFALTALLVGLGSVQAAESIASRDAKIDNVQLHYLTAGHGPAVILLHGFAETSRMWRPIIPLLAEKFTVIAPDLPGIGDSSIPEKIDMVEAARQIHDLARSLKIEKACVVGHDIGLMVAYAYATQFPTETEKLALMDAFLPGVPGWEAIYDAPDIWHFRFNGEYPEKLVKGRERTYFEYFWNVFAADKARSIPEAERKAYTAAYARPGRMQAAWGYFVSWPQLAKDFARLSQTKLSMPVLSIGGEKSLGNELAAQMKLVADNVSVVVLKDTGHWILEERPKETTEALTKFL

Samples

Sample ID Description Type Environment
1 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
93 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
95 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
150 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
151 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
152 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
153 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
154 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
155 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
156 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
157 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
158 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
159 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
160 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
161 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
162 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
163 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
164 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
165 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
166 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
167 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
168 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
169 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
170 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
171 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
172 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
173 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
174 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
175 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
176 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
177 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
178 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
179 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
180 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
181 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
182 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
183 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
184 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
185 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
186 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
187 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
188 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
189 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
190 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
191 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
192 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
193 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
194 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
195 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
196 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
197 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
198 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
199 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
200 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
201 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
202 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
203 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
204 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
205 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
206 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
207 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
208 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
209 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
210 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
211 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
212 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
213 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
214 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
215 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
216 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.04
Metatranscriptomes 0.96
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.05
Rhizosphere 94.71
Stem 0
Stem Tuber 0
