F438828

General Info

Members Datasets Scaffolds Average Seq Length
416 190 830 442

Family's Representative Sequence

Representative Sequence 3300026075|Ga0207708_10050486|Ga0207708_100504862
Length 535
Sequence MVITKLALPRRTFIRGMGATLALPFLDAMIPAMRAAGQSAPRFAAIYSGNGAIMSDWIPAEEGVGVALSPILKPLEAFRDRTLVVSGLDNFQATDQGDVGGQHPRAAPAFMSCAHPKQTEGADVKAGTTIDQIIASRICRDTKLSSLEVSVDRNDVVGACDHGYACAYMNSLAWSSPTTPLPSETNPRFVFERMFGVGATAEERLSRVKEDRSILDGLNSEISRLSRRLGARDRTKLNEYFDAVRDVEQRIAKAESYNSDFSVPEQPVGVPPTFKEYVELMFDLQALAFQADITRVSTLMMARENINRSYPEIGLPEAHHSMSHHGNNPEKMKVYSKLNTYHVETMAYFLNKLKSIPDGDGNLLDHTVVLYGSGMSDGNVHNNYNVPVVVVGGKDLQIKANRHVKYPKGTPLANLMVGLMDRFEVKVTKFGDSTAEIDLSSPIRRSQPDWANYVRGVIAGFQRLGRVMFSSGHSRPHFLATGNLTGLSLRYRCMHRRPCSDSPQWPKLIGAAAASSLATLFVVRNFFADFKGPTS

Samples

Sample ID Description Type Environment
1 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
59 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
60 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
61 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
62 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
144 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
148 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
149 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
150 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
151 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
152 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
153 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
154 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
155 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
156 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
157 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
158 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
159 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
160 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
161 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
162 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
163 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
164 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
165 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
166 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
167 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
168 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
169 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
170 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
171 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
172 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
173 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
175 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
176 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
177 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
178 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
179 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
180 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
181 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
182 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
183 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
184 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
185 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
186 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
187 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
188 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
189 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
190 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.28
Metatranscriptomes 0.72
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.12
Nodule 0
Rhizoplane 1.2
Rhizosphere 95.67
Stem 0
Stem Tuber 0
Unclassified 5.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207708_10050486 3300026075 Bacteria 3166
2 Ga0065712_10007632 3300005290 Bacteria 2690
3 Ga0065715_10001872 3300005293 Bacteria 6831
4 Ga0065715_10001935 3300005293 Bacteria 9849
5 Ga0065715_10012182 3300005293 Bacteria 2440
6 Ga0065715_10014235 3300005293 Bacteria 2715
7 Ga0065707_10001054 3300005295 Bacteria 15444
8 Ga0065707_10130451 3300005295 Bacteria 1929
9 Ga0070676_10002628 3300005328 Bacteria 9241
10 Ga0070676_10020725 3300005328 Bacteria 3675
11 Ga0070690_100046987 3300005330 Bacteria 2745
12 Ga0070670_100043545 3300005331 Bacteria 3858
13 Ga0070670_100048184 3300005331 Unclassified 3667
14 Ga0068869_100010864 3300005334 Bacteria 5955
