F438854

General Info

Members Datasets Scaffolds Average Seq Length
416 312 832 192

Family's Representative Sequence

Representative Sequence 3300035691|Ga0373931_0310015|Ga0373931_0310015_12_692
Length 226
Sequence LQIRRRPAAAQRQPLELGAPFVLHLRCRATMSRNRLEAFSDGVIAILITIMVLELKVPHGGDWDALFERRHEFSAYVLSFVYLGIYWNNHHHMLHTVTRVTGSMLWANLHLLFWLSLVPFTTAWVGENETSSPPAVVYGVVLVCSAIAWTILQTRIVRVLGPDSTLARAVGRDNKGKASIACYVLGIAGSFAHPMVGNAFYALVAVIWLVPDRRIEQRLAEHAGEP

Samples

Sample ID Description Type Environment
1 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
2 3300001430 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 Metagenome Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
8 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
9 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
10 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
11 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
12 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
13 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
14 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
15 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
16 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
17 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
18 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
21 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
22 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
25 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
26 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
27 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
32 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
35 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
36 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
37 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
38 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
39 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
40 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
41 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
42 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
43 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
44 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
45 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
46 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
47 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
48 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
49 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
50 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
51 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
52 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
53 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
54 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
55 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
56 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
57 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
58 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
59 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
60 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
61 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
62 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
63 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
64 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
65 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
66 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
67 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
68 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
69 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
70 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
71 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
72 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
73 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
74 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
75 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
76 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
77 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
78 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
79 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
80 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
81 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
82 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
83 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
84 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
85 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
86 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
87 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
88 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
89 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
91 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
92 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
93 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
94 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
96 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
97 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
98 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
100 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
101 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
102 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
103 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
104 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
105 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
106 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
107 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
108 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
