F438792

General Info

Members Datasets Scaffolds Average Seq Length
416 278 392 332

Family's Representative Sequence

Representative Sequence 3300009551|Ga0105238_10160606|Ga0105238_101606062
Length 362
Sequence MPDFLIRWDQLQHRQQRNTAMAMLETANQTSGKPSANLVKHTRVLPVDNQNGYQAFEAGSFTFRRDEYFARISWPGGSHVMPIDYFMRALMRDVAWGFFYGTVNFDSVVGTTNHYGEVVLFAGLYNDAFRNAGRDFSERFSSDTLMGVFKAMVRNWTNEGYDPFAAPLETGAPWGKKHGDNDDAVDRLRVTAKRMVGLPGDTPVRTDANGFPVNRMFADVPQDQPKVEVEPGFEHEVSAYNLFGYLSRSDVTWNPSVCSVVKDSLFCPTSEEFILPVDHGNDRCEWFVVLTDEIVWDVKDKHSGKNRARVIMKAGDVSCMPADIRHTGYADKRSMLLVWENASPKIPELIQSGKAPVVSVSF

Samples

Sample ID Description Type Environment
1 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
2 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
3 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
4 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
5 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
6 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
7 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
8 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
9 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
10 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
11 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
12 2858950400 Achromobacter sp. K91 Isolate Unclassified
13 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
14 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
15 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
16 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
17 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
18 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
19 2928163908 Burkholderia sp. 567 Isolate Unclassified
20 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
21 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
22 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
23 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
24 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
25 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
26 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
27 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
28 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
29 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
30 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
31 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
32 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
33 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
34 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
35 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
36 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
37 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
38 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
39 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
40 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
41 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
42 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
43 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
44 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
45 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
46 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
47 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
48 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
49 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
50 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
51 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
52 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
53 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
54 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
55 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
56 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
57 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
58 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
59 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
60 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
61 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
62 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
63 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
64 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
65 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
66 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
67 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
68 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
69 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
70 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
71 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
72 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
73 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
74 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
75 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
76 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
77 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
78 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
79 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
80 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
81 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
82 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
83 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
84 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
85 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
86 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
88 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
89 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
90 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
91 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
92 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
93 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
94 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
96 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
97 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
98 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
99 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
101 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
102 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
103 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
104 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
105 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
106 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
107 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
108 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
109 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
110 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
111 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
112 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
113 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
114 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
115 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
116 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
117 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
118 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
119 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
125 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
175 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
180 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
181 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
182 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
183 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
184 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
185 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
186 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
187 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
188 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
189 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
190 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
191 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
192 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
193 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
194 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
195 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
196 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
197 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
198 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
199 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
200 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
201 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
202 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
203 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
204 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
205 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
206 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
207 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
208 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
209 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
210 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
211 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
212 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
213 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
214 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
215 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
216 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
217 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
218 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
219 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
220 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
221 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
222 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
223 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
224 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
225 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
226 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
227 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
228 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
229 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
230 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
231 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
232 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
233 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
234 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
235 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
236 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
237 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
238 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
239 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
240 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
241 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
242 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
243 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
244 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
245 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
246 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
247 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
254 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
255 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
256 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
257 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
258 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
259 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
260 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
261 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
262 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
263 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
264 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
265 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
266 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
267 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
268 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
269 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
270 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
271 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
272 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
273 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
274 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
275 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
276 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
277 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
278 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 93.99
Metatranscriptomes 0.24
Isolates 5.77