15 Ga0068869_100017392 3300005334 Bacteria 4871
16 Ga0068869_100171943 3300005334 Bacteria 1693
17 Ga0070666_10002616 3300005335 Bacteria 10875
18 Ga0070666_10022211 3300005335 Bacteria 4118
19 Ga0070680_100011263 3300005336 Bacteria 6915
20 Ga0068868_100139385 3300005338 Bacteria 1990
21 Ga0068868_100212628 3300005338 Unclassified 1617
22 Ga0070689_100021034 3300005340 Bacteria 4850
23 Ga0070689_100089831 3300005340 Bacteria 2420
24 Ga0070689_100121392 3300005340 Bacteria 2087
25 Ga0070691_10026685 3300005341 Bacteria 2693
26 Ga0070691_10052415 3300005341 Bacteria 1950
27 Ga0070687_100001609 3300005343 Bacteria 8043
28 Ga0070687_100002361 3300005343 Bacteria 7039
29 Ga0070661_100111079 3300005344 Bacteria 2047
30 Ga0070668_100011521 3300005347 Bacteria 6584
31 Ga0070668_100195202 3300005347 Bacteria 1660
32 Ga0070669_100023974 3300005353 Bacteria 4372
33 Ga0070669_100135155 3300005353 Bacteria 1896
34 Ga0070675_100009296 3300005354 Bacteria 7642
35 Ga0070675_100022041 3300005354 Bacteria 5090
36 Ga0070675_100042443 3300005354 Bacteria 3716
37 Ga0070675_100059067 3300005354 Bacteria 3163
38 Ga0070675_100071335 3300005354 Bacteria 2881
39 Ga0070675_100078092 3300005354 Bacteria 2756
40 Ga0070671_100031534 3300005355 Bacteria 4379
41 Ga0070671_100131200 3300005355 Bacteria 2111
42 Ga0070671_100165624 3300005355 Bacteria 1869
43 Ga0070674_100001699 3300005356 Bacteria 11919
44 Ga0070674_100009687 3300005356 Bacteria 5782
45 Ga0070674_100023171 3300005356 Bacteria 4014
46 Ga0070674_100041672 3300005356 Bacteria 3114
47 Ga0070674_100149147 3300005356 Bacteria 1763
48 Ga0070674_100182257 3300005356 Unclassified 1609
49 Ga0070673_100010702 3300005364 Bacteria 6221
50 Ga0070673_100051933 3300005364 Bacteria 3214
51 Ga0070673_100074812 3300005364 Bacteria 2730
52 Ga0070688_100005239 3300005365 Bacteria 6813
53 Ga0070659_100171934 3300005366 Unclassified 1775
54 Ga0070667_100015099 3300005367 Bacteria 6379
55 Ga0070667_100036800 3300005367 Bacteria 4103
56 Ga0070667_100279546 3300005367 Bacteria 1499
57 Ga0070701_10012561 3300005438 Bacteria 3824
58 Ga0070705_100002891 3300005440 Bacteria 8504
59 Ga0070705_100051820 3300005440 Bacteria 2395
60 Ga0070694_100005505 3300005444 Bacteria 7670
61 Ga0070694_100007405 3300005444 Bacteria 6694
62 Ga0070694_100132966 3300005444 Bacteria 1799
63 Ga0070678_100031881 3300005456 Bacteria 3641
64 Ga0070681_10051120 3300005458 Unclassified 4123
65 Ga0068867_100033950 3300005459 Bacteria 3697
66 Ga0068867_100036223 3300005459 Bacteria 3580
67 Ga0068867_100130310 3300005459 Bacteria 1954
68 Ga0068867_100139947 3300005459 Bacteria 1891
69 Ga0070706_100056442 3300005467 Bacteria 3624
70 Ga0070706_100149747 3300005467 Bacteria 2178
71 Ga0070707_100166864 3300005468 Unclassified 2146
72 Ga0070698_100023394 3300005471 Bacteria 6459
73 Ga0070679_100220753 3300005530 Bacteria 1856
74 Ga0070672_100009327 3300005543 Bacteria 6760
75 Ga0070672_100020503 3300005543 Bacteria 4822
76 Ga0070672_100091352 3300005543 Bacteria 2456
77 Ga0070686_100003186 3300005544 Bacteria 8984
78 Ga0070686_100019555 3300005544 Bacteria 3993
79 Ga0070686_100045062 3300005544 Bacteria 2776
80 Ga0070695_100063039 3300005545 Bacteria 2408
81 Ga0070696_100023626 3300005546 Bacteria 4178
82 Ga0070665_100005512 3300005548 Bacteria 13026
83 Ga0070665_100008685 3300005548 Bacteria 10284
84 Ga0070665_100034832 3300005548 Bacteria 5064
85 Ga0070704_100007228 3300005549 Bacteria 6604
86 Ga0070704_100030232 3300005549 Bacteria 3627
87 Ga0070704_100065895 3300005549 Bacteria 2610
88 Ga0068855_100013504 3300005563 Bacteria 9846
89 Ga0068855_100046209 3300005563 Bacteria 5147
90 Ga0070664_100000561 3300005564 Bacteria 28409
91 Ga0068857_100000820 3300005577 Bacteria 23259
92 Ga0068857_100184105 3300005577 Bacteria 1901
93 Ga0068854_100095811 3300005578 Bacteria 2216
94 Ga0068856_100008597 3300005614 Bacteria 9929
95 Ga0068856_100077269 3300005614 Bacteria 3299
96 Ga0070702_100017994 3300005615 Bacteria 3656
97 Ga0070702_100118066 3300005615 Bacteria 1656
98 Ga0068852_100118664 3300005616 Bacteria 2418
99 Ga0068859_100020336 3300005617 Bacteria 6664
100 Ga0068864_100051418 3300005618 Unclassified 3550
101 Ga0068864_100062632 3300005618 Unclassified 3223
102 Ga0068866_10024366 3300005718 Bacteria 2829
103 Ga0068866_10075458 3300005718 Bacteria 1795
104 Ga0068861_100008418 3300005719 Bacteria 7104
105 Ga0068861_100030547 3300005719 Bacteria 3949