Unclassified 15.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga08y16_88216_c1 3300050511 Bacteria 3232
2 SwRhRL3b_contig_2631278 2162886006 Archaea 1412
3 Ga0065715_10007818 3300005293 Bacteria 2580
4 Ga0070683_100091623 3300005329 Bacteria 2854
5 Ga0070690_100039398 3300005330 Bacteria 2986
6 Ga0070670_100005143 3300005331 Bacteria 11005
7 Ga0070670_100183021 3300005331 Bacteria 1819
8 Ga0070666_10001275 3300005335 Bacteria 15250
9 Ga0070666_10040111 3300005335 Bacteria 3124
10 Ga0070666_10141530 3300005335 Bacteria 1675
11 Ga0070680_100391905 3300005336 Bacteria 1183
12 Ga0070682_100016821 3300005337 Unclassified 4256
13 Ga0068868_100002283 3300005338 Bacteria 13255
14 Ga0068868_100015745 3300005338 Bacteria 5601
15 Ga0068868_100061107 3300005338 Unclassified 2984
16 Ga0070660_100128876 3300005339 Bacteria 2023
17 Ga0070661_100037688 3300005344 Unclassified 3517
18 Ga0070668_100011901 3300005347 Bacteria 6477
19 Ga0070669_100244598 3300005353 Bacteria 1426
20 Ga0070675_100115920 3300005354 Bacteria 2271
21 Ga0070671_100212295 3300005355 Bacteria 1642
22 Ga0070671_100281401 3300005355 Bacteria 1415
23 Ga0070674_100011099 3300005356 Bacteria 5470
24 Ga0070674_100080145 3300005356 Bacteria 2331
25 Ga0070673_100070957 3300005364 Bacteria 2797
26 Ga0070688_100102049 3300005365 Bacteria 1893
27 Ga0070688_100192802 3300005365 Bacteria 1421
28 Ga0070667_100005486 3300005367 Bacteria 10589
29 Ga0070667_100009954 3300005367 Bacteria 7881
30 Ga0070667_100022128 3300005367 Bacteria 5273
31 Ga0070709_10005693 3300005434 Bacteria 6757
32 Ga0070709_10015236 3300005434 Unclassified 4369
33 Ga0070709_10028521 3300005434 Unclassified 3330
34 Ga0070709_10050355 3300005434 Bacteria 2609
35 Ga0070709_10092505 3300005434 Unclassified 1998
36 Ga0070714_100219492 3300005435 Bacteria 1747
37 Ga0070713_100000057 3300005436 Bacteria 70266
38 Ga0070713_100100819 3300005436 Bacteria 2500
39 Ga0070713_100195487 3300005436 Bacteria 1824
40 Ga0070710_10012755 3300005437 Bacteria 4184
41 Ga0070711_100000318 3300005439 Bacteria 24918
42 Ga0070711_100028078 3300005439 Bacteria 3699
43 Ga0070711_100039690 3300005439 Bacteria 3172
44 Ga0070694_100029478 3300005444 Bacteria 3581
45 Ga0070694_100108560 3300005444 Bacteria 1974
46 Ga0070708_100201477 3300005445 Bacteria 1863
47 Ga0070708_100234285 3300005445 Bacteria 1723
48 Ga0070678_100122763 3300005456 Bacteria 2051
49 Ga0070678_100213906 3300005456 Bacteria 1599
50 Ga0070678_100244937 3300005456 Bacteria 1501
51 Ga0070662_100032618 3300005457 Unclassified 3661
52 Ga0070662_100043261 3300005457 Unclassified 3221
53 Ga0070662_100066704 3300005457 Bacteria 2641
54 Ga0070662_100234462 3300005457 Bacteria 1469
55 Ga0070681_10010391 3300005458 Bacteria 9194
56 Ga0070681_10011787 3300005458 Bacteria 8666
57 Ga0070681_10384298 3300005458 Bacteria 1314
58 Ga0068867_100007039 3300005459 Bacteria 7945
59 Ga0068867_100083882 3300005459 Bacteria 2406
60 Ga0070685_10133902 3300005466 Bacteria 1552
61 Ga0070706_100035632 3300005467 Bacteria 4593
62 Ga0070706_100042637 3300005467 Bacteria 4193
63 Ga0070707_100003356 3300005468 Bacteria 15114
64 Ga0070707_100009766 3300005468 Bacteria 8921
65 Ga0070707_100018493 3300005468 Bacteria 6556
66 Ga0070707_100019613 3300005468 Bacteria 6373
67 Ga0070707_100036382 3300005468 Bacteria 4697
68 Ga0070707_100238307 3300005468 Bacteria 1771
69 Ga0070707_100262730 3300005468 Unclassified 1679
70 Ga0070707_100383784 3300005468 Bacteria 1365
71 Ga0070707_100405111 3300005468 Bacteria 1324
72 Ga0070707_100516539 3300005468 Bacteria 1156
73 Ga0070698_100022546 3300005471 Bacteria 6586
74 Ga0070699_100109370 3300005518 Bacteria 2426
75 Ga0070699_100151187 3300005518 Bacteria 2053
76 Ga0070699_100176111 3300005518 Unclassified 1897
77 Ga0070679_100073415 3300005530 Bacteria 3413
78 Ga0070679_100251913 3300005530 Bacteria 1722
79 Ga0070684_100026434 3300005535 Unclassified 4890
80 Ga0070697_100051207 3300005536 Bacteria 3355
81 Ga0070697_100053099 3300005536 Bacteria 3294
82 Ga0070697_100085291 3300005536 Bacteria 2606
83 Ga0070697_100157871 3300005536 Bacteria 1915
84 Ga0070697_100174283 3300005536 Bacteria 1821
85 Ga0070672_100128592 3300005543 Bacteria 2080
86 Ga0070672_100240050 3300005543 Bacteria 1524
87 Ga0070686_100262932 3300005544 Bacteria 1265
88 Ga0070696_100019559 3300005546 Bacteria 4586
89 Ga0070693_100061170 3300005547 Bacteria 2188
90 Ga0070665_100044142 3300005548 Bacteria 4477
91 Ga0070665_100217204 3300005548 Bacteria 1913
92 Ga0070665_100219624 3300005548 Bacteria 1901