109 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
110 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
111 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
112 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
113 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
114 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
115 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
116 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
117 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
118 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
119 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
120 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
121 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
122 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
123 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
125 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
127 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
187 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
188 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
191 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
192 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
193 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
194 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
195 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
196 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
197 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
198 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
199 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
200 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
201 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
202 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
203 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
204 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
205 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
206 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
207 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
208 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
209 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
210 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
211 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
212 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
213 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
214 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
215 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
216 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
217 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
218 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
219 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
220 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
221 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
222 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
223 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
224 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
225 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
226 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
227 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
228 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
229 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
230 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
231 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
232 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
233 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
234 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
235 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
236 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
237 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
238 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
239 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
240 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
241 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
242 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
243 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
244 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
245 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
246 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
247 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
248 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
249 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
250 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
251 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
252 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
253 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
254 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
255 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
256 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
257 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
258 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
259 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
260 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
261 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
262 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
263 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
264 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
265 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
266 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
267 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
268 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
269 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
270 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
271 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
272 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
273 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
274 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
275 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
276 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
278 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
280 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
284 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
285 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
286 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
287 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
288 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
289 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
290 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
291 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
292 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
293 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
294 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
295 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
296 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
297 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
298 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
299 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
300 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
301 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
302 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
303 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
304 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
305 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
306 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
307 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
308 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
309 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
310 2738541300 Massilia sp. GV016 Isolate Unclassified
311 2738543018 Massilia sp. GV045 Isolate Unclassified
312 2738543030 Massilia sp. GV097 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.8
Metatranscriptomes 0.24
Isolates 0.96

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.92
Nodule 0
Rhizoplane 4.09
Rhizosphere 91.59
Stem 0
Stem Tuber 0
Unclassified 0.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373931_0310015 3300035691 Bacteria 977
2 JGI24032J14994_100699 3300001430 Bacteria 1714
3 JGI24746J21847_1000629 3300001977 Bacteria 5399
4 JGI24747J21853_1000179 3300001978 Bacteria 3251
5 JGI24739J22299_10001373 3300001989 Bacteria 9140
6 JGI24737J22298_10000073 3300001990 Bacteria 29633
7 JGI24743J22301_10010102 3300001991 Bacteria 1681
8 JGI24750J21931_1000377 3300002070 Bacteria 7558
9 JGI24745J21846_1001800 3300002073 Bacteria 2120
10 JGI24738J21930_10002341 3300002075 Bacteria 4998
11 JGI24749J21850_1000689 3300002076 Bacteria 4866
12 JGI24744J21845_10001417 3300002077 Bacteria 4757
13 JGI24035J26624_1000204 3300002126 Bacteria 5367
14 JGI24034J26672_10001497 3300002239 Bacteria 3105
15 JGI24742J22300_10000032 3300002244 Bacteria 21385
16 rootH1_10124254 3300003323 Bacteria 1373
17 Ga0065712_10114459 3300005290 Bacteria 1766
18 Ga0065715_10094020 3300005293 Bacteria 4469
19 Ga0070658_10021392 3300005327 Bacteria 5184
20 Ga0070676_10000251 3300005328 Bacteria 23359
21 Ga0070683_100002231 3300005329 Bacteria 15353
22 Ga0070683_100519430 3300005329 Bacteria 1138
23 Ga0070690_100000588 3300005330 Bacteria 18282
24 Ga0070670_100001768 3300005331 Bacteria 17581
25 Ga0070670_100015089 3300005331 Bacteria 6630
26 Ga0070677_10000076 3300005333 Bacteria 31338
27 Ga0068869_100008854 3300005334 Bacteria 6512
28 Ga0070680_100000333 3300005336 Bacteria 31571
29 Ga0070680_100031285 3300005336 Bacteria 4278
30 Ga0070682_100000285 3300005337 Bacteria 36134
31 Ga0068868_100049057 3300005338 Bacteria 3313
32 Ga0070660_100000474 3300005339 Bacteria 26843
33 Ga0070689_100000252 3300005340 Bacteria 31157
34 Ga0070689_100010095 3300005340 Bacteria 6722
35 Ga0070691_10000476 3300005341 Bacteria 14963
36 Ga0070687_100000185 3300005343 Bacteria 21632
37 Ga0070661_100005765 3300005344 Bacteria 8524
38 Ga0070692_10000127 3300005345 Bacteria 17980
39 Ga0070668_100001035 3300005347 Bacteria 19528
40 Ga0070669_100002096 3300005353 Bacteria 14426
41 Ga0070675_100008366 3300005354 Bacteria 8026
42 Ga0070675_100357012 3300005354 Bacteria 1297
43 Ga0070675_101221578 3300005354 Bacteria 692
44 Ga0070671_100001132 3300005355 Bacteria 19809
45 Ga0070671_100003236 3300005355 Bacteria 12696
46 Ga0070674_100000240 3300005356 Bacteria 27228
47 Ga0070673_100000666 3300005364 Bacteria 18932
48 Ga0070673_100430796 3300005364 Bacteria 1184
49 Ga0070688_100000162 3300005365 Bacteria 35811
50 Ga0070659_100000720 3300005366 Bacteria 24009
51 Ga0070667_100001046 3300005367 Bacteria 25228
52 Ga0070667_100380665 3300005367 Bacteria 1282
53 Ga0070667_100431050 3300005367 Bacteria 1203
54 Ga0070709_10421001 3300005434 Bacteria 1001
55 Ga0070713_100017393 3300005436 Bacteria 5436
56 Ga0070713_100076779 3300005436 Bacteria 2838
57 Ga0070713_100228193 3300005436 Bacteria 1692
58 Ga0070701_10004311 3300005438 Bacteria 5743
59 Ga0070705_100000321 3300005440 Bacteria 28395
60 Ga0070700_100011814 3300005441 Bacteria 4848
61 Ga0070694_100000554 3300005444 Bacteria 20566
62 Ga0070708_100036023 3300005445 Bacteria 4314
63 Ga0070663_100004739 3300005455 Bacteria 8026
64 Ga0070678_100000228 3300005456 Bacteria 25430
65 Ga0070678_101084065 3300005456 Bacteria 739
66 Ga0070662_100001178 3300005457 Bacteria 16047