106 Ga0068861_100106833 3300005719 Bacteria 2237
107 Ga0068861_100145462 3300005719 Bacteria 1939
108 Ga0068861_100170491 3300005719 Bacteria 1803
109 Ga0068861_100202529 3300005719 Unclassified 1667
110 Ga0068870_10038393 3300005840 Bacteria 2473
111 Ga0068870_10122060 3300005840 Bacteria 1502
112 Ga0068863_100000950 3300005841 Bacteria 29089
113 Ga0068863_100016472 3300005841 Bacteria 7091
114 Ga0068863_100037974 3300005841 Bacteria 4583
115 Ga0068863_100093768 3300005841 Bacteria 2849
116 Ga0068858_100004170 3300005842 Bacteria 14223
117 Ga0068858_100008508 3300005842 Bacteria 9860
118 Ga0068858_100025142 3300005842 Bacteria 5541
119 Ga0068860_100066712 3300005843 Bacteria 3419
120 Ga0068860_100177003 3300005843 Bacteria 2061
121 Ga0068862_100009499 3300005844 Bacteria 8049
122 Ga0068862_100045178 3300005844 Bacteria 3758
123 Ga0068862_100057084 3300005844 Bacteria 3347
124 Ga0068862_100083271 3300005844 Bacteria 2778
125 Ga0068862_100085520 3300005844 Unclassified 2741
126 Ga0068862_100142511 3300005844 Bacteria 2128
127 Ga0068862_100237781 3300005844 Bacteria 1655
128 Ga0068862_100294732 3300005844 Bacteria 1491
129 Ga0081455_10014687 3300005937 Bacteria 7650
130 Ga0075368_10022383 3300006042 Bacteria 2406
131 Ga0075363_100025183 3300006048 Bacteria 3031
132 Ga0075362_10016459 3300006177 Bacteria 3028
133 Ga0075367_10008650 3300006178 Bacteria 5281
134 Ga0075366_10000300 3300006195 Bacteria 22309
135 Ga0075366_10002477 3300006195 Bacteria 9463
136 Ga0097621_100038498 3300006237 Bacteria 3837
137 Ga0097621_100067055 3300006237 Bacteria 2957
138 Ga0097621_100184884 3300006237 Bacteria 1802
139 Ga0075428_100000008 3300006844 Bacteria 271300
140 Ga0075428_100000064 3300006844 Bacteria 85791
141 Ga0075428_100000101 3300006844 Bacteria 71694
142 Ga0075428_100057473 3300006844 Bacteria 4258
143 Ga0075428_100175680 3300006844 Bacteria 2319
144 Ga0075433_10043754 3300006852 Bacteria 3888
145 Ga0075434_100000101 3300006871 Bacteria 48004
146 Ga0075434_100000625 3300006871 Bacteria 27300
147 Ga0075434_100031428 3300006871 Bacteria 5235
148 Ga0075429_100030576 3300006880 Bacteria 4678
149 Ga0068865_100025206 3300006881 Bacteria 3908
150 Ga0068865_100077022 3300006881 Bacteria 2382
151 Ga0075436_100000515 3300006914 Bacteria 25094
152 Ga0075436_100072269 3300006914 Bacteria 2387
153 Ga0075436_100083282 3300006914 Bacteria 2219
154 Ga0097620_100020336 3300006931 Bacteria 6664
155 Ga0075435_100000003 3300007076 Bacteria 124953
156 Ga0075435_100005554 3300007076 Bacteria 8823
157 Ga0075435_100006499 3300007076 Bacteria 8268
158 Ga0075435_100025344 3300007076 Bacteria 4616
159 Ga0075435_100047328 3300007076 Bacteria 3453
160 Ga0105240_10170069 3300009093 Bacteria 2582
161 Ga0105240_10185558 3300009093 Bacteria 2450
162 Ga0111539_10000020 3300009094 Bacteria 265282
163 Ga0111539_10000104 3300009094 Bacteria 91019
164 Ga0111539_10000315 3300009094 Bacteria 58955
165 Ga0111539_10002920 3300009094 Bacteria 22673
166 Ga0111539_10005475 3300009094 Bacteria 16423
167 Ga0111539_10005979 3300009094 Bacteria 15722
168 Ga0111539_10008514 3300009094 Bacteria 13034
169 Ga0111539_10018740 3300009094 Bacteria 8567
170 Ga0111539_10076102 3300009094 Bacteria 3952
171 Ga0111539_10197150 3300009094 Bacteria 2348
172 Ga0111539_10378568 3300009094 Unclassified 1648
173 Ga0105245_10143309 3300009098 Bacteria 2252
174 Ga0105245_10219414 3300009098 Bacteria 1834
175 Ga0105247_10002394 3300009101 Bacteria 12747
176 Ga0114129_10006723 3300009147 Bacteria 16326
177 Ga0114129_10010390 3300009147 Bacteria 13279
178 Ga0114129_10032965 3300009147 Bacteria 7321
179 Ga0114129_10044716 3300009147 Bacteria 6229
180 Ga0114129_10048533 3300009147 Bacteria 5965
181 Ga0114129_10183441 3300009147 Bacteria 2846
182 Ga0105243_10030309 3300009148 Bacteria 4163
183 Ga0105242_10068537 3300009176 Bacteria 2935
184 Ga0105242_10079454 3300009176 Bacteria 2739
185 Ga0105242_10111970 3300009176 Bacteria 2328
186 Ga0105242_10123730 3300009176 Unclassified 2224
187 Ga0105248_10037475 3300009177 Bacteria 5425
188 Ga0105248_10047280 3300009177 Bacteria 4825
189 Ga0105248_10187607 3300009177 Bacteria 2330
190 Ga0105248_10208780 3300009177 Bacteria 2200
191 Ga0105248_10221687 3300009177 Unclassified 2129
192 Ga0105237_10014297 3300009545 Bacteria 8308
193 Ga0105238_10002067 3300009551 Bacteria 20266
194 Ga0105249_10001746 3300009553 Bacteria 18950
195 Ga0105249_10018151 3300009553 Bacteria 6254
196 Ga0105249_10151727 3300009553 Bacteria 2231