93 Ga0070704_100166634 3300005549 Bacteria 1748
94 Ga0068854_100009044 3300005578 Bacteria 6418
95 Ga0068856_100056734 3300005614 Unclassified 3865
96 Ga0068856_100297302 3300005614 Bacteria 1632
97 Ga0068859_100012514 3300005617 Bacteria 8536
98 Ga0068859_100033821 3300005617 Bacteria 5133
99 Ga0068859_100178336 3300005617 Bacteria 2207
100 Ga0068859_100572957 3300005617 Bacteria 1223
101 Ga0068864_100008500 3300005618 Bacteria 8471
102 Ga0068864_100077915 3300005618 Bacteria 2900
103 Ga0068864_100144743 3300005618 Bacteria 2147
104 Ga0068864_100374874 3300005618 Unclassified 1347
105 Ga0068866_10035925 3300005718 Bacteria 2424
106 Ga0068870_10183478 3300005840 Bacteria 1258
107 Ga0068863_100018442 3300005841 Bacteria 6679
108 Ga0068863_100132244 3300005841 Bacteria 2382
109 Ga0068863_100204089 3300005841 Bacteria 1902
110 Ga0068863_100311017 3300005841 Bacteria 1529
111 Ga0068863_100331483 3300005841 Bacteria 1479
112 Ga0068858_100018956 3300005842 Bacteria 6438
113 Ga0068858_100033182 3300005842 Bacteria 4793
114 Ga0068860_100016640 3300005843 Bacteria 7173
115 Ga0068860_100089432 3300005843 Bacteria 2932
116 Ga0068860_100094555 3300005843 Bacteria 2849
117 Ga0070717_10007132 3300006028 Bacteria 8281
118 Ga0070717_10040026 3300006028 Unclassified 3816
119 Ga0070717_10080210 3300006028 Unclassified 2738
120 Ga0070717_10098423 3300006028 Bacteria 2479
121 Ga0070717_10152232 3300006028 Bacteria 2002
122 Ga0070717_10155463 3300006028 Unclassified 1981
123 Ga0070717_10436773 3300006028 Bacteria 1179
124 Ga0070715_10027447 3300006163 Bacteria 2274
125 Ga0070716_100004230 3300006173 Bacteria 6834
126 Ga0070716_100021305 3300006173 Unclassified 3413
127 Ga0070716_100231263 3300006173 Bacteria 1248
128 Ga0070712_100000055 3300006175 Bacteria 57367
129 Ga0070712_100018135 3300006175 Bacteria 4567
130 Ga0070712_100193124 3300006175 Bacteria 1594
131 Ga0070712_100228509 3300006175 Unclassified 1476
132 Ga0097621_100001702 3300006237 Bacteria 15036
133 Ga0097621_100022000 3300006237 Bacteria 4943
134 Ga0097621_100042018 3300006237 Unclassified 3682
135 Ga0097621_100079458 3300006237 Bacteria 2727
136 Ga0068871_100000567 3300006358 Bacteria 25299
137 Ga0068871_100010861 3300006358 Bacteria 6667
138 Ga0068871_100015463 3300006358 Bacteria 5712
139 Ga0068871_100173342 3300006358 Bacteria 1850
140 Ga0075433_10341237 3300006852 Bacteria 1324
141 Ga0075434_100388992 3300006871 Unclassified 1416
142 Ga0068865_100036508 3300006881 Unclassified 3314
143 Ga0068865_100122172 3300006881 Unclassified 1938
144 Ga0075436_100287897 3300006914 Unclassified 1176
145 Ga0075436_100359014 3300006914 Unclassified 1051
146 Ga0097620_100012514 3300006931 Bacteria 8536
147 Ga0097620_100033820 3300006931 Bacteria 5133
148 Ga0097620_100178347 3300006931 Bacteria 2207
149 Ga0097620_100572869 3300006931 Bacteria 1223
150 Ga0075435_100472323 3300007076 Bacteria 1083
151 Ga0099794_10000004 3300007265 Bacteria 134462
152 Ga0105240_10381182 3300009093 Bacteria 1592
153 Ga0111539_10309554 3300009094 Bacteria 1838
154 Ga0105245_10171711 3300009098 Bacteria 2065
155 Ga0105245_10177171 3300009098 Bacteria 2034
156 Ga0105247_10021805 3300009101 Unclassified 3854
157 Ga0114129_10014630 3300009147 Bacteria 11179
158 Ga0105241_10028253 3300009174 Bacteria 4180
159 Ga0105242_10004562 3300009176 Bacteria 10741
160 Ga0105242_10008022 3300009176 Bacteria 8131
161 Ga0105242_10011219 3300009176 Bacteria 6886
162 Ga0105242_10053742 3300009176 Bacteria 3290
163 Ga0105242_10267565 3300009176 Bacteria 1547
164 Ga0105248_10011690 3300009177 Bacteria 9675
165 Ga0105248_10023184 3300009177 Bacteria 6893
166 Ga0105248_10188700 3300009177 Bacteria 2323
167 Ga0105237_10351378 3300009545 Bacteria 1479
168 Ga0105238_10007716 3300009551 Bacteria 10756
169 Ga0105238_10055288 3300009551 Bacteria 3985
170 Ga0105238_10138335 3300009551 Bacteria 2413
171 Ga0105249_10034010 3300009553 Unclassified 4617
172 Ga0105249_10336941 3300009553 Bacteria 1524
173 Ga0105239_10489298 3300010375 Bacteria 1398
174 Ga0105246_10008954 3300011119 Bacteria 6162
175 Ga0105246_10276156 3300011119 Bacteria 1346
176 Ga0157371_10087822 3300013102 Unclassified 2202
177 Ga0157370_10304920 3300013104 Bacteria 1470
178 Ga0157369_10048319 3300013105 Unclassified 4617
179 Ga0157374_10001739 3300013296 Bacteria 18261
180 Ga0157374_10009540 3300013296 Bacteria 8335
181 Ga0157374_10010938 3300013296 Bacteria 7835
182 Ga0157378_10010167 3300013297 Bacteria 8207
183 Ga0157378_10114644 3300013297 Bacteria 2476
184 Ga0157378_10139604 3300013297 Unclassified 2249