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.69
Nodule 2.64
Rhizoplane 4.57
Rhizosphere 80.77
Stem 0
Stem Tuber 0
Unclassified 4.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10015848 3300001989 Bacteria 2735
2 JGI25151J46595_10019336 3300003187 Bacteria 2896
3 Ga0055532_1000270 3300003758 Bacteria 33945
4 Ga0055527_1000216 3300003760 Bacteria 37363
5 Ga0055535_1000512 3300003761 Bacteria 33945
6 Ga0055542_1001562 3300003762 Bacteria 10761
7 Ga0058863_10770902 3300004799 Bacteria 1339
8 Ga0065712_10086196 3300005290 Bacteria 2628
9 Ga0065715_10090092 3300005293 Bacteria 7698
10 Ga0070658_10015364 3300005327 Bacteria 6126
11 Ga0070683_100212621 3300005329 Bacteria 1837
12 Ga0070690_100002283 3300005330 Bacteria 10279
13 Ga0070690_100117205 3300005330 Bacteria 1784
14 Ga0068869_100013219 3300005334 Bacteria 5485
15 Ga0070666_10003517 3300005335 Bacteria 9497
16 Ga0070666_10014159 3300005335 Bacteria 5075
17 Ga0070680_100010032 3300005336 Bacteria 7295
18 Ga0070680_100020106 3300005336 Bacteria 5295
19 Ga0068868_100151429 3300005338 Bacteria 1910
20 Ga0070660_100000112 3300005339 Bacteria 50685
21 Ga0070689_100004156 3300005340 Bacteria 9759
22 Ga0070661_100031441 3300005344 Bacteria 3840
23 Ga0070661_100100538 3300005344 Bacteria 2150
24 Ga0070668_100026964 3300005347 Bacteria 4361
25 Ga0070669_100037397 3300005353 Bacteria 3521
26 Ga0070675_100005004 3300005354 Bacteria 10119
27 Ga0070671_100150926 3300005355 Bacteria 1962
28 Ga0070674_100161826 3300005356 Bacteria 1699
29 Ga0070673_100013594 3300005364 Bacteria 5639
30 Ga0070659_100000020 3300005366 Bacteria 155952
31 Ga0070659_100113602 3300005366 Bacteria 2188
32 Ga0070667_100021300 3300005367 Bacteria 5385
33 Ga0070667_100029809 3300005367 Bacteria 4549
34 Ga0070709_10302733 3300005434 Bacteria 1168
35 Ga0070701_10002417 3300005438 Bacteria 7196
36 Ga0070705_100058182 3300005440 Bacteria 2284
37 Ga0070700_100016317 3300005441 Bacteria 4229
38 Ga0070700_100219689 3300005441 Bacteria 1346
39 Ga0070694_100091749 3300005444 Bacteria 2133
40 Ga0070708_100486616 3300005445 Bacteria 1164
41 Ga0070663_100004241 3300005455 Bacteria 8391
42 Ga0070678_100099837 3300005456 Bacteria 2247
43 Ga0070662_100037204 3300005457 Bacteria 3449
44 Ga0070662_100038118 3300005457 Bacteria 3413
45 Ga0070681_10001778 3300005458 Bacteria 19335
46 Ga0070681_10027147 3300005458 Bacteria 5756
47 Ga0070681_10149379 3300005458 Bacteria 2264
48 Ga0068867_100028196 3300005459 Bacteria 4041
49 Ga0068867_100034327 3300005459 Bacteria 3676
50 Ga0070685_10002147 3300005466 Bacteria 10163
51 Ga0070679_100052542 3300005530 Bacteria 4058
52 Ga0070679_100085446 3300005530 Bacteria 3143
53 Ga0070679_100253670 3300005530 Bacteria 1715
54 Ga0070684_100000868 3300005535 Bacteria 21380
55 Ga0070684_100264658 3300005535 Bacteria 1573
56 Ga0070672_100010887 3300005543 Bacteria 6326
57 Ga0070686_100002186 3300005544 Bacteria 10798
58 Ga0070686_100078767 3300005544 Bacteria 2177
59 Ga0070665_100197084 3300005548 Bacteria 2015
60 Ga0070665_100471588 3300005548 Bacteria 1266
61 Ga0068855_100000430 3300005563 Bacteria 51996
62 Ga0068855_100011937 3300005563 Bacteria 10503
63 Ga0070664_100001699 3300005564 Bacteria 17637
64 Ga0070664_100194772 3300005564 Bacteria 1807
65 Ga0068857_100008492 3300005577 Bacteria 8879
66 Ga0068854_100188428 3300005578 Bacteria 1615
67 Ga0068856_100318859 3300005614 Bacteria 1571
68 Ga0068856_100429969 3300005614 Bacteria 1340
69 Ga0070702_100029730 3300005615 Bacteria 2974
70 Ga0070702_100098791 3300005615 Bacteria 1786
71 Ga0068852_100024865 3300005616 Bacteria 4846
72 Ga0068859_100013300 3300005617 Bacteria 8258
73 Ga0068859_100106254 3300005617 Bacteria 2867
74 Ga0068859_100107666 3300005617 Bacteria 2848
75 Ga0068864_100002495 3300005618 Bacteria 15209
76 Ga0068866_10017021 3300005718 Bacteria 3263
77 Ga0068866_10194679 3300005718 Bacteria 1207
78 Ga0068863_100008564 3300005841 Bacteria 9997
79 Ga0068863_100066315 3300005841 Bacteria 3415
80 Ga0068858_100025893 3300005842 Bacteria 5456
81 Ga0068858_100068172 3300005842 Bacteria 3296
82 Ga0068860_100003514 3300005843 Bacteria 16128
83 Ga0068860_100003553 3300005843 Bacteria 16033
84 Ga0068860_100041843 3300005843 Bacteria 4377
85 Ga0068860_100156228 3300005843 Bacteria 2198
86 Ga0068862_100000566 3300005844 Bacteria 38602
87 Ga0068862_100044286 3300005844 Bacteria 3795
88 Ga0070717_10054063 3300006028 Bacteria 3311
89 Ga0075365_10000571 3300006038 Bacteria 14316
90 Ga0075365_10073252 3300006038 Bacteria 2308
91 Ga0075368_10013360 3300006042 Bacteria 3014
92 Ga0075363_100014921 3300006048 Bacteria 3809
93 Ga0075363_100046096 3300006048 Bacteria 2312
94 Ga0075364_10029136 3300006051 Bacteria 3538
95 Ga0075364_10030115 3300006051 Bacteria 3482
96 Ga0075364_10094458 3300006051 Bacteria 1987
97 Ga0075364_10104659 3300006051 Bacteria 1885
98 Ga0075362_10015485 3300006177 Bacteria 3103
99 Ga0075367_10014276 3300006178 Bacteria 4296
100 Ga0097621_100002638 3300006237 Bacteria 12277
101 Ga0097621_100043639 3300006237 Bacteria 3615
102 Ga0097621_100250994 3300006237 Bacteria 1549
103 Ga0068871_100005961 3300006358 Bacteria 8581
104 Ga0068871_100145089 3300006358 Bacteria 2020
105 Ga0068871_100276696 3300006358 Bacteria 1467
106 Ga0075428_100003068 3300006844 Bacteria 18228
107 Ga0075430_100001123 3300006846 Bacteria 21301
108 Ga0075431_100004037 3300006847 Bacteria 14300
109 Ga0075433_10144248 3300006852 Bacteria 2117
110 Ga0075429_100001435 3300006880 Bacteria 19555
111 Ga0068865_100006307 3300006881 Bacteria 7225
112 Ga0068865_100086370 3300006881 Bacteria 2265
113 Ga0097620_100013299 3300006931 Bacteria 8258
114 Ga0097620_100106253 3300006931 Bacteria 2867
115 Ga0097620_100107664 3300006931 Bacteria 2848
116 Ga0105250_10009591 3300009092 Bacteria 4072
117 Ga0105240_10002678 3300009093 Bacteria 28344
118 Ga0105240_10012414 3300009093 Bacteria 11761
119 Ga0105240_10023883 3300009093 Bacteria 8075
120 Ga0105240_10223951 3300009093 Bacteria 2190
121 Ga0105245_10006965 3300009098 Bacteria 9915
122 Ga0105245_10051591 3300009098 Bacteria 3687
123 Ga0105245_10174244 3300009098 Bacteria 2051
124 Ga0105245_10261226 3300009098 Bacteria 1685
125 Ga0105247_10088839 3300009101 Bacteria 1959
126 Ga0114129_10000308 3300009147 Bacteria 57015
127 Ga0105243_10058159 3300009148 Bacteria 3080
128 Ga0105241_10076022 3300009174 Bacteria 2618