197 Ga0105239_10006300 3300010375 Bacteria 13797
198 Ga0157370_10001603 3300013104 Bacteria 27948
199 Ga0157369_10006541 3300013105 Bacteria 13486
200 Ga0157378_10039655 3300013297 Bacteria 4177
201 Ga0157378_10044654 3300013297 Bacteria 3936
202 Ga0163162_10001608 3300013306 Bacteria 21137
203 Ga0163162_10038126 3300013306 Bacteria 4797
204 Ga0163162_10150903 3300013306 Bacteria 2441
205 Ga0157372_10007179 3300013307 Bacteria 11857
206 Ga0157372_10133115 3300013307 Bacteria 2862
207 Ga0157375_10125083 3300013308 Bacteria 2685
208 Ga0157375_10164119 3300013308 Bacteria 2365
209 Ga0163163_10001148 3300014325 Bacteria 22524
210 Ga0163163_10056672 3300014325 Bacteria 3873
211 Ga0163163_10084525 3300014325 Bacteria 3180
212 Ga0157380_10024171 3300014326 Bacteria 4595
213 Ga0157380_10025751 3300014326 Bacteria 4463
214 Ga0157380_10048331 3300014326 Bacteria 3350
215 Ga0157380_10067658 3300014326 Bacteria 2877
216 Ga0157380_10073940 3300014326 Bacteria 2765
217 Ga0157377_10002540 3300014745 Bacteria 8095
218 Ga0157379_10005597 3300014968 Bacteria 10800
219 Ga0157379_10010171 3300014968 Bacteria 8196
220 Ga0157379_10011549 3300014968 Bacteria 7707
221 Ga0157379_10048787 3300014968 Bacteria 3779
222 Ga0157379_10108700 3300014968 Bacteria 2490
223 Ga0157376_10022172 3300014969 Unclassified 4945
224 Ga0157376_10030400 3300014969 Bacteria 4313
225 Ga0157376_10062170 3300014969 Bacteria 3141
226 Ga0163161_10189741 3300017792 Bacteria 1579
227 Ga0197907_10460726 3300020069 Bacteria 1606
228 Ga0206356_10294409 3300020070 Bacteria 1396
229 Ga0224712_10010069 3300022467 Bacteria 2875
230 Ga0207697_10004120 3300025315 Bacteria 7018
231 Ga0207682_10000405 3300025893 Bacteria 19862
232 Ga0207682_10010995 3300025893 Bacteria 3543
233 Ga0207682_10033177 3300025893 Bacteria 2078
234 Ga0207642_10006653 3300025899 Bacteria 3857
235 Ga0207688_10000965 3300025901 Bacteria 14643
236 Ga0207680_10038145 3300025903 Unclassified 2780
237 Ga0207680_10080270 3300025903 Bacteria 2048
238 Ga0207645_10000952 3300025907 Bacteria 23989
239 Ga0207645_10006403 3300025907 Bacteria 8453
240 Ga0207645_10096084 3300025907 Bacteria 1909
241 Ga0207643_10000236 3300025908 Bacteria 38610
242 Ga0207705_10093113 3300025909 Bacteria 2209
243 Ga0207684_10111604 3300025910 Bacteria 2340
244 Ga0207707_10017629 3300025912 Bacteria 6228
245 Ga0207695_10031343 3300025913 Bacteria 5833
246 Ga0207671_10089316 3300025914 Bacteria 2319
247 Ga0207660_10002274 3300025917 Bacteria 12656
248 Ga0207662_10001511 3300025918 Bacteria 11321
249 Ga0207662_10012085 3300025918 Bacteria 4805
250 Ga0207662_10025968 3300025918 Unclassified 3377
251 Ga0207662_10101296 3300025918 Bacteria 1785
252 Ga0207649_10057437 3300025920 Bacteria 2433
253 Ga0207681_10004800 3300025923 Bacteria 8313
254 Ga0207681_10028264 3300025923 Bacteria 3631
255 Ga0207681_10051927 3300025923 Bacteria 2778
256 Ga0207681_10054642 3300025923 Bacteria 2716
257 Ga0207681_10128183 3300025923 Bacteria 1872
258 Ga0207694_10004486 3300025924 Bacteria 10892
259 Ga0207650_10011802 3300025925 Bacteria 6024
260 Ga0207650_10139269 3300025925 Bacteria 1906
261 Ga0207659_10052302 3300025926 Bacteria 2909
262 Ga0207659_10060446 3300025926 Bacteria 2727
263 Ga0207659_10112238 3300025926 Bacteria 2074
264 Ga0207687_10145962 3300025927 Unclassified 1800
265 Ga0207644_10015044 3300025931 Bacteria 5190
266 Ga0207644_10028707 3300025931 Bacteria 3855
267 Ga0207690_10110846 3300025932 Unclassified 1976
268 Ga0207706_10014807 3300025933 Bacteria 7061
269 Ga0207706_10019573 3300025933 Bacteria 6089
270 Ga0207706_10027931 3300025933 Bacteria 5043
271 Ga0207706_10215504 3300025933 Bacteria 1682
272 Ga0207686_10011012 3300025934 Bacteria 4937
273 Ga0207669_10000380 3300025937 Bacteria 20012
274 Ga0207669_10036243 3300025937 Bacteria 2817
275 Ga0207691_10007003 3300025940 Bacteria 10879
276 Ga0207691_10015472 3300025940 Bacteria 7253
277 Ga0207691_10020829 3300025940 Bacteria 6196
278 Ga0207691_10039323 3300025940 Bacteria 4376
279 Ga0207691_10106797 3300025940 Bacteria 2493
280 Ga0207711_10024842 3300025941 Bacteria 5027
281 Ga0207711_10028560 3300025941 Bacteria 4695
282 Ga0207711_10030675 3300025941 Bacteria 4535
283 Ga0207711_10061653 3300025941 Bacteria 3234
284 Ga0207711_10065361 3300025941 Bacteria 3144
285 Ga0207711_10066050 3300025941 Bacteria 3128
286 Ga0207711_10123600 3300025941 Bacteria 2313
287 Ga0207679_10135728 3300025945 Bacteria 1981