185 Ga0157378_10245848 3300013297 Bacteria 1711
186 Ga0157378_10533830 3300013297 Bacteria 1176
187 Ga0163162_10003106 3300013306 Bacteria 15857
188 Ga0163162_10065783 3300013306 Unclassified 3673
189 Ga0163162_10074425 3300013306 Bacteria 3455
190 Ga0163162_10083152 3300013306 Bacteria 3275
191 Ga0163162_10106954 3300013306 Bacteria 2893
192 Ga0163162_10192150 3300013306 Bacteria 2169
193 Ga0157372_10666625 3300013307 Bacteria 1211
194 Ga0157375_10011184 3300013308 Bacteria 7917
195 Ga0157375_10094257 3300013308 Bacteria 3062
196 Ga0157375_10186847 3300013308 Bacteria 2226
197 Ga0163163_10004018 3300014325 Bacteria 12544
198 Ga0163163_10044203 3300014325 Bacteria 4369
199 Ga0163163_10054469 3300014325 Bacteria 3952
200 Ga0163163_10162857 3300014325 Unclassified 2276
201 Ga0157379_10024644 3300014968 Bacteria 5340
202 Ga0157379_10079795 3300014968 Bacteria 2931
203 Ga0157379_10695749 3300014968 Bacteria 954
204 Ga0157376_10031874 3300014969 Bacteria 4226
205 Ga0157376_10061197 3300014969 Bacteria 3164
206 Ga0157376_10063561 3300014969 Bacteria 3110
207 Ga0228598_1022699 3300024227 Bacteria 1234
208 Ga0207666_1003595 3300025271 Bacteria 1910
209 Ga0207673_1002202 3300025290 Bacteria 2201
210 Ga0207697_10006794 3300025315 Bacteria 5145
211 Ga0207656_10029987 3300025321 Bacteria 2244
212 Ga0207682_10081632 3300025893 Unclassified 1387
213 Ga0207692_10011351 3300025898 Bacteria 3787
214 Ga0207692_10091002 3300025898 Bacteria 1654
215 Ga0207642_10076732 3300025899 Bacteria 1609
216 Ga0207680_10105494 3300025903 Bacteria 1818
217 Ga0207685_10019038 3300025905 Bacteria 2254
218 Ga0207699_10247050 3300025906 Bacteria 1228
219 Ga0207645_10044065 3300025907 Bacteria 2855
220 Ga0207643_10002581 3300025908 Bacteria 9800
221 Ga0207684_10000017 3300025910 Bacteria 385006
222 Ga0207684_10025201 3300025910 Bacteria 5069
223 Ga0207684_10038580 3300025910 Bacteria 4053
224 Ga0207707_10004610 3300025912 Bacteria 12109
225 Ga0207707_10004739 3300025912 Bacteria 11931
226 Ga0207707_10209345 3300025912 Bacteria 1699
227 Ga0207695_10425429 3300025913 Bacteria 1212
228 Ga0207671_10021551 3300025914 Unclassified 4885
229 Ga0207693_10000143 3300025915 Bacteria 65412
230 Ga0207693_10003412 3300025915 Bacteria 13561
231 Ga0207693_10024994 3300025915 Unclassified 4737
232 Ga0207693_10029842 3300025915 Bacteria 4303
233 Ga0207693_10037191 3300025915 Unclassified 3837
234 Ga0207663_10070207 3300025916 Bacteria 2256
235 Ga0207663_10079007 3300025916 Unclassified 2147
236 Ga0207657_10138809 3300025919 Unclassified 1987
237 Ga0207652_10081551 3300025921 Bacteria 2830
238 Ga0207646_10001706 3300025922 Bacteria 26669
239 Ga0207646_10005421 3300025922 Bacteria 13417
240 Ga0207646_10008284 3300025922 Bacteria 10435
241 Ga0207646_10019508 3300025922 Bacteria 6301
242 Ga0207646_10120613 3300025922 Bacteria 2355
243 Ga0207646_10207045 3300025922 Bacteria 1772
244 Ga0207694_10113975 3300025924 Bacteria 2153
245 Ga0207650_10007015 3300025925 Bacteria 7685
246 Ga0207659_10002533 3300025926 Bacteria 10880
247 Ga0207659_10138583 3300025926 Bacteria 1886
248 Ga0207687_10124540 3300025927 Bacteria 1932
249 Ga0207687_10287966 3300025927 Unclassified 1319
250 Ga0207700_10000337 3300025928 Bacteria 27629
251 Ga0207700_10002339 3300025928 Bacteria 10874
252 Ga0207700_10332606 3300025928 Bacteria 1319
253 Ga0207644_10176469 3300025931 Bacteria 1672
254 Ga0207690_10256781 3300025932 Bacteria 1352
255 Ga0207706_10007692 3300025933 Bacteria 9950
256 Ga0207706_10013429 3300025933 Bacteria 7444
257 Ga0207706_10017031 3300025933 Bacteria 6556
258 Ga0207706_10073527 3300025933 Bacteria 3006
259 Ga0207706_10111800 3300025933 Bacteria 2403
260 Ga0207686_10014549 3300025934 Bacteria 4383
261 Ga0207686_10023726 3300025934 Bacteria 3545
262 Ga0207686_10275037 3300025934 Bacteria 1241
263 Ga0207669_10024951 3300025937 Bacteria 3222
264 Ga0207704_10048548 3300025938 Bacteria 2546
265 Ga0207704_10088553 3300025938 Bacteria 2026
266 Ga0207704_10127073 3300025938 Unclassified 1757
267 Ga0207704_10151674 3300025938 Bacteria 1636
268 Ga0207665_10005351 3300025939 Bacteria 8572
269 Ga0207665_10010455 3300025939 Bacteria 6098
270 Ga0207665_10045341 3300025939 Bacteria 2944
271 Ga0207665_10079220 3300025939 Unclassified 2258
272 Ga0207665_10105829 3300025939 Bacteria 1971
273 Ga0207691_10000618 3300025940 Bacteria 35297
274 Ga0207691_10107981 3300025940 Bacteria 2477
275 Ga0207711_10026807 3300025941 Bacteria 4837
276 Ga0207711_10034923 3300025941 Unclassified 4259
277 Ga0207711_10093740 3300025941 Bacteria 2645