129 Ga0105241_10122958 3300009174 Bacteria 2092
130 Ga0105242_10015719 3300009176 Bacteria 5880
131 Ga0105242_10025391 3300009176 Bacteria 4689
132 Ga0105242_10044856 3300009176 Bacteria 3581
133 Ga0105242_10048399 3300009176 Plasmid 3455
134 Ga0105248_10002359 3300009177 Bacteria 20966
135 Ga0105248_10012894 3300009177 Bacteria 9217
136 Ga0105248_10027479 3300009177 Bacteria 6335
137 Ga0105248_10183056 3300009177 Bacteria 2361
138 Ga0105237_10013461 3300009545 Bacteria 8578
139 Ga0105237_10184657 3300009545 Bacteria 2085
140 Ga0105238_10036470 3300009551 Bacteria 4998
141 Ga0105238_10062019 3300009551 Bacteria 3740
142 Ga0105238_10160606 3300009551 Bacteria 2223
143 Ga0105249_10040793 3300009553 Bacteria 4217
144 Ga0105249_10088797 3300009553 Bacteria 2887
145 Ga0105239_10073064 3300010375 Bacteria 3771
146 Ga0105239_10112621 3300010375 Bacteria 3017
147 Ga0105239_10361640 3300010375 Bacteria 1639
148 Ga0105239_10378026 3300010375 Bacteria 1601
149 Ga0157369_10394478 3300013105 Bacteria 1436
150 Ga0157374_10216315 3300013296 Bacteria 1879
151 Ga0157378_10039640 3300013297 Bacteria 4178
152 Ga0157378_10129481 3300013297 Bacteria 2334
153 Ga0157378_10141618 3300013297 Bacteria 2233
154 Ga0163162_10031395 3300013306 Bacteria 5269
155 Ga0163162_10091644 3300013306 Bacteria 3122
156 Ga0163162_10104179 3300013306 Bacteria 2931
157 Ga0163162_10557924 3300013306 Bacteria 1273
158 Ga0157375_10207173 3300013308 Bacteria 2118
159 Ga0163163_10005250 3300014325 Bacteria 11170
160 Ga0163163_10037115 3300014325 Bacteria 4738
161 Ga0163163_10098422 3300014325 Bacteria 2946
162 Ga0157377_10023109 3300014745 Bacteria 3292
163 Ga0157377_10149301 3300014745 Bacteria 1444
164 Ga0157379_10005107 3300014968 Bacteria 11253
165 Ga0157376_10016634 3300014969 Bacteria 5590
166 Ga0182006_1039684 3300015261 Bacteria 1856
167 Ga0182005_1003786 3300015265 Bacteria 5028
168 Ga0209672_100012 3300025228 Bacteria 795742
169 Ga0209147_100007 3300025229 Bacteria 795684
170 Ga0209258_100014 3300025242 Bacteria 720132
171 Ga0209148_1000745 3300025254 Bacteria 25089
172 Ga0209455_1000269 3300025272 Bacteria 58101
173 Ga0209025_1000034 3300025294 Bacteria 413205
174 Ga0209025_1001026 3300025294 Bacteria 41040
175 Ga0207696_1018805 3300025711 Bacteria 2262
176 Ga0207682_10061133 3300025893 Bacteria 1577
177 Ga0207642_10003279 3300025899 Bacteria 5089
178 Ga0207642_10089982 3300025899 Bacteria 1513
179 Ga0207688_10009582 3300025901 Bacteria 5274
180 Ga0207680_10057638 3300025903 Bacteria 2351
181 Ga0207680_10074992 3300025903 Bacteria 2108
182 Ga0207647_10003241 3300025904 Bacteria 12212
183 Ga0207645_10042283 3300025907 Bacteria 2916
184 Ga0207643_10166842 3300025908 Bacteria 1327
185 Ga0207705_10020301 3300025909 Bacteria 4751
186 Ga0207654_10187207 3300025911 Bacteria 1354
187 Ga0207707_10024699 3300025912 Bacteria 5258
188 Ga0207707_10166155 3300025912 Bacteria 1928
189 Ga0207695_10006989 3300025913 Bacteria 14487
190 Ga0207695_10023844 3300025913 Bacteria 6906
191 Ga0207695_10026351 3300025913 Bacteria 6488
192 Ga0207695_10108986 3300025913 Bacteria 2752
193 Ga0207671_10034374 3300025914 Bacteria 3766
194 Ga0207671_10148866 3300025914 Bacteria 1808
195 Ga0207693_10025898 3300025915 Bacteria 4646
196 Ga0207660_10081493 3300025917 Bacteria 2378
197 Ga0207660_10163455 3300025917 Bacteria 1719
198 Ga0207662_10001692 3300025918 Bacteria 10797
199 Ga0207662_10017020 3300025918 Bacteria 4107
200 Ga0207662_10030869 3300025918 Bacteria 3113
201 Ga0207662_10093015 3300025918 Bacteria 1857
202 Ga0207657_10000338 3300025919 Bacteria 49545
203 Ga0207649_10021564 3300025920 Bacteria 3711
204 Ga0207652_10014371 3300025921 Bacteria 6413
205 Ga0207652_10161214 3300025921 Bacteria 2011
206 Ga0207652_10205769 3300025921 Bacteria 1771
207 Ga0207681_10098570 3300025923 Bacteria 2103
208 Ga0207694_10069806 3300025924 Bacteria 2745
209 Ga0207659_10007470 3300025926 Bacteria 6724
210 Ga0207687_10006401 3300025927 Bacteria 7778
211 Ga0207690_10000011 3300025932 Bacteria 295252
212 Ga0207690_10036913 3300025932 Bacteria 3168
213 Ga0207706_10012739 3300025933 Bacteria 7655
214 Ga0207706_10160563 3300025933 Bacteria 1976
215 Ga0207686_10191378 3300025934 Unclassified 1459
216 Ga0207709_10187499 3300025935 Bacteria 1466
217 Ga0207670_10041378 3300025936 Bacteria 3030
218 Ga0207670_10041711 3300025936 Bacteria 3019
219 Ga0207704_10028724 3300025938 Bacteria 3090
220 Ga0207691_10015212 3300025940 Bacteria 7320
221 Ga0207711_10013695 3300025941 Bacteria 6734
222 Ga0207689_10003752 3300025942 Bacteria 13843
223 Ga0207689_10018189 3300025942 Bacteria 5933
224 Ga0207661_10092787 3300025944 Bacteria 2518
225 Ga0207661_10181942 3300025944 Bacteria 1837
226 Ga0207679_10013208 3300025945 Bacteria 5410
227 Ga0207679_10198307 3300025945 Bacteria 1675
228 Ga0207667_10148360 3300025949 Bacteria 2414
229 Ga0207651_10003489 3300025960 Bacteria 7725
230 Ga0207712_10007074 3300025961 Bacteria 7075
231 Ga0207712_10149019 3300025961 Bacteria 1805
232 Ga0207712_10179652 3300025961 Bacteria 1661
233 Ga0207668_10005357 3300025972 Bacteria 7545
234 Ga0207658_10069752 3300025986 Bacteria 2657
235 Ga0207658_10071622 3300025986 Bacteria 2625
236 Ga0207703_10016755 3300026035 Bacteria 5717
237 Ga0207703_10269073 3300026035 Bacteria 1543
238 Ga0207678_10001890 3300026067 Bacteria 19107
239 Ga0207708_10093112 3300026075 Bacteria 2326
240 Ga0207708_10245953 3300026075 Bacteria 1440
241 Ga0207641_10005895 3300026088 Bacteria 10394
242 Ga0207641_10198009 3300026088 Bacteria 1850
243 Ga0207648_10001655 3300026089 Bacteria 24414
244 Ga0207648_10007964 3300026089 Bacteria 10333
245 Ga0207676_10048908 3300026095 Bacteria 3285
246 Ga0207674_10041848 3300026116 Bacteria 4736
247 Ga0207675_100002981 3300026118 Bacteria 16638
248 Ga0207675_100066150 3300026118 Bacteria 3378
249 Ga0207675_100131931 3300026118 Bacteria 2369
250 Ga0207683_10100109 3300026121 Bacteria 2587
251 Ga0207698_10014744 3300026142 Bacteria 5208
252 Ga0209489_100172 3300027361 Bacteria 100396
253 Ga0209983_1004416 3300027665 Bacteria 2956
254 Ga0268266_10009712 3300028379 Bacteria 8457
255 Ga0268266_10023530 3300028379 Bacteria 5243
256 Ga0268266_10076003 3300028379 Bacteria 2918
257 Ga0268265_10001478 3300028380 Bacteria 19705
258 Ga0268265_10005847 3300028380 Bacteria 8387
259 Ga0268264_10011269 3300028381 Bacteria 7388
260 Ga0268264_10039827 3300028381 Bacteria 3882