288 Ga0207651_10016642 3300025960 Bacteria 4315
289 Ga0207651_10019993 3300025960 Bacteria 4029
290 Ga0207651_10045001 3300025960 Bacteria 2958
291 Ga0207668_10062522 3300025972 Bacteria 2622
292 Ga0207668_10154611 3300025972 Unclassified 1780
293 Ga0207668_10170035 3300025972 Bacteria 1708
294 Ga0207640_10050033 3300025981 Bacteria 2709
295 Ga0207658_10031861 3300025986 Bacteria 3748
296 Ga0207677_10030429 3300026023 Bacteria 3446
297 Ga0207677_10036237 3300026023 Unclassified 3213
298 Ga0207703_10034856 3300026035 Bacteria 3996
299 Ga0207703_10059113 3300026035 Bacteria 3131
300 Ga0207703_10112997 3300026035 Bacteria 2321
301 Ga0207639_10092492 3300026041 Unclassified 2424
302 Ga0207678_10009778 3300026067 Bacteria 8434
303 Ga0207678_10102471 3300026067 Bacteria 2444
304 Ga0207708_10126581 3300026075 Bacteria 1994
305 Ga0207708_10134781 3300026075 Bacteria 1933
306 Ga0207702_10179231 3300026078 Bacteria 1950
307 Ga0207641_10001001 3300026088 Bacteria 28894
308 Ga0207641_10021373 3300026088 Bacteria 5319
309 Ga0207641_10101433 3300026088 Unclassified 2536
310 Ga0207648_10015297 3300026089 Bacteria 7060
311 Ga0207648_10019144 3300026089 Bacteria 6179
312 Ga0207648_10026466 3300026089 Bacteria 5154
313 Ga0207648_10027864 3300026089 Bacteria 5012
314 Ga0207648_10040591 3300026089 Bacteria 4089
315 Ga0207676_10022563 3300026095 Bacteria 4630
316 Ga0207676_10097551 3300026095 Bacteria 2428
317 Ga0207676_10178818 3300026095 Bacteria 1856
318 Ga0207674_10007384 3300026116 Bacteria 12801
319 Ga0207675_100001803 3300026118 Bacteria 21451
320 Ga0207675_100006532 3300026118 Bacteria 11038
321 Ga0207675_100046768 3300026118 Bacteria 4043
322 Ga0207675_100050309 3300026118 Bacteria 3888
323 Ga0207675_100205389 3300026118 Bacteria 1893
324 Ga0207683_10007394 3300026121 Bacteria 9415
325 Ga0207683_10067735 3300026121 Bacteria 3150
326 Ga0207683_10145652 3300026121 Bacteria 2136
327 Ga0207698_10085670 3300026142 Bacteria 2559
328 Ga0207428_10000005 3300027907 Bacteria 520045
329 Ga0207428_10000051 3300027907 Bacteria 176522
330 Ga0207428_10000143 3300027907 Bacteria 96995
331 Ga0207428_10016382 3300027907 Bacteria 6377
332 Ga0207428_10022200 3300027907 Bacteria 5359
333 Ga0207428_10023570 3300027907 Bacteria 5173
334 Ga0207428_10031234 3300027907 Bacteria 4399
335 Ga0268266_10026151 3300028379 Bacteria 4967
336 Ga0268266_10063808 3300028379 Bacteria 3180
337 Ga0268265_10014780 3300028380 Bacteria 5327
338 Ga0268265_10023716 3300028380 Bacteria 4329
339 Ga0268265_10139367 3300028380 Unclassified 2028
340 Ga0268264_10029963 3300028381 Bacteria 4461
341 Ga0265319_1005176 3300028563 Bacteria 6304
342 Ga0307408_100019758 3300031548 Bacteria 4538
343 Ga0307411_10044555 3300032005 Bacteria 2847
344 Ga0373959_0003287 3300034820 Bacteria 2569
345 Ga0373938_0001850 3300034957 Bacteria 3379
346 Ga0373928_0001362 3300035084 Bacteria 4792
347 Ga0373940_0000304 3300035088 Bacteria 7092
348 Ga0373949_0004081 3300035090 Bacteria 3380
349 Ga0373951_0007059 3300035091 Bacteria 2558
350 Ga0373952_0011681 3300035092 Bacteria 1716
351 Ga0373932_0032174 3300035112 Bacteria 1465
352 Ga0373939_0000251 3300035114 Bacteria 14525
353 Ga0373941_0000245 3300035115 Bacteria 10460
354 Ga0373960_0003963 3300035121 Bacteria 3376
355 Ga0373961_0000763 3300035241 Bacteria 11096
356 Ga0373931_0003187 3300035691 Bacteria 7319
357 Ga0373931_0051194 3300035691 Bacteria 2199
358 Ga0395898_0092228 3300037466 Bacteria 2913
359 Ga0450920_013473 3300042122 Bacteria 1540
360 Ga0450908_001283 3300042184 Bacteria 4872
361 Ga0451576_0002867 3300045051 Bacteria 24696
362 Ga0451576_0098551 3300045051 Bacteria 3040
363 Ga0495643_0006034 3300046522 Bacteria 8079
364 Ga0495669_0007789 3300046684 Bacteria 4498
365 Ga0496104_0141249 3300048907 Bacteria 2313
366 Ga0496106_0074018 3300048909 Bacteria 2607
367 Ga0496108_0050257 3300048911 Bacteria 3490
368 Ga0496108_0070135 3300048911 Bacteria 2958
369 Ga0496109_0185336 3300048912 Bacteria 1956
370 Ga0501036_0035703 3300049572 Unclassified 4206
371 Ga0501072_0011522 3300049588 Bacteria 6758
372 Ga0501072_0191828 3300049588 Bacteria 1629
373 Ga0501075_0014076 3300049591 Bacteria 5729
374 Ga0501076_0012267 3300049592 Bacteria 6409
375 Ga0501076_0021252 3300049592 Bacteria 4977
376 nmdc:mga0yw44_180027_c1 3300050492 Bacteria 1391
377 nmdc:mga0k408_11802_c1 3300050493 Bacteria 4766
378 nmdc:mga0k408_682_c1 3300050493 Bacteria 18644
379 nmdc:mga06z11_15788_c1 3300050494 Bacteria 3381