67 Ga0070681_10000446 3300005458 Bacteria 33708
68 Ga0070681_10182963 3300005458 Bacteria 2017
69 Ga0068867_100001229 3300005459 Bacteria 17655
70 Ga0068867_100953207 3300005459 Bacteria 775
71 Ga0070685_10000768 3300005466 Bacteria 17443
72 Ga0070698_100349250 3300005471 Bacteria 1411
73 Ga0070699_100063033 3300005518 Bacteria 3214
74 Ga0070679_100001839 3300005530 Bacteria 19098
75 Ga0070679_100038079 3300005530 Bacteria 4780
76 Ga0070679_100100722 3300005530 Bacteria 2875
77 Ga0070684_100000411 3300005535 Bacteria 29347
78 Ga0068853_100019479 3300005539 Bacteria 5625
79 Ga0068853_100397625 3300005539 Bacteria 1289
80 Ga0070672_100001539 3300005543 Bacteria 14279
81 Ga0070686_100000379 3300005544 Bacteria 28370
82 Ga0070686_100521827 3300005544 Bacteria 925
83 Ga0070695_100000294 3300005545 Bacteria 25143
84 Ga0070696_100000594 3300005546 Bacteria 23147
85 Ga0070693_100000031 3300005547 Bacteria 53010
86 Ga0070665_100123538 3300005548 Bacteria 2591
87 Ga0070665_100148993 3300005548 Bacteria 2343
88 Ga0070704_100000481 3300005549 Bacteria 18891
89 Ga0068855_100043684 3300005563 Bacteria 5307
90 Ga0068855_100057969 3300005563 Bacteria 4538
91 Ga0070664_100000874 3300005564 Bacteria 23359
92 Ga0068857_100000249 3300005577 Bacteria 36056
93 Ga0068857_100018116 3300005577 Bacteria 6177
94 Ga0068854_100000146 3300005578 Bacteria 49106
95 Ga0068854_100041888 3300005578 Bacteria 3238
96 Ga0068856_100001251 3300005614 Bacteria 26705
97 Ga0068856_100952472 3300005614 Bacteria 877
98 Ga0070702_100000134 3300005615 Bacteria 22670
99 Ga0068852_100002982 3300005616 Bacteria 11760
100 Ga0068852_100563204 3300005616 Bacteria 1141
101 Ga0068859_100002043 3300005617 Bacteria 20614
102 Ga0068859_100008082 3300005617 Bacteria 10667
103 Ga0068864_100000674 3300005618 Bacteria 28538
104 Ga0068866_10000348 3300005718 Bacteria 21747
105 Ga0068861_100000958 3300005719 Bacteria 17568
106 Ga0068861_100210377 3300005719 Bacteria 1638
107 Ga0068851_10039298 3300005834 Bacteria 2376
108 Ga0068870_10004860 3300005840 Bacteria 5812
109 Ga0068863_100000150 3300005841 Bacteria 72968
110 Ga0068858_100009937 3300005842 Bacteria 9039
111 Ga0068858_100361807 3300005842 Bacteria 1391
112 Ga0068860_100006010 3300005843 Bacteria 12217
113 Ga0068862_100001121 3300005844 Bacteria 25430
114 Ga0081539_10215486 3300005985 Bacteria 877
115 Ga0070717_10089429 3300006028 Bacteria 2597
116 Ga0075367_10170624 3300006178 Bacteria 1355
117 Ga0097621_100001205 3300006237 Bacteria 17920
118 Ga0097621_100576868 3300006237 Bacteria 1026
119 Ga0068871_100000676 3300006358 Bacteria 23320
120 Ga0075433_10000718 3300006852 Bacteria 22669
121 Ga0075434_100002238 3300006871 Bacteria 16906
122 Ga0075434_100318339 3300006871 Bacteria 1576
123 Ga0068865_100000085 3300006881 Bacteria 50007
124 Ga0097620_100002042 3300006931 Bacteria 20614
125 Ga0097620_100008082 3300006931 Bacteria 10667
126 Ga0075435_100108158 3300007076 Bacteria 2310
127 Ga0105244_10105945 3300009036 Bacteria 1372
128 Ga0105240_10272141 3300009093 Bacteria 1949
129 Ga0105240_11128784 3300009093 Bacteria 833
130 Ga0111539_10001107 3300009094 Bacteria 35545
131 Ga0105245_10000235 3300009098 Bacteria 52697
132 Ga0105245_10351203 3300009098 Bacteria 1461
133 Ga0105247_10003180 3300009101 Bacteria 10823
134 Ga0105243_10001256 3300009148 Bacteria 22778
135 Ga0105243_10191495 3300009148 Bacteria 1787
136 Ga0105241_10000934 3300009174 Bacteria 22126
137 Ga0105241_10038552 3300009174 Bacteria 3602
138 Ga0105242_10000134 3300009176 Bacteria 53681
139 Ga0105248_10001347 3300009177 Bacteria 27377
140 Ga0105248_10464477 3300009177 Bacteria 1427
141 Ga0105237_10015067 3300009545 Bacteria 8057
142 Ga0105237_10366583 3300009545 Bacteria 1445
143 Ga0105249_10000325 3300009553 Bacteria 48220
144 Ga0105239_10004832 3300010375 Bacteria 15955
145 Ga0105239_10009903 3300010375 Bacteria 10704
146 Ga0105246_10000041 3300011119 Bacteria 48215
147 Ga0157371_10009552 3300013102 Bacteria 7628
148 Ga0157370_10005249 3300013104 Bacteria 14574
149 Ga0157369_10671333 3300013105 Bacteria 1068
150 Ga0157369_10865089 3300013105 Bacteria 928
151 Ga0157369_11015869 3300013105 Bacteria 849
152 Ga0157374_10059286 3300013296 Bacteria 3578
153 Ga0157374_10116461 3300013296 Bacteria 2575
154 Ga0157378_10009388 3300013297 Bacteria 8523
155 Ga0157378_10624595 3300013297 Bacteria 1091
156 Ga0163162_10014013 3300013306 Bacteria 7836
157 Ga0163162_10647237 3300013306 Bacteria 1181
158 Ga0157372_10006948 3300013307 Bacteria 12050
159 Ga0157372_10611912 3300013307 Bacteria 1270
160 Ga0157375_10000181 3300013308 Bacteria 59305
161 Ga0163163_10072524 3300014325 Bacteria 3433
162 Ga0157380_10000631 3300014326 Bacteria 21669
163 Ga0157377_10000101 3300014745 Bacteria 60248
164 Ga0157379_10000364 3300014968 Bacteria 36402
165 Ga0157376_10000142 3300014969 Bacteria 49085
166 Ga0163161_10000081 3300017792 Bacteria 97213
167 Ga0206356_11271130 3300020070 Bacteria 940
168 Ga0224572_1001191 3300024225 Bacteria 3714
169 Ga0207666_1000031 3300025271 Bacteria 30080
170 Ga0207673_1002624 3300025290 Bacteria 2063
171 Ga0209051_1002023 3300025303 Bacteria 15445
172 Ga0207697_10000045 3300025315 Bacteria 48192
173 Ga0207656_10215422 3300025321 Bacteria 932
174 Ga0207682_10000314 3300025893 Bacteria 21994
175 Ga0207642_10000262 3300025899 Bacteria 15798
176 Ga0207688_10000044 3300025901 Bacteria 43600
177 Ga0207680_10034045 3300025903 Bacteria 2911
178 Ga0207699_10093518 3300025906 Bacteria 1892
179 Ga0207645_10001816 3300025907 Bacteria 17211
180 Ga0207643_10000025 3300025908 Bacteria 101583
181 Ga0207705_10158833 3300025909 Bacteria 1697
182 Ga0207654_10070985 3300025911 Bacteria 2069
183 Ga0207707_10001635 3300025912 Bacteria 20673
184 Ga0207707_10248265 3300025912 Bacteria 1546