278 Ga0207689_10010028 3300025942 Bacteria 8168
279 Ga0207689_10034687 3300025942 Bacteria 4190
280 Ga0207661_10173898 3300025944 Bacteria 1876
281 Ga0207679_10439791 3300025945 Bacteria 1155
282 Ga0207667_10044414 3300025949 Unclassified 4708
283 Ga0207651_10146211 3300025960 Bacteria 1833
284 Ga0207651_10153083 3300025960 Bacteria 1798
285 Ga0207712_10049194 3300025961 Unclassified 2936
286 Ga0207712_10113452 3300025961 Bacteria 2037
287 Ga0207668_10014111 3300025972 Bacteria 4940
288 Ga0207668_10224487 3300025972 Bacteria 1511
289 Ga0207658_10015027 3300025986 Bacteria 5308
290 Ga0207658_10132365 3300025986 Bacteria 2006
291 Ga0207658_10287389 3300025986 Bacteria 1412
292 Ga0207658_10453251 3300025986 Bacteria 1136
293 Ga0207677_10005480 3300026023 Bacteria 6888
294 Ga0207677_10007528 3300026023 Bacteria 6035
295 Ga0207677_10021638 3300026023 Bacteria 3934
296 Ga0207677_10320038 3300026023 Bacteria 1289
297 Ga0207703_10010543 3300026035 Bacteria 7227
298 Ga0207678_10006473 3300026067 Bacteria 10392
299 Ga0207678_10265972 3300026067 Bacteria 1470
300 Ga0207702_10242667 3300026078 Bacteria 1689
301 Ga0207641_10024156 3300026088 Bacteria 5010
302 Ga0207641_10140549 3300026088 Bacteria 2178
303 Ga0207641_10161018 3300026088 Bacteria 2040
304 Ga0207641_10227955 3300026088 Bacteria 1730
305 Ga0207648_10019549 3300026089 Bacteria 6113
306 Ga0207648_10052764 3300026089 Bacteria 3555
307 Ga0207676_10007019 3300026095 Bacteria 7978
308 Ga0207676_10203702 3300026095 Bacteria 1750
309 Ga0207674_10001335 3300026116 Bacteria 31992
310 Ga0207675_100001866 3300026118 Bacteria 21100
311 Ga0207683_10035580 3300026121 Bacteria 4332
312 Ga0207683_10084187 3300026121 Bacteria 2827
313 Ga0207683_10122313 3300026121 Bacteria 2337
314 Ga0207683_10166474 3300026121 Bacteria 1995
315 Ga0268266_10004515 3300028379 Bacteria 13297
316 Ga0268266_10333471 3300028379 Bacteria 1422
317 Ga0268265_10091236 3300028380 Unclassified 2436
318 Ga0268264_10011845 3300028381 Bacteria 7186
319 Ga0268264_10478138 3300028381 Bacteria 1211
320 Ga0265338_10039805 3300028800 Unclassified 4426
321 Ga0265338_10068350 3300028800 Bacteria 3061
322 Ga0265324_10033541 3300029957 Bacteria 1791
323 Ga0265762_1000192 3300030760 Bacteria 9683
324 Ga0265762_1010265 3300030760 Unclassified 1672
325 Ga0265765_1002118 3300030879 Unclassified 1896
326 Ga0265760_10019397 3300031090 Bacteria 1959
327 Ga0265328_10015540 3300031239 Unclassified 2979
328 Ga0265325_10184054 3300031241 Bacteria 971
329 Ga0265339_10151357 3300031249 Bacteria 1173
330 Ga0265316_10044405 3300031344 Unclassified 3535
331 Ga0373926_0049738 3300035083 Bacteria 1510
332 Ga0373923_0034350 3300035111 Bacteria 2058
333 Ga0373923_0096566 3300035111 Bacteria 1299
334 Ga0373936_0013080 3300035113 Bacteria 3166
335 Ga0373941_0025672 3300035115 Bacteria 1704
336 Ga0373954_0072159 3300035118 Bacteria 1642
337 Ga0373943_0014107 3300035170 Bacteria 3614
338 Ga0373943_0043250 3300035170 Bacteria 2187
339 Ga0373955_0080870 3300035172 Bacteria 1836
340 Ga0373935_0041092 3300035692 Bacteria 2904
341 Ga0373935_0277336 3300035692 Bacteria 1180
342 Ga0373927_0248928 3300035695 Bacteria 1168
343 Ga0373933_0070864 3300035724 Bacteria 2121
344 Ga0373947_0026939 3300035725 Bacteria 3362
345 Ga0373947_0093934 3300035725 Bacteria 1875
346 Ga0373937_0053512 3300036401 Bacteria 3703
347 Ga0373925_0171012 3300037068 Unclassified 1716
348 Ga0373925_0277643 3300037068 Bacteria 1349
349 Ga0395901_0044645 3300038443 Bacteria 4597
350 Ga0436365_1609334 3300039437 Bacteria 3238
351 Ga0451576_0368581 3300045051 Unclassified 1505
352 Ga0495603_0113720 3300046455 Unclassified 1578
353 Ga0495629_0025583 3300046459 Bacteria 4194
354 Ga0495629_0138112 3300046459 Bacteria 1697
355 Ga0495580_0000019 3300046472 Bacteria 91862
356 Ga0495580_0000561 3300046472 Bacteria 31371
357 Ga0495580_0178820 3300046472 Unclassified 1465
358 Ga0495582_0052090 3300046473 Bacteria 2257
359 Ga0495582_0099134 3300046473 Bacteria 1630
360 Ga0495639_0032986 3300046475 Bacteria 2311
361 Ga0495662_0118946 3300046476 Unclassified 1296
362 Ga0495594_0058050 3300046499 Bacteria 2137
363 Ga0495630_0005803 3300046517 Bacteria 8721
364 Ga0495645_0040786 3300046543 Bacteria 3385
365 Ga0495622_0088321 3300046557 Unclassified 1425
366 Ga0495667_0069306 3300046559 Bacteria 2302
367 Ga0495668_0072073 3300046616 Unclassified 1898
368 Ga0495599_0008519 3300046678 Bacteria 6239
369 Ga0495599_0050278 3300046678 Bacteria 2612
370 Ga0495599_0064389 3300046678 Bacteria 2290
371 Ga0495646_0010623 3300046680 Bacteria 5848