380 nmdc:mga06z11_38726_c1 3300050494 Bacteria 2369
381 nmdc:mga06z11_6371_c1 3300050494 Bacteria 4795
382 nmdc:mga07m45_76048_c1 3300050496 Bacteria 1914
383 nmdc:mga05p37_117214_c1 3300050507 Bacteria 3273
384 nmdc:mga05p37_129282_c1 3300050507 Bacteria 3100
385 nmdc:mga05p37_15824_c1 3300050507 Bacteria 9072
386 nmdc:mga05p37_62957_c1 3300050507 Bacteria 4565
387 nmdc:mga09592_229483_c1 3300050508 Bacteria 1608
388 nmdc:mga09592_26006_c1 3300050508 Bacteria 4847
389 nmdc:mga09592_62745_c1 3300050508 Bacteria 3144
390 nmdc:mga06r32_11977_c1 3300050510 Bacteria 7817
391 nmdc:mga08y16_121863_c1 3300050511 Bacteria 2714
392 nmdc:mga08y16_14083_c1 3300050511 Bacteria 8419
393 nmdc:mga08y16_25_c1 3300050511 Bacteria 235789
394 nmdc:mga08y16_289903_c1 3300050511 Bacteria 1688
395 nmdc:mga08y16_7840_c1 3300050511 Bacteria 11183
396 nmdc:mga08y16_8_c1 3300050511 Bacteria 571177
397 nmdc:mga08y16_9_c1 3300050511 Bacteria 566088
398 nmdc:mga0n895_159020_c1 3300050512 Bacteria 2290
399 nmdc:mga0n895_9_c1 3300050512 Bacteria 119566
400 nmdc:mga0rr50_219_c1 3300050513 Bacteria 30871
401 nmdc:mga0rr50_24921_c1 3300050513 Bacteria 4152
402 nmdc:mga0rr50_65279_c1 3300050513 Bacteria 2756
403 nmdc:mga0rr50_7_c1 3300050513 Bacteria 297175
404 nmdc:mga0rr50_8112_c1 3300050513 Bacteria 6519
405 nmdc:mga08x19_1296_c1 3300050514 Bacteria 15519
406 nmdc:mga08x19_13660_c1 3300050514 Bacteria 4913
407 nmdc:mga08x19_31793_c1 3300050514 Bacteria 3324
408 nmdc:mga08x19_75086_c1 3300050514 Bacteria 2210
409 nmdc:mga0a205_1271_c1 3300050515 Bacteria 21232
410 nmdc:mga0a205_19658_c1 3300050515 Bacteria 6371
411 nmdc:mga0a205_383796_c1 3300050515 Bacteria 1270
412 nmdc:mga0a205_71197_c1 3300050515 Bacteria 3358
413 Ga0495601_0078902 3300053077 Bacteria 2110
414 Ga0501082_0027217 3300060353 Bacteria 4924
415 Ga0501082_0048977 3300060353 Bacteria 3643
416 Ga0207708_10050486
417 Ga0065712_10007632
418 Ga0065715_10001872
419 Ga0065715_10001935
420 Ga0065715_10012182
421 Ga0065715_10014235
422 Ga0065707_10001054
423 Ga0065707_10130451
424 Ga0070676_10002628
425 Ga0070676_10020725
426 Ga0070690_100046987
427 Ga0070670_100043545
428 Ga0070670_100048184
429 Ga0068869_100010864
430 Ga0068869_100017392
431 Ga0068869_100171943
432 Ga0070666_10002616
433 Ga0070666_10022211
434 Ga0070680_100011263
435 Ga0068868_100139385
436 Ga0068868_100212628
437 Ga0070689_100021034
438 Ga0070689_100089831
439 Ga0070689_100121392
440 Ga0070691_10026685
441 Ga0070691_10052415
442 Ga0070687_100001609
443 Ga0070687_100002361
444 Ga0070661_100111079
445 Ga0070668_100011521
446 Ga0070668_100195202
447 Ga0070669_100023974
448 Ga0070669_100135155
449 Ga0070675_100009296
450 Ga0070675_100022041
451 Ga0070675_100042443
452 Ga0070675_100059067
453 Ga0070675_100071335
454 Ga0070675_100078092
455 Ga0070671_100031534
456 Ga0070671_100131200
457 Ga0070671_100165624
458 Ga0070674_100001699
459 Ga0070674_100009687
460 Ga0070674_100023171
461 Ga0070674_100041672
462 Ga0070674_100149147
463 Ga0070674_100182257
464 Ga0070673_100010702
465 Ga0070673_100051933
466 Ga0070673_100074812
467 Ga0070688_100005239
468 Ga0070659_100171934
469 Ga0070667_100015099
470 Ga0070667_100036800
471 Ga0070667_100279546
472 Ga0070701_10012561
473 Ga0070705_100002891
474 Ga0070705_100051820
475 Ga0070694_100005505
476 Ga0070694_100007405
477 Ga0070694_100132966
478 Ga0070678_100031881
479 Ga0070681_10051120
480 Ga0068867_100033950
481 Ga0068867_100036223
482 Ga0068867_100130310
483 Ga0068867_100139947
484 Ga0070706_100056442
485 Ga0070706_100149747
486 Ga0070707_100166864
487 Ga0070698_100023394
488 Ga0070679_100220753
489 Ga0070672_100009327
490 Ga0070672_100020503
491 Ga0070672_100091352
492 Ga0070686_100003186
493 Ga0070686_100019555
494 Ga0070686_100045062
495 Ga0070695_100063039
496 Ga0070696_100023626
497 Ga0070665_100005512
498 Ga0070665_100008685
499 Ga0070665_100034832
500 Ga0070704_100007228
501 Ga0070704_100030232
502 Ga0070704_100065895
503 Ga0068855_100013504
504 Ga0068855_100046209
505 Ga0070664_100000561
506 Ga0068857_100000820
507 Ga0068857_100184105
508 Ga0068854_100095811
509 Ga0068856_100008597
510 Ga0068856_100077269
511 Ga0070702_100017994
512 Ga0070702_100118066
513 Ga0068852_100118664
514 Ga0068859_100020336
515 Ga0068864_100051418
516 Ga0068864_100062632
517 Ga0068866_10024366
518 Ga0068866_10075458
519 Ga0068861_100008418
520 Ga0068861_100030547
521 Ga0068861_100106833
522 Ga0068861_100145462
523 Ga0068861_100170491
524 Ga0068861_100202529