185 Ga0207707_10276338 3300025912 Bacteria 1455
186 Ga0207695_10091290 3300025913 Bacteria 3060
187 Ga0207695_10239291 3300025913 Bacteria 1717
188 Ga0207695_10632018 3300025913 Bacteria 952
189 Ga0207660_10000131 3300025917 Bacteria 44091
190 Ga0207660_10039676 3300025917 Bacteria 3293
191 Ga0207660_10208262 3300025917 Bacteria 1530
192 Ga0207662_10000100 3300025918 Bacteria 40845
193 Ga0207657_10000699 3300025919 Bacteria 35613
194 Ga0207649_10000310 3300025920 Bacteria 37179
195 Ga0207652_10007477 3300025921 Bacteria 8804
196 Ga0207652_10050183 3300025921 Bacteria 3574
197 Ga0207681_10000131 3300025923 Bacteria 61025
198 Ga0207650_10002469 3300025925 Bacteria 12857
199 Ga0207650_10012081 3300025925 Bacteria 5954
200 Ga0207659_10000040 3300025926 Bacteria 91375
201 Ga0207659_10310249 3300025926 Bacteria 1299
202 Ga0207659_10453283 3300025926 Bacteria 1081
203 Ga0207659_10920799 3300025926 Bacteria 752
204 Ga0207687_10000122 3300025927 Bacteria 52776
205 Ga0207687_10134165 3300025927 Bacteria 1870
206 Ga0207700_10074290 3300025928 Bacteria 2629
207 Ga0207664_10070657 3300025929 Bacteria 2810
208 Ga0207644_10000393 3300025931 Bacteria 28466
209 Ga0207644_10024765 3300025931 Bacteria 4122
210 Ga0207644_10066377 3300025931 Bacteria 2627
211 Ga0207690_10000277 3300025932 Bacteria 36311
212 Ga0207706_10000311 3300025933 Bacteria 52676
213 Ga0207686_10002434 3300025934 Bacteria 10135
214 Ga0207709_10000322 3300025935 Bacteria 51855
215 Ga0207709_10075742 3300025935 Bacteria 2151
216 Ga0207670_10000240 3300025936 Bacteria 34666
217 Ga0207670_10002292 3300025936 Bacteria 10026
218 Ga0207670_10040099 3300025936 Bacteria 3071
219 Ga0207669_10000191 3300025937 Bacteria 27739
220 Ga0207704_10000071 3300025938 Bacteria 64527
221 Ga0207691_10000257 3300025940 Bacteria 52675
222 Ga0207711_10002577 3300025941 Bacteria 16126
223 Ga0207711_10694626 3300025941 Bacteria 949
224 Ga0207689_10000134 3300025942 Bacteria 62937
225 Ga0207661_10000191 3300025944 Bacteria 39865
226 Ga0207661_10437212 3300025944 Bacteria 1190
227 Ga0207661_10682207 3300025944 Bacteria 945
228 Ga0207679_10000099 3300025945 Bacteria 74047
229 Ga0207667_10000834 3300025949 Bacteria 39795
230 Ga0207667_10048127 3300025949 Bacteria 4510
231 Ga0207667_10222055 3300025949 Bacteria 1936
232 Ga0207667_10238641 3300025949 Bacteria 1861
233 Ga0207667_10982776 3300025949 Bacteria 832
234 Ga0207651_10000017 3300025960 Bacteria 100256
235 Ga0207651_10057202 3300025960 Bacteria 2688
236 Ga0207712_10000114 3300025961 Bacteria 87261
237 Ga0207668_10002065 3300025972 Bacteria 11713
238 Ga0207640_10000604 3300025981 Bacteria 21239
239 Ga0207640_10507813 3300025981 Bacteria 1005
240 Ga0207658_10011285 3300025986 Bacteria 6084
241 Ga0207658_10331935 3300025986 Bacteria 1319
242 Ga0207658_10519825 3300025986 Bacteria 1062
243 Ga0207677_10000974 3300026023 Bacteria 15834
244 Ga0207703_10033656 3300026035 Bacteria 4064
245 Ga0207703_10523571 3300026035 Bacteria 1115
246 Ga0207639_10000646 3300026041 Bacteria 24015
247 Ga0207639_10689005 3300026041 Bacteria 947
248 Ga0207678_10000131 3300026067 Bacteria 62864
249 Ga0207708_10000192 3300026075 Bacteria 48193
250 Ga0207702_10003256 3300026078 Bacteria 15000
251 Ga0207702_11542566 3300026078 Bacteria 658
252 Ga0207641_10000246 3300026088 Bacteria 70235
253 Ga0207648_10001831 3300026089 Bacteria 23254
254 Ga0207676_10001655 3300026095 Bacteria 16413
255 Ga0207674_10000355 3300026116 Bacteria 59230
256 Ga0207674_10005230 3300026116 Bacteria 15448
257 Ga0207675_100001893 3300026118 Bacteria 20920
258 Ga0207675_100128996 3300026118 Bacteria 2397
259 Ga0207683_10000924 3300026121 Bacteria 26999
260 Ga0207698_10001234 3300026142 Bacteria 14949
261 Ga0207698_10038853 3300026142 Bacteria 3521
262 Ga0210002_1003224 3300027617 Bacteria 2396
263 Ga0209998_10000477 3300027717 Bacteria 11041
264 Ga0207428_10000469 3300027907 Bacteria 48709
265 Ga0265357_1000442 3300028023 Bacteria 2387
266 Ga0268265_10000312 3300028380 Bacteria 53940
267 Ga0268264_10000412 3300028381 Bacteria 60566
268 Ga0265327_10004738 3300031251 Bacteria 11868
269 Ga0265327_10246216 3300031251 Bacteria 797
270 Ga0307405_10114238 3300031731 Bacteria 1835
271 Ga0373950_0004467 3300034818 Bacteria 2050
272 Ga0373959_0004680 3300034820 Bacteria 2217
273 Ga0373938_0000451 3300034957 Bacteria 6711
274 Ga0373928_0001248 3300035084 Bacteria 5002
275 Ga0373929_0007719 3300035085 Bacteria 1970
276 Ga0373940_0006823 3300035088 Bacteria 2553
277 Ga0373949_0000392 3300035090 Bacteria 15288
278 Ga0373951_0030770 3300035091 Bacteria 1264
279 Ga0373952_0000364 3300035092 Bacteria 7685
280 Ga0373932_0001306 3300035112 Bacteria 7024
281 Ga0373939_0000964 3300035114 Bacteria 7176
282 Ga0373960_0000122 3300035121 Bacteria 12600
283 Ga0373943_0000531 3300035170 Bacteria 16460
284 Ga0373946_0085579 3300035171 Bacteria 1388
285 Ga0373946_0164953 3300035171 Bacteria 1042
286 Ga0373942_0010262 3300035207 Bacteria 2201
287 Ga0373961_0001327 3300035241 Bacteria 7481
288 Ga0373962_0000343 3300035242 Bacteria 10212
289 Ga0373931_0000167 3300035691 Bacteria 28656
290 Ga0373935_0027990 3300035692 Bacteria 3483
291 Ga0373935_0151666 3300035692 Bacteria 1573
292 Ga0373927_0004529 3300035695 Bacteria 9710
293 Ga0373947_0006078 3300035725 Bacteria 7034
294 Ga0373947_0047238 3300035725 Bacteria 2579
295 Ga0316584_0472202 3300036712 Bacteria 885
296 Ga0373925_0005270 3300037068 Bacteria 9654
297 Ga0395905_0071810 3300037471 Bacteria 3245
298 Ga0395905_0244661 3300037471 Bacteria 1676
299 Ga0395901_0632876 3300038443 Bacteria 1075
300 Ga0436365_0247919 3300039437 Bacteria 743
301 Ga0436360_0796564 3300039438 Bacteria 955
302 Ga0436363_0338542 3300039450 Bacteria 2022