372 Ga0495669_0007619 3300046684 Bacteria 4542
373 Ga0495669_0203134 3300046684 Unclassified 947
374 Ga0495613_0005748 3300046689 Bacteria 9289
375 Ga0495613_0119416 3300046689 Bacteria 1894
376 Ga0495624_0100709 3300046690 Bacteria 1779
377 Ga0495624_0167663 3300046690 Bacteria 1340
378 Ga0495636_0130196 3300047318 Unclassified 1119
379 Ga0495676_0206154 3300047321 Bacteria 1363
380 Ga0495680_0112759 3300047322 Bacteria 2014
381 Ga0495675_0021296 3300047444 Bacteria 4128
382 Ga0495677_0013675 3300047445 Unclassified 2954
383 Ga0495684_0053093 3300047471 Bacteria 3092
384 Ga0495614_0114423 3300048089 Bacteria 1186
385 Ga0496100_0037265 3300048903 Bacteria 3073
386 Ga0496101_0380106 3300048904 Unclassified 1111
387 Ga0496102_0044366 3300048905 Bacteria 4035
388 Ga0496102_0061135 3300048905 Unclassified 3446
389 Ga0496103_0220173 3300048906 Unclassified 1221
390 Ga0496104_0215709 3300048907 Bacteria 1831
391 Ga0496104_0219700 3300048907 Bacteria 1812
392 Ga0496105_0049647 3300048908 Bacteria 3465
393 Ga0496105_0089617 3300048908 Bacteria 2541
394 Ga0496105_0361757 3300048908 Bacteria 1157
395 Ga0496108_0069409 3300048911 Bacteria 2974
396 Ga0496108_0150999 3300048911 Bacteria 2005
397 Ga0496109_0129299 3300048912 Bacteria 2357
398 Ga0496112_0039975 3300048915 Bacteria 4585
399 Ga0496112_0366507 3300048915 Bacteria 1382
400 Ga0496114_0052343 3300048917 Bacteria 3402
401 Ga0496114_0117718 3300048917 Bacteria 2282
402 Ga0496115_0002360 3300048918 Bacteria 13541
403 Ga0496115_0019536 3300048918 Bacteria 5215
404 Ga0496115_0021775 3300048918 Bacteria 4955
405 Ga0496115_0401546 3300048918 Bacteria 1112
406 nmdc:mga05p37_172182_c1 3300050507 Bacteria 2640
407 nmdc:mga0n895_130670_c1 3300050512 Bacteria 2536
408 nmdc:mga0n895_230246_c1 3300050512 Bacteria 1881
409 nmdc:mga0rr50_130097_c1 3300050513 Bacteria 2014
410 nmdc:mga08x19_298317_c1 3300050514 Unclassified 1119
411 nmdc:mga0a205_4362_c2 3300050515 Bacteria 7732
412 nmdc:mga0a205_492807_c1 3300050515 Bacteria 1083
413 Ga0495601_0227723 3300053077 Bacteria 1218
414 Ga0495601_0330807 3300053077 Unclassified 992
415 Ga0495612_0068027 3300053078 Bacteria 1482
416 Ga0495619_0202633 3300053085 Bacteria 1374
417 nmdc:mga08y16_88216_c1
418 SwRhRL3b_contig_2631278
419 Ga0065715_10007818
420 Ga0070683_100091623
421 Ga0070690_100039398
422 Ga0070670_100005143
423 Ga0070670_100183021
424 Ga0070666_10001275
425 Ga0070666_10040111
426 Ga0070666_10141530
427 Ga0070680_100391905
428 Ga0070682_100016821
429 Ga0068868_100002283
430 Ga0068868_100015745
431 Ga0068868_100061107
432 Ga0070660_100128876
433 Ga0070661_100037688
434 Ga0070668_100011901
435 Ga0070669_100244598
436 Ga0070675_100115920
437 Ga0070671_100212295
438 Ga0070671_100281401
439 Ga0070674_100011099
440 Ga0070674_100080145
441 Ga0070673_100070957
442 Ga0070688_100102049
443 Ga0070688_100192802
444 Ga0070667_100005486
445 Ga0070667_100009954
446 Ga0070667_100022128
447 Ga0070709_10005693
448 Ga0070709_10015236
449 Ga0070709_10028521
450 Ga0070709_10050355
451 Ga0070709_10092505
452 Ga0070714_100219492
453 Ga0070713_100000057
454 Ga0070713_100100819
455 Ga0070713_100195487
456 Ga0070710_10012755
457 Ga0070711_100000318
458 Ga0070711_100028078
459 Ga0070711_100039690
460 Ga0070694_100029478
461 Ga0070694_100108560
462 Ga0070708_100201477
463 Ga0070708_100234285
464 Ga0070678_100122763
465 Ga0070678_100213906
466 Ga0070678_100244937
467 Ga0070662_100032618
468 Ga0070662_100043261
469 Ga0070662_100066704
470 Ga0070662_100234462
471 Ga0070681_10010391
472 Ga0070681_10011787
473 Ga0070681_10384298
474 Ga0068867_100007039
475 Ga0068867_100083882
476 Ga0070685_10133902
477 Ga0070706_100035632
478 Ga0070706_100042637
479 Ga0070707_100003356
480 Ga0070707_100009766
481 Ga0070707_100018493
482 Ga0070707_100019613
483 Ga0070707_100036382
484 Ga0070707_100238307
485 Ga0070707_100262730
486 Ga0070707_100383784
487 Ga0070707_100405111
488 Ga0070707_100516539
489 Ga0070698_100022546
490 Ga0070699_100109370
491 Ga0070699_100151187
492 Ga0070699_100176111
493 Ga0070679_100073415
494 Ga0070679_100251913
495 Ga0070684_100026434
496 Ga0070697_100051207
497 Ga0070697_100053099
498 Ga0070697_100085291
499 Ga0070697_100157871
500 Ga0070697_100174283
501 Ga0070672_100128592
502 Ga0070672_100240050
503 Ga0070686_100262932
504 Ga0070696_100019559
505 Ga0070693_100061170
506 Ga0070665_100044142
507 Ga0070665_100217204
508 Ga0070665_100219624
509 Ga0070704_100166634
510 Ga0068854_100009044
511 Ga0068856_100056734
512 Ga0068856_100297302
513 Ga0068859_100012514