525 Ga0068870_10038393
526 Ga0068870_10122060
527 Ga0068863_100000950
528 Ga0068863_100016472
529 Ga0068863_100037974
530 Ga0068863_100093768
531 Ga0068858_100004170
532 Ga0068858_100008508
533 Ga0068858_100025142
534 Ga0068860_100066712
535 Ga0068860_100177003
536 Ga0068862_100009499
537 Ga0068862_100045178
538 Ga0068862_100057084
539 Ga0068862_100083271
540 Ga0068862_100085520
541 Ga0068862_100142511
542 Ga0068862_100237781
543 Ga0068862_100294732
544 Ga0081455_10014687
545 Ga0075368_10022383
546 Ga0075363_100025183
547 Ga0075362_10016459
548 Ga0075367_10008650
549 Ga0075366_10000300
550 Ga0075366_10002477
551 Ga0097621_100038498
552 Ga0097621_100067055
553 Ga0097621_100184884
554 Ga0075428_100000008
555 Ga0075428_100000064
556 Ga0075428_100000101
557 Ga0075428_100057473
558 Ga0075428_100175680
559 Ga0075433_10043754
560 Ga0075434_100000101
561 Ga0075434_100000625
562 Ga0075434_100031428
563 Ga0075429_100030576
564 Ga0068865_100025206
565 Ga0068865_100077022
566 Ga0075436_100000515
567 Ga0075436_100072269
568 Ga0075436_100083282
569 Ga0097620_100020336
570 Ga0075435_100000003
571 Ga0075435_100005554
572 Ga0075435_100006499
573 Ga0075435_100025344
574 Ga0075435_100047328
575 Ga0105240_10170069
576 Ga0105240_10185558
577 Ga0111539_10000020
578 Ga0111539_10000104
579 Ga0111539_10000315
580 Ga0111539_10002920
581 Ga0111539_10005475
582 Ga0111539_10005979
583 Ga0111539_10008514
584 Ga0111539_10018740
585 Ga0111539_10076102
586 Ga0111539_10197150
587 Ga0111539_10378568
588 Ga0105245_10143309
589 Ga0105245_10219414
590 Ga0105247_10002394
591 Ga0114129_10006723
592 Ga0114129_10010390
593 Ga0114129_10032965
594 Ga0114129_10044716
595 Ga0114129_10048533
596 Ga0114129_10183441
597 Ga0105243_10030309
598 Ga0105242_10068537
599 Ga0105242_10079454
600 Ga0105242_10111970
601 Ga0105242_10123730
602 Ga0105248_10037475
603 Ga0105248_10047280
604 Ga0105248_10187607
605 Ga0105248_10208780
606 Ga0105248_10221687
607 Ga0105237_10014297
608 Ga0105238_10002067
609 Ga0105249_10001746
610 Ga0105249_10018151
611 Ga0105249_10151727
612 Ga0105239_10006300
613 Ga0157370_10001603
614 Ga0157369_10006541
615 Ga0157378_10039655
616 Ga0157378_10044654
617 Ga0163162_10001608
618 Ga0163162_10038126
619 Ga0163162_10150903
620 Ga0157372_10007179
621 Ga0157372_10133115
622 Ga0157375_10125083
623 Ga0157375_10164119
624 Ga0163163_10001148
625 Ga0163163_10056672
626 Ga0163163_10084525
627 Ga0157380_10024171
628 Ga0157380_10025751
629 Ga0157380_10048331
630 Ga0157380_10067658
631 Ga0157380_10073940
632 Ga0157377_10002540
633 Ga0157379_10005597
634 Ga0157379_10010171
635 Ga0157379_10011549
636 Ga0157379_10048787
637 Ga0157379_10108700
638 Ga0157376_10022172
639 Ga0157376_10030400
640 Ga0157376_10062170
641 Ga0163161_10189741
642 Ga0197907_10460726
643 Ga0206356_10294409
644 Ga0224712_10010069
645 Ga0207697_10004120
646 Ga0207682_10000405
647 Ga0207682_10010995
648 Ga0207682_10033177
649 Ga0207642_10006653
650 Ga0207688_10000965
651 Ga0207680_10038145
652 Ga0207680_10080270
653 Ga0207645_10000952
654 Ga0207645_10006403
655 Ga0207645_10096084
656 Ga0207643_10000236
657 Ga0207705_10093113
658 Ga0207684_10111604
659 Ga0207707_10017629
660 Ga0207695_10031343
661 Ga0207671_10089316
662 Ga0207660_10002274
663 Ga0207662_10001511
664 Ga0207662_10012085
665 Ga0207662_10025968
666 Ga0207662_10101296
667 Ga0207649_10057437
668 Ga0207681_10004800
669 Ga0207681_10028264
670 Ga0207681_10051927
671 Ga0207681_10054642
672 Ga0207681_10128183
673 Ga0207694_10004486
674 Ga0207650_10011802
675 Ga0207650_10139269
676 Ga0207659_10052302
677 Ga0207659_10060446
678 Ga0207659_10112238
679 Ga0207687_10145962
680 Ga0207644_10015044
681 Ga0207644_10028707
682 Ga0207690_10110846
683 Ga0207706_10014807
684 Ga0207706_10019573
685 Ga0207706_10027931
686 Ga0207706_10215504
687 Ga0207686_10011012
688 Ga0207669_10000380
689 Ga0207669_10036243
690 Ga0207691_10007003
691 Ga0207691_10015472
692 Ga0207691_10020829
693 Ga0207691_10039323
694 Ga0207691_10106797
695 Ga0207711_10024842
696 Ga0207711_10028560
697 Ga0207711_10030675
698 Ga0207711_10061653
699 Ga0207711_10065361
700 Ga0207711_10066050
701 Ga0207711_10123600
702 Ga0207679_10135728
703 Ga0207651_10016642
704 Ga0207651_10019993
705 Ga0207651_10045001
706 Ga0207668_10062522
707 Ga0207668_10154611
708 Ga0207668_10170035
709 Ga0207640_10050033
710 Ga0207658_10031861
711 Ga0207677_10030429
712 Ga0207677_10036237
713 Ga0207703_10034856
714 Ga0207703_10059113