303 Ga0436362_1167327 3300039453 Bacteria 1111
304 Ga0451577_0390134 3300042876 Unclassified 1264
305 Ga0466964_0194078 3300044706 Bacteria 971
306 Ga0453684_0000529 3300044712 Bacteria 145936
307 Ga0453684_0327050 3300044712 Unclassified 1734
308 Ga0495592_0350416 3300046454 Bacteria 947
309 Ga0495638_0068368 3300046460 Bacteria 2178
310 Ga0495653_0142895 3300046463 Bacteria 1681
311 Ga0495650_0001608 3300046471 Bacteria 21116
312 Ga0495580_0180654 3300046472 Bacteria 1457
313 Ga0495662_0321944 3300046476 Bacteria 760
314 Ga0495664_0026179 3300046477 Bacteria 3397
315 Ga0495607_0006551 3300046501 Bacteria 8187
316 Ga0495606_0000790 3300046507 Bacteria 48364
317 Ga0495606_0013589 3300046507 Bacteria 6422
318 Ga0495610_0004258 3300046512 Bacteria 10651
319 Ga0495618_0148035 3300046514 Bacteria 1500
320 Ga0495630_0063931 3300046517 Bacteria 2764
321 Ga0495643_0219473 3300046522 Bacteria 903
322 Ga0495648_0000724 3300046524 Bacteria 35198
323 Ga0495666_0191400 3300046526 Bacteria 942
324 Ga0495665_0385939 3300046531 Bacteria 711
325 Ga0495640_0013840 3300046533 Bacteria 6126
326 Ga0495597_0009389 3300046542 Bacteria 4836
327 Ga0495645_0016665 3300046543 Bacteria 5253
328 Ga0495633_0006562 3300046558 Bacteria 6877
329 Ga0495668_0000308 3300046616 Bacteria 67599
330 Ga0495668_0003909 3300046616 Bacteria 10886
331 Ga0495625_0008272 3300046660 Bacteria 8893
332 Ga0495635_0022156 3300046663 Bacteria 4425
333 Ga0495635_0057720 3300046663 Bacteria 2670
334 Ga0495635_0172171 3300046663 Bacteria 1472
335 Ga0495658_0014693 3300046683 Bacteria 4004
336 Ga0495669_0046207 3300046684 Bacteria 1943
337 Ga0495613_0122737 3300046689 Bacteria 1864
338 Ga0495613_0676798 3300046689 Bacteria 681
339 Ga0495624_0001792 3300046690 Bacteria 16434
340 Ga0495671_0038245 3300046692 Bacteria 2425
341 Ga0495671_0058034 3300046692 Bacteria 1915
342 Ga0495649_0025006 3300046694 Bacteria 3327
343 Ga0495660_0006474 3300046810 Bacteria 6925
344 Ga0495581_0015789 3300047315 Bacteria 4385
345 Ga0495674_0132381 3300047319 Bacteria 2100
346 Ga0495674_0144782 3300047319 Bacteria 1995
347 Ga0495673_0000461 3300047469 Bacteria 44189
348 Ga0495684_0025569 3300047471 Bacteria 4535
349 Ga0495684_0028777 3300047471 Bacteria 4265
350 Ga0495686_0013704 3300047472 Bacteria 5619
351 Ga0495686_0025356 3300047472 Bacteria 3888
352 Ga0495686_0084780 3300047472 Bacteria 1930
353 Ga0495593_0026650 3300047673 Bacteria 3189
354 Ga0496100_0000992 3300048903 Bacteria 13666
355 Ga0496101_0000417 3300048904 Bacteria 27418
356 Ga0496102_0011394 3300048905 Bacteria 7662
357 Ga0496102_0582188 3300048905 Bacteria 1042
358 Ga0496103_0000554 3300048906 Bacteria 29772
359 Ga0496106_0118715 3300048909 Bacteria 2065
360 Ga0496107_0002466 3300048910 Bacteria 12000
361 Ga0496107_0409970 3300048910 Bacteria 1008
362 Ga0496107_0651879 3300048910 Bacteria 776
363 Ga0496108_0001209 3300048911 Bacteria 20254
364 Ga0496109_0000150 3300048912 Bacteria 68777
365 Ga0496110_0033499 3300048913 Bacteria 4444
366 Ga0496111_0054364 3300048914 Bacteria 2894
367 Ga0496112_0046059 3300048915 Bacteria 4276
368 Ga0496114_0000393 3300048917 Bacteria 32210
369 Ga0496114_0072477 3300048917 Bacteria 2897
370 Ga0496115_0006917 3300048918 Bacteria 8332
371 Ga0496116_0058037 3300048919 Bacteria 2526
372 Ga0496121_0140132 3300048924 Bacteria 1795
373 Ga0496124_0060165 3300048927 Bacteria 3188
374 Ga0496126_0274222 3300048929 Bacteria 1399
375 Ga0501034_0032071 3300049571 Bacteria 5337
376 Ga0501034_0517746 3300049571 Bacteria 1105
377 Ga0501036_0019869 3300049572 Bacteria 5640
378 Ga0501037_0051271 3300049573 Bacteria 3018
379 Ga0501038_0029998 3300049574 Bacteria 4814
380 Ga0501043_0017706 3300049579 Bacteria 5586
381 Ga0501046_0001260 3300049580 Bacteria 24521
382 Ga0501047_0033170 3300049581 Bacteria 4984
383 Ga0501047_0045357 3300049581 Bacteria 4251
384 Ga0501067_0288855 3300049583 Bacteria 913
385 Ga0501073_0009561 3300049589 Bacteria 7150
386 Ga0501073_0025598 3300049589 Bacteria 4228
387 Ga0501074_0003713 3300049590 Bacteria 10827
388 Ga0501077_0715871 3300049593 Bacteria 643
389 Ga0501249_001134 3300049679 Bacteria 5618
390 Ga0501079_0142896 3300049741 Bacteria 1864
391 Ga0501080_0354861 3300049742 Bacteria 1324
392 Ga0501083_0003978 3300049744 Bacteria 10378
393 Ga0501241_006032 3300049758 Bacteria 2244
394 Ga0501269_000005 3300049766 Bacteria 77832
395 Ga0501035_0005487 3300049822 Bacteria 11981
396 Ga0501035_0005653 3300049822 Bacteria 11803
397 Ga0501044_0347715 3300049823 Bacteria 1403
398 nmdc:mga06z11_7090_c1 3300050494 Bacteria 4597
399 nmdc:mga08y16_40005_c1 3300050511 Bacteria 4917
400 nmdc:mga0n895_5635_c1 3300050512 Bacteria 10493
401 nmdc:mga08x19_202734_c1 3300050514 Bacteria 1360
402 nmdc:mga0a205_430_c1 3300050515 Bacteria 32284
403 Ga0495601_0003049 3300053077 Bacteria 9549
404 Ga0495612_0014767 3300053078 Bacteria 3134
405 Ga0500635_0000282 3300053080 Bacteria 18689
406 Ga0495595_0427397 3300053084 Bacteria 672
407 Ga0495619_0000149 3300053085 Bacteria 51751
408 Ga0495619_0404477 3300053085 Bacteria 942
409 Ga0500643_061304 3300053087 Bacteria 1056
410 Ga0500644_0000508 3300053088 Bacteria 16629
411 Ga0500564_001198 3300053138 Bacteria 8719
412 Ga0500625_011248 3300053729 Bacteria 4058
413 2585149164 2582581279 Bacteria 4980720
414 2738842468 2738541300 Bacteria 6675882
415 2739273215 2738543018 Bacteria 6718814
416 2739342259 2738543030 Bacteria 6719714
417 Ga0373931_0310015
418 JGI24032J14994_100699
419 JGI24746J21847_1000629
420 JGI24747J21853_1000179
421 JGI24739J22299_10001373
422 JGI24737J22298_10000073
423 JGI24743J22301_10010102
424 JGI24750J21931_1000377
425 JGI24745J21846_1001800
426 JGI24738J21930_10002341
427 JGI24749J21850_1000689