261 Ga0268264_10076052 3300028381 Bacteria 2856
262 Ga0268264_10113594 3300028381 Bacteria 2376
263 Ga0265326_10017802 3300028558 Bacteria 2047
264 Ga0265319_1003129 3300028563 Bacteria 8734
265 Ga0265319_1026922 3300028563 Bacteria 2044
266 Ga0265334_10000609 3300028573 Bacteria 17990
267 Ga0265318_10000940 3300028577 Bacteria 18811
268 Ga0265318_10002345 3300028577 Bacteria 10156
269 Ga0265338_10024249 3300028800 Bacteria 6203
270 Ga0307511_10075417 3300030521 Bacteria 2421
271 Ga0307511_10141854 3300030521 Bacteria 1408
272 Ga0265330_10036637 3300031235 Bacteria 2186
273 Ga0265328_10013780 3300031239 Bacteria 3193
274 Ga0265325_10002388 3300031241 Bacteria 12688
275 Ga0265329_10023768 3300031242 Bacteria 2038
276 Ga0265340_10005732 3300031247 Bacteria 6861
277 Ga0265340_10093163 3300031247 Bacteria 1406
278 Ga0265339_10066575 3300031249 Bacteria 1928
279 Ga0265339_10088965 3300031249 Bacteria 1621
280 Ga0265339_10116819 3300031249 Bacteria 1375
281 Ga0265331_10004001 3300031250 Bacteria 9307
282 Ga0265331_10023843 3300031250 Bacteria 3102
283 Ga0265316_10049006 3300031344 Bacteria 3329
284 Ga0265316_10077625 3300031344 Bacteria 2550
285 Ga0265316_10141861 3300031344 Bacteria 1804
286 Ga0307509_10075330 3300031507 Bacteria 3505
287 Ga0307408_100037529 3300031548 Bacteria 3414
288 Ga0265313_10001116 3300031595 Bacteria 25640
289 Ga0265313_10024921 3300031595 Bacteria 3182
290 Ga0265314_10000582 3300031711 Bacteria 45932
291 Ga0265314_10002946 3300031711 Bacteria 16863
292 Ga0265314_10072033 3300031711 Bacteria 2310
293 Ga0265342_10002161 3300031712 Bacteria 17328
294 Ga0265342_10052258 3300031712 Bacteria 2436
295 Ga0307516_10010896 3300031730 Bacteria 9946
296 Ga0307416_100236514 3300032002 Bacteria 1766
297 Ga0307510_10011408 3300033180 Bacteria 10556
298 Ga0307510_10031102 3300033180 Bacteria 6036
299 Ga0373951_0026815 3300035091 Bacteria 1344
300 Ga0395900_0483562 3300037418 Bacteria 1190
301 Ga0395905_0000020 3300037471 Bacteria 337672
302 Ga0395905_0077993 3300037471 Bacteria 3104
303 Ga0395905_0091364 3300037471 Bacteria 2854
304 Ga0395905_0206530 3300037471 Bacteria 1841
305 Ga0436365_0730862 3300039437 Bacteria 4184
306 Ga0436365_1371760 3300039437 Bacteria 2146
307 Ga0466969_0005534 3300044656 Bacteria 6713
308 Ga0466965_0258146 3300044683 Bacteria 936
309 Ga0466966_0068721 3300044684 Bacteria 2224
310 Ga0466957_0005035 3300044842 Bacteria 7398
311 Ga0466960_0007726 3300044901 Bacteria 4379
312 Ga0451576_0032939 3300045051 Bacteria 5510
313 Ga0466958_0137863 3300045836 Bacteria 1535
314 Ga0495603_0001020 3300046455 Bacteria 16158
315 Ga0495629_0012125 3300046459 Bacteria 6247
316 Ga0495629_0062536 3300046459 Bacteria 2600
317 Ga0495641_0027244 3300046461 Bacteria 2781
318 Ga0495650_0033177 3300046471 Bacteria 2300
319 Ga0495580_0016575 3300046472 Bacteria 5527
320 Ga0495580_0018517 3300046472 Bacteria 5183
321 Ga0495628_0001336 3300046516 Bacteria 22630
322 Ga0495666_0016458 3300046526 Bacteria 3682
323 Ga0495652_0035178 3300046529 Bacteria 4360
324 Ga0495665_0053868 3300046531 Bacteria 2126
325 Ga0495640_0058270 3300046533 Bacteria 2634
326 Ga0495645_0079826 3300046543 Bacteria 2349
327 Ga0495625_0058511 3300046660 Bacteria 2739
328 Ga0495613_0001241 3300046689 Bacteria 19460
329 Ga0495613_0001959 3300046689 Bacteria 15623
330 Ga0495624_0015142 3300046690 Bacteria 5216
331 Ga0495649_0014764 3300046694 Bacteria 4464
332 Ga0495604_0005275 3300047317 Bacteria 10251
333 Ga0495674_0020791 3300047319 Bacteria 6076
334 Ga0495676_0020996 3300047321 Bacteria 5715
335 Ga0495676_0096802 3300047321 Bacteria 2193
336 Ga0495683_0001890 3300047323 Bacteria 13111
337 Ga0495679_003344 3300047446 Bacteria 7746
338 Ga0495686_0086803 3300047472 Bacteria 1904
339 Ga0496100_0012494 3300048903 Bacteria 4872
340 Ga0496101_0237732 3300048904 Bacteria 1417
341 Ga0496102_0077907 3300048905 Bacteria 3051
342 Ga0496104_0015654 3300048907 Bacteria 6878
343 Ga0496105_0040007 3300048908 Bacteria 3865
344 Ga0496106_0074617 3300048909 Bacteria 2597
345 Ga0496106_0127624 3300048909 Bacteria 1992
346 Ga0496107_0054083 3300048910 Bacteria 2897
347 Ga0496109_0046240 3300048912 Bacteria 3953
348 Ga0496110_0021205 3300048913 Bacteria 5496
349 Ga0496110_0044005 3300048913 Bacteria 3899
350 Ga0496110_0125346 3300048913 Bacteria 2317
351 Ga0496110_0138611 3300048913 Bacteria 2199
352 Ga0496111_0030266 3300048914 Bacteria 3850
353 Ga0496111_0094757 3300048914 Bacteria 2190
354 Ga0496111_0122907 3300048914 Bacteria 1918
355 Ga0496112_0124318 3300048915 Bacteria 2550
356 Ga0496113_0072764 3300048916 Bacteria 2617
357 Ga0496115_0092594 3300048918 Bacteria 2471
358 Ga0496125_0104386 3300048928 Bacteria 2076
359 Ga0501032_0068683 3300049569 Bacteria 2365
360 Ga0501034_0000106 3300049571 Bacteria 153523
361 Ga0501034_0043224 3300049571 Bacteria 4561
362 Ga0501041_0096355 3300049577 Bacteria 1829
363 Ga0501042_0047289 3300049578 Bacteria 3068
364 Ga0501047_0134696 3300049581 Bacteria 2351
365 Ga0501048_0112471 3300049582 Bacteria 1923
366 Ga0501071_0246604 3300049587 Bacteria 1347
367 Ga0501072_0053001 3300049588 Bacteria 3194
368 Ga0501075_0414730 3300049591 Bacteria 1027
369 Ga0501076_0031925 3300049592 Bacteria 4110
370 Ga0501076_0095175 3300049592 Bacteria 2399
371 Ga0501045_0086350 3300049824 Bacteria 2316
372 Ga0501045_0180722 3300049824 Bacteria 1572
373 nmdc:mga03683_7819_c1 3300050489 Bacteria 3730
374 nmdc:mga03n38_92665_c1 3300050490 Bacteria 1442
375 nmdc:mga00v17_29368_c1 3300050491 Bacteria 3227
376 nmdc:mga00v17_54682_c1 3300050491 Bacteria 2436
377 nmdc:mga00v17_66124_c1 3300050491 Bacteria 2232
378 nmdc:mga0yw44_1283_c1 3300050492 Bacteria 9910
379 nmdc:mga05p37_4597_c1 3300050507 Bacteria 16131
380 nmdc:mga09592_5949_c1 3300050508 Bacteria 9945
381 nmdc:mga0qj67_1933_c1 3300050509 Bacteria 14729
382 nmdc:mga06r32_624_c1 3300050510 Bacteria 30829
383 nmdc:mga08y16_152145_c1 3300050511 Bacteria 2405
384 nmdc:mga0a205_321805_c1 3300050515 Bacteria 1417
385 Ga0500554_075787 3300053102 Bacteria 1101
386 Ga0500616_0167855 3300053153 Bacteria 999
387 Ga0500622_0002410 3300053156 Bacteria 13513
388 Ga0501084_0135829 3300054114 Bacteria 2070
389 Ga0501082_0003544 3300060353 Bacteria 13632
390 Ga0466962_0001254 3300061719 Bacteria 11703
391 Ga0530510_0037299 3300061734 Bacteria 3504
392 Ga0530510_0267771 3300061734 Bacteria 1275