514 Ga0068859_100033821
515 Ga0068859_100178336
516 Ga0068859_100572957
517 Ga0068864_100008500
518 Ga0068864_100077915
519 Ga0068864_100144743
520 Ga0068864_100374874
521 Ga0068866_10035925
522 Ga0068870_10183478
523 Ga0068863_100018442
524 Ga0068863_100132244
525 Ga0068863_100204089
526 Ga0068863_100311017
527 Ga0068863_100331483
528 Ga0068858_100018956
529 Ga0068858_100033182
530 Ga0068860_100016640
531 Ga0068860_100089432
532 Ga0068860_100094555
533 Ga0070717_10007132
534 Ga0070717_10040026
535 Ga0070717_10080210
536 Ga0070717_10098423
537 Ga0070717_10152232
538 Ga0070717_10155463
539 Ga0070717_10436773
540 Ga0070715_10027447
541 Ga0070716_100004230
542 Ga0070716_100021305
543 Ga0070716_100231263
544 Ga0070712_100000055
545 Ga0070712_100018135
546 Ga0070712_100193124
547 Ga0070712_100228509
548 Ga0097621_100001702
549 Ga0097621_100022000
550 Ga0097621_100042018
551 Ga0097621_100079458
552 Ga0068871_100000567
553 Ga0068871_100010861
554 Ga0068871_100015463
555 Ga0068871_100173342
556 Ga0075433_10341237
557 Ga0075434_100388992
558 Ga0068865_100036508
559 Ga0068865_100122172
560 Ga0075436_100287897
561 Ga0075436_100359014
562 Ga0097620_100012514
563 Ga0097620_100033820
564 Ga0097620_100178347
565 Ga0097620_100572869
566 Ga0075435_100472323
567 Ga0099794_10000004
568 Ga0105240_10381182
569 Ga0111539_10309554
570 Ga0105245_10171711
571 Ga0105245_10177171
572 Ga0105247_10021805
573 Ga0114129_10014630
574 Ga0105241_10028253
575 Ga0105242_10004562
576 Ga0105242_10008022
577 Ga0105242_10011219
578 Ga0105242_10053742
579 Ga0105242_10267565
580 Ga0105248_10011690
581 Ga0105248_10023184
582 Ga0105248_10188700
583 Ga0105237_10351378
584 Ga0105238_10007716
585 Ga0105238_10055288
586 Ga0105238_10138335
587 Ga0105249_10034010
588 Ga0105249_10336941
589 Ga0105239_10489298
590 Ga0105246_10008954
591 Ga0105246_10276156
592 Ga0157371_10087822
593 Ga0157370_10304920
594 Ga0157369_10048319
595 Ga0157374_10001739
596 Ga0157374_10009540
597 Ga0157374_10010938
598 Ga0157378_10010167
599 Ga0157378_10114644
600 Ga0157378_10139604
601 Ga0157378_10245848
602 Ga0157378_10533830
603 Ga0163162_10003106
604 Ga0163162_10065783
605 Ga0163162_10074425
606 Ga0163162_10083152
607 Ga0163162_10106954
608 Ga0163162_10192150
609 Ga0157372_10666625
610 Ga0157375_10011184
611 Ga0157375_10094257
612 Ga0157375_10186847
613 Ga0163163_10004018
614 Ga0163163_10044203
615 Ga0163163_10054469
616 Ga0163163_10162857
617 Ga0157379_10024644
618 Ga0157379_10079795
619 Ga0157379_10695749
620 Ga0157376_10031874
621 Ga0157376_10061197
622 Ga0157376_10063561
623 Ga0228598_1022699
624 Ga0207666_1003595
625 Ga0207673_1002202
626 Ga0207697_10006794
627 Ga0207656_10029987
628 Ga0207682_10081632
629 Ga0207692_10011351
630 Ga0207692_10091002
631 Ga0207642_10076732
632 Ga0207680_10105494
633 Ga0207685_10019038
634 Ga0207699_10247050
635 Ga0207645_10044065
636 Ga0207643_10002581
637 Ga0207684_10000017
638 Ga0207684_10025201
639 Ga0207684_10038580
640 Ga0207707_10004610
641 Ga0207707_10004739
642 Ga0207707_10209345
643 Ga0207695_10425429
644 Ga0207671_10021551
645 Ga0207693_10000143
646 Ga0207693_10003412
647 Ga0207693_10024994
648 Ga0207693_10029842
649 Ga0207693_10037191
650 Ga0207663_10070207
651 Ga0207663_10079007
652 Ga0207657_10138809
653 Ga0207652_10081551
654 Ga0207646_10001706
655 Ga0207646_10005421
656 Ga0207646_10008284
657 Ga0207646_10019508
658 Ga0207646_10120613
659 Ga0207646_10207045
660 Ga0207694_10113975
661 Ga0207650_10007015
662 Ga0207659_10002533
663 Ga0207659_10138583
664 Ga0207687_10124540
665 Ga0207687_10287966
666 Ga0207700_10000337
667 Ga0207700_10002339
668 Ga0207700_10332606
669 Ga0207644_10176469
670 Ga0207690_10256781
671 Ga0207706_10007692
672 Ga0207706_10013429
673 Ga0207706_10017031
674 Ga0207706_10073527
675 Ga0207706_10111800
676 Ga0207686_10014549
677 Ga0207686_10023726
678 Ga0207686_10275037
679 Ga0207669_10024951
680 Ga0207704_10048548
681 Ga0207704_10088553
682 Ga0207704_10127073
683 Ga0207704_10151674
684 Ga0207665_10005351
685 Ga0207665_10010455
686 Ga0207665_10045341
687 Ga0207665_10079220
688 Ga0207665_10105829
689 Ga0207691_10000618
690 Ga0207691_10107981
691 Ga0207711_10026807
692 Ga0207711_10034923
693 Ga0207711_10093740
694 Ga0207689_10010028
695 Ga0207689_10034687
696 Ga0207661_10173898
697 Ga0207679_10439791
698 Ga0207667_10044414
699 Ga0207651_10146211
700 Ga0207651_10153083
701 Ga0207712_10049194
702 Ga0207712_10113452
703 Ga0207668_10014111
704 Ga0207668_10224487
705 Ga0207658_10015027
706 Ga0207658_10132365
707 Ga0207658_10287389
708 Ga0207658_10453251