428 JGI24744J21845_10001417
429 JGI24035J26624_1000204
430 JGI24034J26672_10001497
431 JGI24742J22300_10000032
432 rootH1_10124254
433 Ga0065712_10114459
434 Ga0065715_10094020
435 Ga0070658_10021392
436 Ga0070676_10000251
437 Ga0070683_100002231
438 Ga0070683_100519430
439 Ga0070690_100000588
440 Ga0070670_100001768
441 Ga0070670_100015089
442 Ga0070677_10000076
443 Ga0068869_100008854
444 Ga0070680_100000333
445 Ga0070680_100031285
446 Ga0070682_100000285
447 Ga0068868_100049057
448 Ga0070660_100000474
449 Ga0070689_100000252
450 Ga0070689_100010095
451 Ga0070691_10000476
452 Ga0070687_100000185
453 Ga0070661_100005765
454 Ga0070692_10000127
455 Ga0070668_100001035
456 Ga0070669_100002096
457 Ga0070675_100008366
458 Ga0070675_100357012
459 Ga0070675_101221578
460 Ga0070671_100001132
461 Ga0070671_100003236
462 Ga0070674_100000240
463 Ga0070673_100000666
464 Ga0070673_100430796
465 Ga0070688_100000162
466 Ga0070659_100000720
467 Ga0070667_100001046
468 Ga0070667_100380665
469 Ga0070667_100431050
470 Ga0070709_10421001
471 Ga0070713_100017393
472 Ga0070713_100076779
473 Ga0070713_100228193
474 Ga0070701_10004311
475 Ga0070705_100000321
476 Ga0070700_100011814
477 Ga0070694_100000554
478 Ga0070708_100036023
479 Ga0070663_100004739
480 Ga0070678_100000228
481 Ga0070678_101084065
482 Ga0070662_100001178
483 Ga0070681_10000446
484 Ga0070681_10182963
485 Ga0068867_100001229
486 Ga0068867_100953207
487 Ga0070685_10000768
488 Ga0070698_100349250
489 Ga0070699_100063033
490 Ga0070679_100001839
491 Ga0070679_100038079
492 Ga0070679_100100722
493 Ga0070684_100000411
494 Ga0068853_100019479
495 Ga0068853_100397625
496 Ga0070672_100001539
497 Ga0070686_100000379
498 Ga0070686_100521827
499 Ga0070695_100000294
500 Ga0070696_100000594
501 Ga0070693_100000031
502 Ga0070665_100123538
503 Ga0070665_100148993
504 Ga0070704_100000481
505 Ga0068855_100043684
506 Ga0068855_100057969
507 Ga0070664_100000874
508 Ga0068857_100000249
509 Ga0068857_100018116
510 Ga0068854_100000146
511 Ga0068854_100041888
512 Ga0068856_100001251
513 Ga0068856_100952472
514 Ga0070702_100000134
515 Ga0068852_100002982
516 Ga0068852_100563204
517 Ga0068859_100002043
518 Ga0068859_100008082
519 Ga0068864_100000674
520 Ga0068866_10000348
521 Ga0068861_100000958
522 Ga0068861_100210377
523 Ga0068851_10039298
524 Ga0068870_10004860
525 Ga0068863_100000150
526 Ga0068858_100009937
527 Ga0068858_100361807
528 Ga0068860_100006010
529 Ga0068862_100001121
530 Ga0081539_10215486
531 Ga0070717_10089429
532 Ga0075367_10170624
533 Ga0097621_100001205
534 Ga0097621_100576868
535 Ga0068871_100000676
536 Ga0075433_10000718
537 Ga0075434_100002238
538 Ga0075434_100318339
539 Ga0068865_100000085
540 Ga0097620_100002042
541 Ga0097620_100008082
542 Ga0075435_100108158
543 Ga0105244_10105945
544 Ga0105240_10272141
545 Ga0105240_11128784
546 Ga0111539_10001107
547 Ga0105245_10000235
548 Ga0105245_10351203
549 Ga0105247_10003180
550 Ga0105243_10001256
551 Ga0105243_10191495
552 Ga0105241_10000934
553 Ga0105241_10038552
554 Ga0105242_10000134
555 Ga0105248_10001347
556 Ga0105248_10464477
557 Ga0105237_10015067
558 Ga0105237_10366583
559 Ga0105249_10000325
560 Ga0105239_10004832
561 Ga0105239_10009903
562 Ga0105246_10000041
563 Ga0157371_10009552
564 Ga0157370_10005249
565 Ga0157369_10671333
566 Ga0157369_10865089
567 Ga0157369_11015869
568 Ga0157374_10059286
569 Ga0157374_10116461
570 Ga0157378_10009388
571 Ga0157378_10624595
572 Ga0163162_10014013
573 Ga0163162_10647237
574 Ga0157372_10006948
575 Ga0157372_10611912
576 Ga0157375_10000181
577 Ga0163163_10072524
578 Ga0157380_10000631
579 Ga0157377_10000101
580 Ga0157379_10000364
581 Ga0157376_10000142
582 Ga0163161_10000081
583 Ga0206356_11271130
584 Ga0224572_1001191
585 Ga0207666_1000031
586 Ga0207673_1002624
587 Ga0209051_1002023
588 Ga0207697_10000045
589 Ga0207656_10215422
590 Ga0207682_10000314
591 Ga0207642_10000262
592 Ga0207688_10000044
593 Ga0207680_10034045
594 Ga0207699_10093518
595 Ga0207645_10001816
596 Ga0207643_10000025
597 Ga0207705_10158833
598 Ga0207654_10070985
599 Ga0207707_10001635
600 Ga0207707_10248265
601 Ga0207707_10276338
602 Ga0207695_10091290
603 Ga0207695_10239291
604 Ga0207695_10632018
605 Ga0207660_10000131
606 Ga0207660_10039676
607 Ga0207660_10208262
608 Ga0207662_10000100
609 Ga0207657_10000699
610 Ga0207649_10000310
611 Ga0207652_10007477
612 Ga0207652_10050183
613 Ga0207681_10000131
614 Ga0207650_10002469
615 Ga0207650_10012081
616 Ga0207659_10000040
617 Ga0207659_10310249
618 Ga0207659_10453283
619 Ga0207659_10920799
620 Ga0207687_10000122
621 Ga0207687_10134165
622 Ga0207700_10074290
623 Ga0207664_10070657
624 Ga0207644_10000393
625 Ga0207644_10024765
626 Ga0207644_10066377
627 Ga0207690_10000277
628 Ga0207706_10000311
629 Ga0207686_10002434
630 Ga0207709_10000322
631 Ga0207709_10075742
632 Ga0207670_10000240
633 Ga0207670_10002292
634 Ga0207670_10040099
635 Ga0207669_10000191
636 Ga0207704_10000071
637 Ga0207691_10000257
638 Ga0207711_10002577
639 Ga0207711_10694626
640 Ga0207689_10000134
641 Ga0207661_10000191
642 Ga0207661_10437212
643 Ga0207661_10682207
644 Ga0207679_10000099
645 Ga0207667_10000834
646 Ga0207667_10048127
647 Ga0207667_10222055
648 Ga0207667_10238641
649 Ga0207667_10982776
650 Ga0207651_10000017
651 Ga0207651_10057202
652 Ga0207712_10000114
653 Ga0207668_10002065
654 Ga0207640_10000604
655 Ga0207640_10507813
656 Ga0207658_10011285
657 Ga0207658_10331935
658 Ga0207658_10519825
659 Ga0207677_10000974
660 Ga0207703_10033656
661 Ga0207703_10523571
662 Ga0207639_10000646
663 Ga0207639_10689005
664 Ga0207678_10000131
665 Ga0207708_10000192
666 Ga0207702_10003256
667 Ga0207702_11542566
668 Ga0207641_10000246
669 Ga0207648_10001831
670 Ga0207676_10001655
671 Ga0207674_10000355