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044683 Ga0466965_0258146 Ga0466965_0258146_20_841 269
2 3300053153 Ga0500616_0167855 Ga0500616_0167855_12_836 270
3 3300046461 Ga0495641_0027244 Ga0495641_0027244_1713_2684 303
4 3300049587 Ga0501071_0246604 Ga0501071_0246604_270_1238 304
5 3300049824 Ga0501045_0180722 Ga0501045_0180722_20_988 304
6 3300049592 Ga0501076_0095175 Ga0501076_0095175_1209_2180 305
7 3300006048 Ga0075363_100014921 Ga0075363_1000149213 307
8 3300009098 Ga0105245_10174244 Ga0105245_101742442 309
9 3300009148 Ga0105243_10058159 Ga0105243_100581594 309
10 3300009176 Ga0105242_10044856 Ga0105242_100448563 309
11 3300013297 Ga0157378_10039640 Ga0157378_100396404 309
12 3300013306 Ga0163162_10557924 Ga0163162_105579242 309
13 3300014968 Ga0157379_10005107 Ga0157379_100051074 309
14 3300046689 Ga0495613_0001959 Ga0495613_0001959_7298_8308 309
15 3300048903 Ga0496100_0012494 Ga0496100_0012494_577_1545 309
16 3300048905 Ga0496102_0077907 Ga0496102_0077907_838_1806 309
17 3300048907 Ga0496104_0015654 Ga0496104_0015654_2179_3147 309
18 3300048908 Ga0496105_0040007 Ga0496105_0040007_640_1608 309
19 3300048909 Ga0496106_0074617 Ga0496106_0074617_723_1691 309
20 3300048910 Ga0496107_0054083 Ga0496107_0054083_1370_2338 309
21 3300048913 Ga0496110_0021205 Ga0496110_0021205_3087_4055 309
22 3300048914 Ga0496111_0030266 Ga0496111_0030266_1207_2175 309
23 3300028563 Ga0265319_1026922 Ga0265319_10269222 310
24 3300005330 Ga0070690_100117205 Ga0070690_1001172052 311
25 3300005356 Ga0070674_100161826 Ga0070674_1001618262 311
26 3300005459 Ga0068867_100034327 Ga0068867_1000343272 311
27 3300005544 Ga0070686_100078767 Ga0070686_1000787672 311
28 3300005617 Ga0068859_100106254 Ga0068859_1001062542 311
29 3300005718 Ga0068866_10017021 Ga0068866_100170212 311
30 3300006881 Ga0068865_100086370 Ga0068865_1000863703 311
31 3300006931 Ga0097620_100106253 Ga0097620_1001062532 311
32 3300013297 Ga0157378_10129481 Ga0157378_101294812 311
33 3300025899 Ga0207642_10003279 Ga0207642_100032794 311
34 3300025918 Ga0207662_10017020 Ga0207662_100170204 311
35 3300025923 Ga0207681_10098570 Ga0207681_100985703 311
36 3300025933 Ga0207706_10160563 Ga0207706_101605632 311
37 3300025936 Ga0207670_10041711 Ga0207670_100417113 311
38 3300025961 Ga0207712_10179652 Ga0207712_101796522 311
39 3300026075 Ga0207708_10093112 Ga0207708_100931123 311
40 3300026089 Ga0207648_10001655 Ga0207648_1000165523 311
41 3300026118 Ga0207675_100131931 Ga0207675_1001319312 311
42 3300048904 Ga0496101_0237732 Ga0496101_0237732_58_1032 311
43 3300049588 Ga0501072_0053001 Ga0501072_0053001_496_1479 312
44 3300054114 Ga0501084_0135829 Ga0501084_0135829_1002_1985 312
45 3300061734 Ga0530510_0037299 Ga0530510_0037299_2395_3378 312
46 3300009098 Ga0105245_10261226 Ga0105245_102612262 313
47 3300010375 Ga0105239_10361640 Ga0105239_103616402 313
48 3300013308 Ga0157375_10207173 Ga0157375_102071733 313
49 3300014745 Ga0157377_10149301 Ga0157377_101493012 313
50 3300048913 Ga0496110_0044005 Ga0496110_0044005_1277_2260 313
51 3300048914 Ga0496111_0094757 Ga0496111_0094757_43_1026 313
52 3300049577 Ga0501041_0096355 Ga0501041_0096355_520_1503 313
53 3300049578 Ga0501042_0047289 Ga0501042_0047289_1817_2800 313
54 3300049582 Ga0501048_0112471 Ga0501048_0112471_242_1225 313
55 3300049591 Ga0501075_0414730 Ga0501075_0414730_11_994 313
56 3300049592 Ga0501076_0031925 Ga0501076_0031925_2550_3533 313
57 3300048918 Ga0496115_0092594 Ga0496115_0092594_815_1813 319
58 3300053102 Ga0500554_075787 Ga0500554_075787_29_1066 320
59 3300006028 Ga0070717_10054063 Ga0070717_100540633 321
60 3300006051 Ga0075364_10104659 Ga0075364_101046592 321
61 3300005843 Ga0068860_100156228 Ga0068860_1001562281 322
62 3300013296 Ga0157374_10216315 Ga0157374_102163152 322
63 3300025915 Ga0207693_10025898 Ga0207693_100258984 322
64 3300027665 Ga0209983_1004416 Ga0209983_10044162 322
65 3300028381 Ga0268264_10076052 Ga0268264_100760522 322
66 3300033180 Ga0307510_10031102 Ga0307510_100311022 322
67 3300046660 Ga0495625_0058511 Ga0495625_0058511_436_1458 322
68 3300049569 Ga0501032_0068683 Ga0501032_0068683_1049_2071 322
69 3300005548 Ga0070665_100471588 Ga0070665_1004715882 323
70 3300005843 Ga0068860_100003553 Ga0068860_1000035536 323
71 3300009174 Ga0105241_10076022 Ga0105241_100760222 323
72 3300009176 Ga0105242_10025391 Ga0105242_100253911 323
73 3300009177 Ga0105248_10002359 Ga0105248_1000235913 323
74 3300049571 Ga0501034_0043224 Ga0501034_0043224_1124_2146 323
75 3300025908 Ga0207643_10166842 Ga0207643_101668422 324
76 3300025918 Ga0207662_10030869 Ga0207662_100308691 324
77 3300025918 Ga0207662_10093015 Ga0207662_100930152 324
78 3300025942 Ga0207689_10018189 Ga0207689_100181894 324
79 3300035091 Ga0373951_0026815 Ga0373951_0026815_139_1125 324
80 3300028558 Ga0265326_10017802 Ga0265326_100178022 325
81 3300028563 Ga0265319_1003129 Ga0265319_100312913 325
82 3300028573 Ga0265334_10000609 Ga0265334_1000060911 325
83 3300028577 Ga0265318_10002345 Ga0265318_100023458 325
84 3300031239 Ga0265328_10013780 Ga0265328_100137803 325
85 3300031241 Ga0265325_10002388 Ga0265325_100023888 325
86 3300031247 Ga0265340_10005732 Ga0265340_100057322 325
87 3300031249 Ga0265339_10066575 Ga0265339_100665752 325
88 3300031595 Ga0265313_10024921 Ga0265313_100249212 325
89 3300031712 Ga0265342_10002161 Ga0265342_100021614 325
90 3300048913 Ga0496110_0125346 Ga0496110_0125346_868_1851 325
91 3300049824 Ga0501045_0086350 Ga0501045_0086350_1115_2098 325
92 3300061734 Ga0530510_0267771 Ga0530510_0267771_153_1136 325
93 iso_pu_bacteria 2858688981 2858690849 325
94 3300009093 Ga0105240_10002678 Ga0105240_1000267829 326
95 3300009551 Ga0105238_10160606 Ga0105238_101606062 326
96 3300010375 Ga0105239_10073064 Ga0105239_100730643 326
97 3300025913 Ga0207695_10006989 Ga0207695_100069893 326
98 3300031242 Ga0265329_10023768 Ga0265329_100237682 326
99 3300031249 Ga0265339_10088965 Ga0265339_100889652 326
100 3300031249 Ga0265339_10116819 Ga0265339_101168192 326
101 3300031344 Ga0265316_10049006 Ga0265316_100490061 326
102 3300031344 Ga0265316_10141861 Ga0265316_101418612 326
103 3300031711 Ga0265314_10072033 Ga0265314_100720332 326
104 3300005335 Ga0070666_10003517 Ga0070666_100035179 327
105 3300005338 Ga0068868_100151429 Ga0068868_1001514293 327
106 3300005367 Ga0070667_100029809 Ga0070667_1000298094 327
107 3300005617 Ga0068859_100107666 Ga0068859_1001076664 327
108 3300005841 Ga0068863_100066315 Ga0068863_1000663154 327
109 3300005842 Ga0068858_100068172 Ga0068858_1000681723 327
110 3300005843 Ga0068860_100003514 Ga0068860_1000035143 327
111 3300006237 Ga0097621_100002638 Ga0097621_10000263814 327
112 3300006358 Ga0068871_100005961 Ga0068871_1000059613 327
113 3300006931 Ga0097620_100107664 Ga0097620_1001076642 327
114 3300009098 Ga0105245_10006965 Ga0105245_100069654 327
115 3300009176 Ga0105242_10015719 Ga0105242_100157194 327
116 3300009177 Ga0105248_10012894 Ga0105248_100128946 327
117 3300010375 Ga0105239_10378026 Ga0105239_103780262 327
118 3300013306 Ga0163162_10091644 Ga0163162_100916444 327
119 3300014325 Ga0163163_10098422 Ga0163163_100984223 327
120 3300014969 Ga0157376_10016634 Ga0157376_100166343 327
121 3300025903 Ga0207680_10074992 Ga0207680_100749923 327
122 3300025927 Ga0207687_10006401 Ga0207687_100064017 327
123 3300025986 Ga0207658_10069752 Ga0207658_100697521 327
124 3300026035 Ga0207703_10016755 Ga0207703_100167555 327
125 3300026088 Ga0207641_10198009 Ga0207641_101980092 327
126 3300028381 Ga0268264_10113594 Ga0268264_101135943 327
127 3300028800 Ga0265338_10024249 Ga0265338_100242492 327
128 3300031711 Ga0265314_10000582 Ga0265314_1000058241 327
129 3300053156 Ga0500622_0002410 Ga0500622_0002410_8632_9663 327
130 3300049581 Ga0501047_0134696 Ga0501047_0134696_293_1291 328
131 3300060353 Ga0501082_0003544 Ga0501082_0003544_9234_10325 328
132 3300005445 Ga0070708_100486616 Ga0070708_1004866161 329
133 3300005614 Ga0068856_100429969 Ga0068856_1004299692 329
134 3300009098 Ga0105245_10051591 Ga0105245_100515913 329
135 3300009551 Ga0105238_10036470 Ga0105238_100364705 329
136 3300013105 Ga0157369_10394478 Ga0157369_103944782 329
137 3300025913 Ga0207695_10108986 Ga0207695_101089863 329
138 3300027361 Ga0209489_100172 Ga0209489_10017264 329