709 Ga0207677_10005480
710 Ga0207677_10007528
711 Ga0207677_10021638
712 Ga0207677_10320038
713 Ga0207703_10010543
714 Ga0207678_10006473
715 Ga0207678_10265972
716 Ga0207702_10242667
717 Ga0207641_10024156
718 Ga0207641_10140549
719 Ga0207641_10161018
720 Ga0207641_10227955
721 Ga0207648_10019549
722 Ga0207648_10052764
723 Ga0207676_10007019
724 Ga0207676_10203702
725 Ga0207674_10001335
726 Ga0207675_100001866
727 Ga0207683_10035580
728 Ga0207683_10084187
729 Ga0207683_10122313
730 Ga0207683_10166474
731 Ga0268266_10004515
732 Ga0268266_10333471
733 Ga0268265_10091236
734 Ga0268264_10011845
735 Ga0268264_10478138
736 Ga0265338_10039805
737 Ga0265338_10068350
738 Ga0265324_10033541
739 Ga0265762_1000192
740 Ga0265762_1010265
741 Ga0265765_1002118
742 Ga0265760_10019397
743 Ga0265328_10015540
744 Ga0265325_10184054
745 Ga0265339_10151357
746 Ga0265316_10044405
747 Ga0373926_0049738
748 Ga0373923_0034350
749 Ga0373923_0096566
750 Ga0373936_0013080
751 Ga0373941_0025672
752 Ga0373954_0072159
753 Ga0373943_0014107
754 Ga0373943_0043250
755 Ga0373955_0080870
756 Ga0373935_0041092
757 Ga0373935_0277336
758 Ga0373927_0248928
759 Ga0373933_0070864
760 Ga0373947_0026939
761 Ga0373947_0093934
762 Ga0373937_0053512
763 Ga0373925_0171012
764 Ga0373925_0277643
765 Ga0395901_0044645
766 Ga0436365_1609334
767 Ga0451576_0368581
768 Ga0495603_0113720
769 Ga0495629_0025583
770 Ga0495629_0138112
771 Ga0495580_0000019
772 Ga0495580_0000561
773 Ga0495580_0178820
774 Ga0495582_0052090
775 Ga0495582_0099134
776 Ga0495639_0032986
777 Ga0495662_0118946
778 Ga0495594_0058050
779 Ga0495630_0005803
780 Ga0495645_0040786
781 Ga0495622_0088321
782 Ga0495667_0069306
783 Ga0495668_0072073
784 Ga0495599_0008519
785 Ga0495599_0050278
786 Ga0495599_0064389
787 Ga0495646_0010623
788 Ga0495669_0007619
789 Ga0495669_0203134
790 Ga0495613_0005748
791 Ga0495613_0119416
792 Ga0495624_0100709
793 Ga0495624_0167663
794 Ga0495636_0130196
795 Ga0495676_0206154
796 Ga0495680_0112759
797 Ga0495675_0021296
798 Ga0495677_0013675
799 Ga0495684_0053093
800 Ga0495614_0114423
801 Ga0496100_0037265
802 Ga0496101_0380106
803 Ga0496102_0044366
804 Ga0496102_0061135
805 Ga0496103_0220173
806 Ga0496104_0215709
807 Ga0496104_0219700
808 Ga0496105_0049647
809 Ga0496105_0089617
810 Ga0496105_0361757
811 Ga0496108_0069409
812 Ga0496108_0150999
813 Ga0496109_0129299
814 Ga0496112_0039975
815 Ga0496112_0366507
816 Ga0496114_0052343
817 Ga0496114_0117718
818 Ga0496115_0002360
819 Ga0496115_0019536
820 Ga0496115_0021775
821 Ga0496115_0401546
822 nmdc:mga05p37_172182_c1
823 nmdc:mga0n895_130670_c1
824 nmdc:mga0n895_230246_c1
825 nmdc:mga0rr50_130097_c1
826 nmdc:mga08x19_298317_c1
827 nmdc:mga0a205_4362_c2
828 nmdc:mga0a205_492807_c1
829 Ga0495601_0227723
830 Ga0495601_0330807
831 Ga0495612_0068027
832 Ga0495619_0202633

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

94

333

0.91

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

96

339

0.66

Structural Annotation

Top 5 Hits

ID Description Score Start End
7jqy-assembly1.cif.gz_B crystal structure of cfl1-d123s from burkholderia cenocepacia 0.9553 23 294
7jqx-assembly1.cif.gz_A crystal structure of cfl1 wild-type from burkholderia cenocepacia 0.9549 23 294
3pi6-assembly2.cif.gz_D crystal structure of the cftr inhibitory factor cif with the h177y mutation 0.9354 23 294
3kda-assembly2.cif.gz_B crystal structure of the cftr inhibitory factor cif with the h269a mutation 0.935 23 294
4dmc-assembly2.cif.gz_D crystal structure of the cftr inhibitory factor cif with the e153q mutation 0.9343 23 294
ID Description Score Start End Superfamily
3kd2B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9214 23 294 3.40.50.1820
4mebB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9153 20 294 3.40.50.1820
4bb0A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9038 23 295 3.40.50.1820
af_A0A0R0KMM0_1_93_3.40.50.12270 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8942 21 107 3.40.50.12270
af_P96811_2_293_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8941 21 294 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A2V6J615-F1-model_v4 Alpha/beta hydrolase 1 71 295 GO:0016020
GO:0046464
GO:0047372
AF-A0A2V6J615-F1-model_v4 Alpha/beta hydrolase 0.9956 71 295 GO:0016020
GO:0046464
GO:0047372
AF-A0A845HET2-F1-model_v4 Alpha/beta fold hydrolase 0.9926 51 295 GO:0016020
GO:0046464
GO:0047372
AF-A0A259J300-F1-model_v4 Alpha/beta hydrolase 0.9913 100 294 GO:0016787
AF-A0A2V5PXH1-F1-model_v4 Alpha/beta hydrolase 0.9911 179 295 GO:0016787

Map