715 Ga0207703_10112997
716 Ga0207639_10092492
717 Ga0207678_10009778
718 Ga0207678_10102471
719 Ga0207708_10126581
720 Ga0207708_10134781
721 Ga0207702_10179231
722 Ga0207641_10001001
723 Ga0207641_10021373
724 Ga0207641_10101433
725 Ga0207648_10015297
726 Ga0207648_10019144
727 Ga0207648_10026466
728 Ga0207648_10027864
729 Ga0207648_10040591
730 Ga0207676_10022563
731 Ga0207676_10097551
732 Ga0207676_10178818
733 Ga0207674_10007384
734 Ga0207675_100001803
735 Ga0207675_100006532
736 Ga0207675_100046768
737 Ga0207675_100050309
738 Ga0207675_100205389
739 Ga0207683_10007394
740 Ga0207683_10067735
741 Ga0207683_10145652
742 Ga0207698_10085670
743 Ga0207428_10000005
744 Ga0207428_10000051
745 Ga0207428_10000143
746 Ga0207428_10016382
747 Ga0207428_10022200
748 Ga0207428_10023570
749 Ga0207428_10031234
750 Ga0268266_10026151
751 Ga0268266_10063808
752 Ga0268265_10014780
753 Ga0268265_10023716
754 Ga0268265_10139367
755 Ga0268264_10029963
756 Ga0265319_1005176
757 Ga0307408_100019758
758 Ga0307411_10044555
759 Ga0373959_0003287
760 Ga0373938_0001850
761 Ga0373928_0001362
762 Ga0373940_0000304
763 Ga0373949_0004081
764 Ga0373951_0007059
765 Ga0373952_0011681
766 Ga0373932_0032174
767 Ga0373939_0000251
768 Ga0373941_0000245
769 Ga0373960_0003963
770 Ga0373961_0000763
771 Ga0373931_0003187
772 Ga0373931_0051194
773 Ga0395898_0092228
774 Ga0450920_013473
775 Ga0450908_001283
776 Ga0451576_0002867
777 Ga0451576_0098551
778 Ga0495643_0006034
779 Ga0495669_0007789
780 Ga0496104_0141249
781 Ga0496106_0074018
782 Ga0496108_0050257
783 Ga0496108_0070135
784 Ga0496109_0185336
785 Ga0501036_0035703
786 Ga0501072_0011522
787 Ga0501072_0191828
788 Ga0501075_0014076
789 Ga0501076_0012267
790 Ga0501076_0021252
791 nmdc:mga0yw44_180027_c1
792 nmdc:mga0k408_11802_c1
793 nmdc:mga0k408_682_c1
794 nmdc:mga06z11_15788_c1
795 nmdc:mga06z11_38726_c1
796 nmdc:mga06z11_6371_c1
797 nmdc:mga07m45_76048_c1
798 nmdc:mga05p37_117214_c1
799 nmdc:mga05p37_129282_c1
800 nmdc:mga05p37_15824_c1
801 nmdc:mga05p37_62957_c1
802 nmdc:mga09592_229483_c1
803 nmdc:mga09592_26006_c1
804 nmdc:mga09592_62745_c1
805 nmdc:mga06r32_11977_c1
806 nmdc:mga08y16_121863_c1
807 nmdc:mga08y16_14083_c1
808 nmdc:mga08y16_25_c1
809 nmdc:mga08y16_289903_c1
810 nmdc:mga08y16_7840_c1
811 nmdc:mga08y16_8_c1
812 nmdc:mga08y16_9_c1
813 nmdc:mga0n895_159020_c1
814 nmdc:mga0n895_9_c1
815 nmdc:mga0rr50_219_c1
816 nmdc:mga0rr50_24921_c1
817 nmdc:mga0rr50_65279_c1
818 nmdc:mga0rr50_7_c1
819 nmdc:mga0rr50_8112_c1
820 nmdc:mga08x19_1296_c1
821 nmdc:mga08x19_13660_c1
822 nmdc:mga08x19_31793_c1
823 nmdc:mga08x19_75086_c1
824 nmdc:mga0a205_1271_c1
825 nmdc:mga0a205_19658_c1
826 nmdc:mga0a205_383796_c1
827 nmdc:mga0a205_71197_c1
828 Ga0495601_0078902
829 Ga0501082_0027217
830 Ga0501082_0048977

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07586

HXXSHH

Protein of unknown function (DUF1552)

42

347

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6vc7-assembly1.cif.gz_A structure of the f349a mutant of the periplasmic domain of yejm from salmonella typhimurium 0.6072 45 430
5i5d-assembly3.cif.gz_C salmonella global domain 245 0.5958 44 430
6v8q-assembly2.cif.gz_B structure of an inner membrane protein required for phopq regulated increases in outer membrane cardiolipin 0.5831 45 430
8j0h-assembly3.cif.gz_C crystal structure of the fission yeast rex1bd protein(c4h3.06) 0.5691 181 288
6xlp-assembly1.cif.gz_A structure of the essential inner membrane lipopolysaccharide-pbga complex 0.5581 45 430
ID Description Score Start End Superfamily
af_P0AD27_254_505_3.40.720.10 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.6036 45 416 3.40.720.10
4uopA02 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.5878 39 428 3.40.720.10
af_Q10214_1_137_1.10.287.1490 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.5817 179 288 1.10.287.1490
4uopA02 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.5814 39 428 3.40.720.10
af_P0AD27_254_505_3.40.720.10 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.581 45 416 3.40.720.10
ID Description Score Start End GO Terms
AF-A0A350QXW2-F1-model_v4 Uncharacterized protein 0.9814 345 436
AF-A0A2V8DTC8-F1-model_v4 DUF1552 domain-containing protein 0.9689 266 395
AF-A0A2V8H4H0-F1-model_v4 DUF1552 domain-containing protein 0.9664 277 436
AF-A0A3N5GB64-F1-model_v4 DUF1552 domain-containing protein 0.964 269 434
AF-A0A4Q3VQ31-F1-model_v4 DUF1552 domain-containing protein 0.9631 267 434

Map