139 3300028379 Ga0268266_10009712 Ga0268266_100097127 329
140 3300028577 Ga0265318_10000940 Ga0265318_1000094014 329
141 3300030521 Ga0307511_10075417 Ga0307511_100754172 329
142 3300030521 Ga0307511_10141854 Ga0307511_101418542 329
143 3300031247 Ga0265340_10093163 Ga0265340_100931632 329
144 3300031250 Ga0265331_10004001 Ga0265331_100040016 329
145 3300031507 Ga0307509_10075330 Ga0307509_100753304 329
146 3300031595 Ga0265313_10001116 Ga0265313_100011165 329
147 3300031711 Ga0265314_10002946 Ga0265314_1000294611 329
148 3300031712 Ga0265342_10052258 Ga0265342_100522582 329
149 3300031730 Ga0307516_10010896 Ga0307516_1001089610 329
150 3300033180 Ga0307510_10011408 Ga0307510_100114087 329
151 3300039437 Ga0436365_1371760 Ga0436365_1371760_622_1662 329
152 3300050491 nmdc:mga00v17_54682_c1 nmdc:mga00v17_54682_c1_486_1481 329
153 3300005329 Ga0070683_100212621 Ga0070683_1002126212 330
154 3300006038 Ga0075365_10000571 Ga0075365_100005719 330
155 3300006038 Ga0075365_10073252 Ga0075365_100732523 330
156 3300006042 Ga0075368_10013360 Ga0075368_100133603 330
157 3300006048 Ga0075363_100046096 Ga0075363_1000460963 330
158 3300006051 Ga0075364_10029136 Ga0075364_100291362 330
159 3300006051 Ga0075364_10030115 Ga0075364_100301153 330
160 3300006051 Ga0075364_10094458 Ga0075364_100944582 330
161 3300006177 Ga0075362_10015485 Ga0075362_100154853 330
162 3300006178 Ga0075367_10014276 Ga0075367_100142763 330
163 3300009176 Ga0105242_10048399 Ga0105242_100483993 330
164 3300025934 Ga0207686_10191378 Ga0207686_101913781 330
165 3300025944 Ga0207661_10181942 Ga0207661_101819422 330
166 3300031250 Ga0265331_10023843 Ga0265331_100238432 330
167 3300037471 Ga0395905_0206530 Ga0395905_0206530_401_1405 330
168 3300047472 Ga0495686_0086803 Ga0495686_0086803_189_1196 330
169 3300050489 nmdc:mga03683_7819_c1 nmdc:mga03683_7819_c1_1465_2463 330
170 3300050490 nmdc:mga03n38_92665_c1 nmdc:mga03n38_92665_c1_40_1038 330
171 3300050491 nmdc:mga00v17_29368_c1 nmdc:mga00v17_29368_c1_377_1375 330
172 3300050491 nmdc:mga00v17_66124_c1 nmdc:mga00v17_66124_c1_741_1739 330
173 3300050492 nmdc:mga0yw44_1283_c1 nmdc:mga0yw44_1283_c1_6868_7866 330
174 3300004799 Ga0058863_10770902 Ga0058863_107709022 331
175 3300005290 Ga0065712_10086196 Ga0065712_100861963 331
176 3300005293 Ga0065715_10090092 Ga0065715_100900925 331
177 3300005330 Ga0070690_100002283 Ga0070690_1000022835 331
178 3300005334 Ga0068869_100013219 Ga0068869_1000132194 331
179 3300005335 Ga0070666_10014159 Ga0070666_100141593 331
180 3300005336 Ga0070680_100020106 Ga0070680_1000201065 331
181 3300005340 Ga0070689_100004156 Ga0070689_1000041562 331
182 3300005344 Ga0070661_100100538 Ga0070661_1001005382 331
183 3300005347 Ga0070668_100026964 Ga0070668_1000269643 331
184 3300005353 Ga0070669_100037397 Ga0070669_1000373974 331
185 3300005354 Ga0070675_100005004 Ga0070675_1000050049 331
186 3300005355 Ga0070671_100150926 Ga0070671_1001509261 331
187 3300005364 Ga0070673_100013594 Ga0070673_1000135942 331
188 3300005366 Ga0070659_100113602 Ga0070659_1001136022 331
189 3300005367 Ga0070667_100021300 Ga0070667_1000213003 331
190 3300005438 Ga0070701_10002417 Ga0070701_100024174 331
191 3300005440 Ga0070705_100058182 Ga0070705_1000581823 331
192 3300005441 Ga0070700_100016317 Ga0070700_1000163174 331
193 3300005441 Ga0070700_100219689 Ga0070700_1002196891 331
194 3300005444 Ga0070694_100091749 Ga0070694_1000917492 331
195 3300005456 Ga0070678_100099837 Ga0070678_1000998373 331
196 3300005457 Ga0070662_100037204 Ga0070662_1000372044 331
197 3300005457 Ga0070662_100038118 Ga0070662_1000381182 331
198 3300005458 Ga0070681_10149379 Ga0070681_101493792 331
199 3300005459 Ga0068867_100028196 Ga0068867_1000281962 331
200 3300005466 Ga0070685_10002147 Ga0070685_100021478 331
201 3300005530 Ga0070679_100085446 Ga0070679_1000854463 331
202 3300005530 Ga0070679_100253670 Ga0070679_1002536702 331
203 3300005535 Ga0070684_100000868 Ga0070684_10000086816 331
204 3300005535 Ga0070684_100264658 Ga0070684_1002646581 331
205 3300005543 Ga0070672_100010887 Ga0070672_1000108875 331
206 3300005544 Ga0070686_100002186 Ga0070686_1000021865 331
207 3300005564 Ga0070664_100001699 Ga0070664_10000169913 331
208 3300005577 Ga0068857_100008492 Ga0068857_1000084925 331
209 3300005614 Ga0068856_100318859 Ga0068856_1003188592 331
210 3300005615 Ga0070702_100029730 Ga0070702_1000297303 331
211 3300005615 Ga0070702_100098791 Ga0070702_1000987912 331
212 3300005617 Ga0068859_100013300 Ga0068859_1000133005 331
213 3300005618 Ga0068864_100002495 Ga0068864_1000024955 331
214 3300005718 Ga0068866_10194679 Ga0068866_101946792 331
215 3300005841 Ga0068863_100008564 Ga0068863_1000085645 331
216 3300005842 Ga0068858_100025893 Ga0068858_1000258935 331
217 3300005843 Ga0068860_100041843 Ga0068860_1000418432 331
218 3300005844 Ga0068862_100000566 Ga0068862_10000056635 331
219 3300005844 Ga0068862_100044286 Ga0068862_1000442863 331
220 3300006237 Ga0097621_100043639 Ga0097621_1000436392 331
221 3300006237 Ga0097621_100250994 Ga0097621_1002509942 331
222 3300006358 Ga0068871_100145089 Ga0068871_1001450893 331
223 3300006358 Ga0068871_100276696 Ga0068871_1002766962 331
224 3300006844 Ga0075428_100003068 Ga0075428_1000030685 331
225 3300006846 Ga0075430_100001123 Ga0075430_1000011237 331
226 3300006847 Ga0075431_100004037 Ga0075431_1000040379 331
227 3300006852 Ga0075433_10144248 Ga0075433_101442482 331
228 3300006880 Ga0075429_100001435 Ga0075429_1000014355 331
229 3300006881 Ga0068865_100006307 Ga0068865_1000063075 331
230 3300006931 Ga0097620_100013299 Ga0097620_1000132995 331
231 3300009101 Ga0105247_10088839 Ga0105247_100888393 331
232 3300009147 Ga0114129_10000308 Ga0114129_1000030812 331
233 3300009174 Ga0105241_10122958 Ga0105241_101229583 331
234 3300009177 Ga0105248_10027479 Ga0105248_100274795 331
235 3300009177 Ga0105248_10183056 Ga0105248_101830562 331
236 3300009553 Ga0105249_10040793 Ga0105249_100407935 331
237 3300009553 Ga0105249_10088797 Ga0105249_100887973 331
238 3300013297 Ga0157378_10141618 Ga0157378_101416182 331
239 3300013306 Ga0163162_10031395 Ga0163162_100313956 331
240 3300013306 Ga0163162_10104179 Ga0163162_101041792 331
241 3300014325 Ga0163163_10005250 Ga0163163_100052506 331
242 3300014325 Ga0163163_10037115 Ga0163163_100371154 331
243 3300014745 Ga0157377_10023109 Ga0157377_100231093 331
244 3300025893 Ga0207682_10061133 Ga0207682_100611331 331
245 3300025899 Ga0207642_10089982 Ga0207642_100899822 331
246 3300025901 Ga0207688_10009582 Ga0207688_100095824 331
247 3300025903 Ga0207680_10057638 Ga0207680_100576383 331
248 3300025907 Ga0207645_10042283 Ga0207645_100422832 331
249 3300025911 Ga0207654_10187207 Ga0207654_101872072 331
250 3300025912 Ga0207707_10166155 Ga0207707_101661552 331
251 3300025917 Ga0207660_10163455 Ga0207660_101634552 331
252 3300025918 Ga0207662_10001692 Ga0207662_100016929 331
253 3300025920 Ga0207649_10021564 Ga0207649_100215642 331
254 3300025921 Ga0207652_10161214 Ga0207652_101612142 331
255 3300025921 Ga0207652_10205769 Ga0207652_102057692 331
256 3300025926 Ga0207659_10007470 Ga0207659_100074705 331
257 3300025932 Ga0207690_10036913 Ga0207690_100369133 331
258 3300025933 Ga0207706_10012739 Ga0207706_100127394 331
259 3300025935 Ga0207709_10187499 Ga0207709_101874992 331
260 3300025936 Ga0207670_10041378 Ga0207670_100413783 331
261 3300025938 Ga0207704_10028724 Ga0207704_100287242 331
262 3300025940 Ga0207691_10015212 Ga0207691_100152125 331
263 3300025941 Ga0207711_10013695 Ga0207711_100136956 331
264 3300025942 Ga0207689_10003752 Ga0207689_100037528 331
265 3300025944 Ga0207661_10092787 Ga0207661_100927873 331
266 3300025945 Ga0207679_10013208 Ga0207679_100132085 331
267 3300025960 Ga0207651_10003489 Ga0207651_100034895 331
268 3300025961 Ga0207712_10007074 Ga0207712_100070745 331
269 3300025961 Ga0207712_10149019 Ga0207712_101490192 331
270 3300025972 Ga0207668_10005357 Ga0207668_100053574 331
271 3300025986 Ga0207658_10071622 Ga0207658_100716223 331
272 3300026035 Ga0207703_10269073 Ga0207703_102690732 331
273 3300026075 Ga0207708_10245953 Ga0207708_102459532 331
274 3300026088 Ga0207641_10005895 Ga0207641_100058952 331
275 3300026089 Ga0207648_10007964 Ga0207648_100079648 331
276 3300026095 Ga0207676_10048908 Ga0207676_100489082 331