672 Ga0207674_10005230
673 Ga0207675_100001893
674 Ga0207675_100128996
675 Ga0207683_10000924
676 Ga0207698_10001234
677 Ga0207698_10038853
678 Ga0210002_1003224
679 Ga0209998_10000477
680 Ga0207428_10000469
681 Ga0265357_1000442
682 Ga0268265_10000312
683 Ga0268264_10000412
684 Ga0265327_10004738
685 Ga0265327_10246216
686 Ga0307405_10114238
687 Ga0373950_0004467
688 Ga0373959_0004680
689 Ga0373938_0000451
690 Ga0373928_0001248
691 Ga0373929_0007719
692 Ga0373940_0006823
693 Ga0373949_0000392
694 Ga0373951_0030770
695 Ga0373952_0000364
696 Ga0373932_0001306
697 Ga0373939_0000964
698 Ga0373960_0000122
699 Ga0373943_0000531
700 Ga0373946_0085579
701 Ga0373946_0164953
702 Ga0373942_0010262
703 Ga0373961_0001327
704 Ga0373962_0000343
705 Ga0373931_0000167
706 Ga0373935_0027990
707 Ga0373935_0151666
708 Ga0373927_0004529
709 Ga0373947_0006078
710 Ga0373947_0047238
711 Ga0316584_0472202
712 Ga0373925_0005270
713 Ga0395905_0071810
714 Ga0395905_0244661
715 Ga0395901_0632876
716 Ga0436365_0247919
717 Ga0436360_0796564
718 Ga0436363_0338542
719 Ga0436362_1167327
720 Ga0451577_0390134
721 Ga0466964_0194078
722 Ga0453684_0000529
723 Ga0453684_0327050
724 Ga0495592_0350416
725 Ga0495638_0068368
726 Ga0495653_0142895
727 Ga0495650_0001608
728 Ga0495580_0180654
729 Ga0495662_0321944
730 Ga0495664_0026179
731 Ga0495607_0006551
732 Ga0495606_0000790
733 Ga0495606_0013589
734 Ga0495610_0004258
735 Ga0495618_0148035
736 Ga0495630_0063931
737 Ga0495643_0219473
738 Ga0495648_0000724
739 Ga0495666_0191400
740 Ga0495665_0385939
741 Ga0495640_0013840
742 Ga0495597_0009389
743 Ga0495645_0016665
744 Ga0495633_0006562
745 Ga0495668_0000308
746 Ga0495668_0003909
747 Ga0495625_0008272
748 Ga0495635_0022156
749 Ga0495635_0057720
750 Ga0495635_0172171
751 Ga0495658_0014693
752 Ga0495669_0046207
753 Ga0495613_0122737
754 Ga0495613_0676798
755 Ga0495624_0001792
756 Ga0495671_0038245
757 Ga0495671_0058034
758 Ga0495649_0025006
759 Ga0495660_0006474
760 Ga0495581_0015789
761 Ga0495674_0132381
762 Ga0495674_0144782
763 Ga0495673_0000461
764 Ga0495684_0025569
765 Ga0495684_0028777
766 Ga0495686_0013704
767 Ga0495686_0025356
768 Ga0495686_0084780
769 Ga0495593_0026650
770 Ga0496100_0000992
771 Ga0496101_0000417
772 Ga0496102_0011394
773 Ga0496102_0582188
774 Ga0496103_0000554
775 Ga0496106_0118715
776 Ga0496107_0002466
777 Ga0496107_0409970
778 Ga0496107_0651879
779 Ga0496108_0001209
780 Ga0496109_0000150
781 Ga0496110_0033499
782 Ga0496111_0054364
783 Ga0496112_0046059
784 Ga0496114_0000393
785 Ga0496114_0072477
786 Ga0496115_0006917
787 Ga0496116_0058037
788 Ga0496121_0140132
789 Ga0496124_0060165
790 Ga0496126_0274222
791 Ga0501034_0032071
792 Ga0501034_0517746
793 Ga0501036_0019869
794 Ga0501037_0051271
795 Ga0501038_0029998
796 Ga0501043_0017706
797 Ga0501046_0001260
798 Ga0501047_0033170
799 Ga0501047_0045357
800 Ga0501067_0288855
801 Ga0501073_0009561
802 Ga0501073_0025598
803 Ga0501074_0003713
804 Ga0501077_0715871
805 Ga0501249_001134
806 Ga0501079_0142896
807 Ga0501080_0354861
808 Ga0501083_0003978
809 Ga0501241_006032
810 Ga0501269_000005
811 Ga0501035_0005487
812 Ga0501035_0005653
813 Ga0501044_0347715
814 nmdc:mga06z11_7090_c1
815 nmdc:mga08y16_40005_c1
816 nmdc:mga0n895_5635_c1
817 nmdc:mga08x19_202734_c1
818 nmdc:mga0a205_430_c1
819 Ga0495601_0003049
820 Ga0495612_0014767
821 Ga0500635_0000282
822 Ga0495595_0427397
823 Ga0495619_0000149
824 Ga0495619_0404477
825 Ga0500643_061304
826 Ga0500644_0000508
827 Ga0500564_001198
828 Ga0500625_011248
829 2585149164
830 2738842468
831 2739273215
832 2739342259

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06736

TMEM175

Endosomal/lysosomal potassium channel TMEM175

35

119

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
5vre-assembly1.cif.gz_D crystal structure of a lysosomal potassium-selective channel tmem175 homolog from chamaesiphon minutus 0.8684 3 179
5vre-assembly1.cif.gz_D crystal structure of a lysosomal potassium-selective channel tmem175 homolog from chamaesiphon minutus 0.816 3 179
6w8p-assembly1.cif.gz_B structure of membrane protein with ions 0.7611 4 175
8fyf-assembly1.cif.gz_B human tmem175-lamp1 transmembrane domain only complex 0.759 3 190
6w8n-assembly1.cif.gz_B structure of a trans-membrane protein 0.7458 1 190
ID Description Score Start End Superfamily
af_A0A0R0KXK1_49_164_1.20.930.20 Mainly Alpha;Up-down Bundle;Transcription Elongation Factor S-II; Chain A;Adaptor protein Cbl, N-terminal domain 0.6952 5 125 1.20.930.20
af_Q3EBY6_10_127_1.20.930.20 Mainly Alpha;Up-down Bundle;Transcription Elongation Factor S-II; Chain A;Adaptor protein Cbl, N-terminal domain 0.679 10 122 1.20.930.20
af_A0A0R0KXK1_49_164_1.20.930.20 Mainly Alpha;Up-down Bundle;Transcription Elongation Factor S-II; Chain A;Adaptor protein Cbl, N-terminal domain 0.6708 5 125 1.20.930.20
af_Q6P0S3_121_241_1.20.58.390 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Neurotransmitter-gated ion-channel transmembrane domain 0.6529 38 122 1.20.58.390
af_Q3EBY6_10_127_1.20.930.20 Mainly Alpha;Up-down Bundle;Transcription Elongation Factor S-II; Chain A;Adaptor protein Cbl, N-terminal domain 0.6061 10 122 1.20.930.20
ID Description Score Start End GO Terms
AF-A0A0K8Q9U3-F1-model_v4 Transmembrane protein 175 0.9835 3 191 GO:0005267
GO:0015252
GO:0016020
AF-A0A2U3QFG1-F1-model_v4 DUF1211 domain-containing protein 0.9831 1 190 GO:0005267
GO:0015252
GO:0016020
AF-R5R2G1-F1-model_v4 Integral membrane protein 0.9828 1 187 GO:0005267
GO:0015252
GO:0016020
AF-A0A2V5PTR6-F1-model_v4 DUF1211 domain-containing protein 0.9818 1 175 GO:0005267
GO:0015252
GO:0016020
AF-A5KNC7-F1-model_v4 DUF1211 domain-containing protein 0.9813 7 187 GO:0005267
GO:0015252
GO:0016020

Map