277 3300026116 Ga0207674_10041848 Ga0207674_100418482 331
278 3300026118 Ga0207675_100002981 Ga0207675_1000029816 331
279 3300026118 Ga0207675_100066150 Ga0207675_1000661502 331
280 3300026121 Ga0207683_10100109 Ga0207683_101001093 331
281 3300028379 Ga0268266_10023530 Ga0268266_100235303 331
282 3300028379 Ga0268266_10076003 Ga0268266_100760032 331
283 3300028380 Ga0268265_10001478 Ga0268265_100014785 331
284 3300028380 Ga0268265_10005847 Ga0268265_100058475 331
285 3300028381 Ga0268264_10011269 Ga0268264_100112697 331
286 3300028381 Ga0268264_10039827 Ga0268264_100398273 331
287 3300037418 Ga0395900_0483562 Ga0395900_0483562_10_1017 331
288 3300037471 Ga0395905_0091364 Ga0395905_0091364_248_1255 331
289 3300044656 Ga0466969_0005534 Ga0466969_0005534_2172_3179 331
290 3300044684 Ga0466966_0068721 Ga0466966_0068721_578_1585 331
291 3300044901 Ga0466960_0007726 Ga0466960_0007726_1655_2662 331
292 3300045051 Ga0451576_0032939 Ga0451576_0032939_1339_2346 331
293 3300048909 Ga0496106_0127624 Ga0496106_0127624_474_1481 331
294 3300048912 Ga0496109_0046240 Ga0496109_0046240_293_1300 331
295 3300048913 Ga0496110_0138611 Ga0496110_0138611_671_1678 331
296 3300048914 Ga0496111_0122907 Ga0496111_0122907_196_1203 331
297 3300048915 Ga0496112_0124318 Ga0496112_0124318_1267_2274 331
298 3300048916 Ga0496113_0072764 Ga0496113_0072764_1059_2066 331
299 3300048928 Ga0496125_0104386 Ga0496125_0104386_747_1754 331
300 3300050507 nmdc:mga05p37_4597_c1 nmdc:mga05p37_4597_c1_924_1931 331
301 3300050508 nmdc:mga09592_5949_c1 nmdc:mga09592_5949_c1_3321_4328 331
302 3300050509 nmdc:mga0qj67_1933_c1 nmdc:mga0qj67_1933_c1_13441_14448 331
303 3300050510 nmdc:mga06r32_624_c1 nmdc:mga06r32_624_c1_3449_4456 331
304 3300050511 nmdc:mga08y16_152145_c1 nmdc:mga08y16_152145_c1_310_1317 331
305 3300050515 nmdc:mga0a205_321805_c1 nmdc:mga0a205_321805_c1_110_1117 331
306 iso_pu_bacteria 2508501125 2509130547 331
307 3300005336 Ga0070680_100010032 Ga0070680_1000100323 332
308 3300005434 Ga0070709_10302733 Ga0070709_103027331 332
309 3300005458 Ga0070681_10001778 Ga0070681_100017785 332
310 3300005458 Ga0070681_10027147 Ga0070681_100271478 332
311 3300005530 Ga0070679_100052542 Ga0070679_1000525424 332
312 3300005548 Ga0070665_100197084 Ga0070665_1001970841 332
313 3300005563 Ga0068855_100000430 Ga0068855_10000043044 332
314 3300005563 Ga0068855_100011937 Ga0068855_1000119373 332
315 3300005578 Ga0068854_100188428 Ga0068854_1001884282 332
316 3300009093 Ga0105240_10012414 Ga0105240_100124146 332
317 3300009093 Ga0105240_10023883 Ga0105240_100238838 332
318 3300009545 Ga0105237_10184657 Ga0105237_101846574 332
319 3300009551 Ga0105238_10062019 Ga0105238_100620193 332
320 3300025912 Ga0207707_10024699 Ga0207707_100246992 332
321 3300025913 Ga0207695_10023844 Ga0207695_100238446 332
322 3300025913 Ga0207695_10026351 Ga0207695_100263514 332
323 3300025914 Ga0207671_10148866 Ga0207671_101488661 332
324 3300025917 Ga0207660_10081493 Ga0207660_100814934 332
325 3300025921 Ga0207652_10014371 Ga0207652_100143715 332
326 3300025949 Ga0207667_10148360 Ga0207667_101483602 332
327 3300031235 Ga0265330_10036637 Ga0265330_100366372 332
328 3300031344 Ga0265316_10077625 Ga0265316_100776252 332
329 3300046471 Ga0495650_0033177 Ga0495650_0033177_859_1869 332
330 3300044842 Ga0466957_0005035 Ga0466957_0005035_1633_2745 334
331 iso_pu_bacteria 2501025502 2501077085 335
332 iso_pu_bacteria 2510917013 2511092769 335
333 iso_pu_bacteria 2513237083 2513565480 335
334 iso_pu_bacteria 2513237166 2514049254 335
335 iso_pu_bacteria 2515154122 2515685397 335
336 iso_pu_bacteria 2515154189 2516019872 335
337 iso_pu_bacteria 2842324504 2842327716 335
338 iso_pu_bacteria 2842348783 2842351676 335
339 iso_pu_bacteria 2842454564 2842460664 335
340 iso_pu_bacteria 2858950400 2858955964 335
341 iso_pu_bacteria 2883087390 2883091879 335
342 iso_pu_bacteria 2885270888 2885278937 335
343 iso_pu_bacteria 2902682994 2902684652 335
344 iso_pu_bacteria 2904434214 2904436715 335
345 iso_pu_bacteria 2919527303 2919534206 335
346 iso_pu_bacteria 2928157003 2928158057 335
347 iso_pu_bacteria 2928163908 2928165845 335
348 iso_pu_bacteria 2981990288 2981991089 335
349 iso_pu_bacteria 641736154 642417029 335
350 iso_pu_bacteria 642555112 642597339 335
351 iso_pu_bacteria 8003955200 8003961791 335
352 iso_pu_bacteria 8055301274 8055303026 335
353 3300001989 JGI24739J22299_10015848 JGI24739J22299_100158481 339
354 3300003187 JGI25151J46595_10019336 JGI25151J46595_100193362 339
355 3300003758 Ga0055532_1000270 Ga0055532_100027027 339
356 3300003760 Ga0055527_1000216 Ga0055527_10002169 339
357 3300003761 Ga0055535_1000512 Ga0055535_100051227 339
358 3300003762 Ga0055542_1001562 Ga0055542_10015625 339
359 3300005327 Ga0070658_10015364 Ga0070658_100153643 339
360 3300005339 Ga0070660_100000112 Ga0070660_10000011237 339
361 3300005344 Ga0070661_100031441 Ga0070661_1000314413 339
362 3300005366 Ga0070659_100000020 Ga0070659_100000020143 339
363 3300005455 Ga0070663_100004241 Ga0070663_1000042418 339
364 3300005564 Ga0070664_100194772 Ga0070664_1001947722 339
365 3300005616 Ga0068852_100024865 Ga0068852_1000248653 339
366 3300009092 Ga0105250_10009591 Ga0105250_100095913 339
367 3300009093 Ga0105240_10223951 Ga0105240_102239511 339
368 3300009545 Ga0105237_10013461 Ga0105237_100134617 339
369 3300010375 Ga0105239_10112621 Ga0105239_101126212 339
370 3300015261 Ga0182006_1039684 Ga0182006_10396842 339
371 3300015265 Ga0182005_1003786 Ga0182005_10037862 339
372 3300025228 Ga0209672_100012 Ga0209672_100012236 339
373 3300025229 Ga0209147_100007 Ga0209147_100007536 339
374 3300025242 Ga0209258_100014 Ga0209258_100014167 339
375 3300025254 Ga0209148_1000745 Ga0209148_10007458 339
376 3300025272 Ga0209455_1000269 Ga0209455_100026948 339
377 3300025294 Ga0209025_1000034 Ga0209025_1000034137 339
378 3300025294 Ga0209025_1001026 Ga0209025_100102625 339
379 3300025711 Ga0207696_1018805 Ga0207696_10188052 339
380 3300025904 Ga0207647_10003241 Ga0207647_100032415 339
381 3300025909 Ga0207705_10020301 Ga0207705_100203014 339
382 3300025914 Ga0207671_10034374 Ga0207671_100343743 339
383 3300025919 Ga0207657_10000338 Ga0207657_1000033814 339
384 3300025924 Ga0207694_10069806 Ga0207694_100698062 339
385 3300025932 Ga0207690_10000011 Ga0207690_10000011258 339
386 3300025945 Ga0207679_10198307 Ga0207679_101983071 339
387 3300026067 Ga0207678_10001890 Ga0207678_100018903 339
388 3300026142 Ga0207698_10014744 Ga0207698_100147443 339
389 3300031548 Ga0307408_100037529 Ga0307408_1000375292 339
390 3300032002 Ga0307416_100236514 Ga0307416_1002365142 339
391 3300037471 Ga0395905_0000020 Ga0395905_0000020_209172_210191 339
392 3300037471 Ga0395905_0077993 Ga0395905_0077993_516_1535 339
393 3300039437 Ga0436365_0730862 Ga0436365_0730862_957_1976 339
394 3300045836 Ga0466958_0137863 Ga0466958_0137863_38_1057 339
395 3300046455 Ga0495603_0001020 Ga0495603_0001020_2478_3497 339
396 3300046459 Ga0495629_0012125 Ga0495629_0012125_3709_4728 339
397 3300046459 Ga0495629_0062536 Ga0495629_0062536_366_1385 339
398 3300046472 Ga0495580_0016575 Ga0495580_0016575_715_1740 339
399 3300046472 Ga0495580_0018517 Ga0495580_0018517_1590_2609 339
400 3300046516 Ga0495628_0001336 Ga0495628_0001336_2051_3070 339
401 3300046526 Ga0495666_0016458 Ga0495666_0016458_90_1109 339
402 3300046529 Ga0495652_0035178 Ga0495652_0035178_2575_3594 339
403 3300046531 Ga0495665_0053868 Ga0495665_0053868_949_1974 339
404 3300046533 Ga0495640_0058270 Ga0495640_0058270_1199_2218 339
405 3300046543 Ga0495645_0079826 Ga0495645_0079826_410_1429 339
406 3300046689 Ga0495613_0001241 Ga0495613_0001241_3722_4741 339
407 3300046690 Ga0495624_0015142 Ga0495624_0015142_63_1082 339
408 3300046694 Ga0495649_0014764 Ga0495649_0014764_3044_4063 339
409 3300047317 Ga0495604_0005275 Ga0495604_0005275_8510_9535 339
410 3300047319 Ga0495674_0020791 Ga0495674_0020791_4263_5282 339
411 3300047321 Ga0495676_0020996 Ga0495676_0020996_4109_5128 339
412 3300047321 Ga0495676_0096802 Ga0495676_0096802_754_1773 339
413 3300047323 Ga0495683_0001890 Ga0495683_0001890_6261_7280 339
414 3300047446 Ga0495679_003344 Ga0495679_003344_4263_5282 339
415 3300049571 Ga0501034_0000106 Ga0501034_0000106_31847_32872 339
416 3300061719 Ga0466962_0001254 Ga0466962_0001254_3914_4933 339

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF18191

PnpCD_PnpD_N

Hydroquinone 1,2-dioxygenase large subunit N-terminal

45

190

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4zxc-assembly2.cif.gz_Y crystal structure of hydroquinone 1,2-dioxygenase pnpcd in complex with fe3+ 0.9689 18 339
5m21-assembly1.cif.gz_D crystal structure of hydroquinone 1,2-dioxygenase from sphingomonas sp. ttnp3 with 4-hydroxybenzoate bound 0.9655 18 339
5m4o-assembly1.cif.gz_D crystal structure of hydroquinone 1,2-dioxygenase from sphingomonas sp. ttnp3 in complex with 4-nitrophenol 0.962 18 339
4zxc-assembly2.cif.gz_Y crystal structure of hydroquinone 1,2-dioxygenase pnpcd in complex with fe3+ 0.9601 18 339
5m21-assembly1.cif.gz_D crystal structure of hydroquinone 1,2-dioxygenase from sphingomonas sp. ttnp3 with 4-hydroxybenzoate bound 0.9453 18 339
ID Description Score Start End Superfamily
af_O06194_5_109_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8744 240 320 2.60.120.10
af_F4IQK5_38_206_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8521 229 318 2.60.120.10
af_Q19341_4_281_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8386 240 318 2.60.120.10
af_P09377_6_85_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8377 241 317 2.60.120.10
af_P76555_101_233_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8374 239 319 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A848H1S0-F1-model_v4 Hydroxyquinol 1,2-dioxygenase 0.9794 18 339 GO:0051213
AF-A0A0Q7CYD2-F1-model_v4 Hydroxyquinol 1,2-dioxygenase 0.9787 18 339 GO:0051213
AF-A0A1C3RFN8-F1-model_v4 Hydroquinone 1,2-dioxygenase large subunit N-terminal domain-containing protein 0.9776 18 339
AF-A0A520GC87-F1-model_v4 Hydroxyquinol 1,2-dioxygenase 0.9745 15 339 GO:0051213
AF-A0A160FTN2-F1-model_v4 Hydroxyquinol 1,2-dioxygenase 0.9742 15 339 GO:0051213

Feature Viewer

pLDDT pTM Quality
88.85 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map