F438770

General Info

Members Datasets Scaffolds Average Seq Length
416 188 832 179

Family's Representative Sequence

Representative Sequence 3300006852|Ga0075433_10058803|Ga0075433_100588034
Length 188
Sequence MNLADWAILGVIVFSVVMAIAEGFFHQAFSLAGLIVGYLLAAWQYRRLAEWFSPQLKSPWLGEIVAFVAIFLGVVILAGIAGRITRWVMKEAGLSLFDRLLGGLLGLLKGALFVSVILMGMTAFTPTSKWLEGSGLAPYFLVVGRAAIWLAPSQLRSKFYEGLGLLHRARVPEAVPLPGNEPAAKPAQ

Samples

Sample ID Description Type Environment
1 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
32 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
33 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
34 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
39 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
51 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
52 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
62 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
63 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
64 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
65 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
66 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
98 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
101 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
102 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
103 3300030888 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
104 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
105 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
106 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
107 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
108 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
109 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
110 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
111 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
112 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
113 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
114 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
115 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
116 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
117 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
118 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
119 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
120 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
121 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
122 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
123 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
124 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
125 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
126 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
127 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
128 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
129 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
130 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
131 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
132 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
133 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
134 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
135 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
136 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
137 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
138 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
139 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
140 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
141 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
142 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
143 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
144 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
145 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
146 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
147 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
148 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
149 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
150 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
151 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
152 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
153 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
154 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
155 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
156 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
157 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
158 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
159 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
160 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
161 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
162 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
163 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
164 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
165 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
166 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
167 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
168 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
169 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
170 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
171 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
172 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
173 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
174 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
175 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
176 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
177 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
178 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
179 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
180 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
181 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
182 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
184 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
186 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
187 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
188 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.39
Metatranscriptomes 3.61
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.16
Rhizosphere 96.15
Stem 0
Stem Tuber 0
Unclassified 14.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075433_10058803 3300006852 Unclassified 3363
2 rootH2_10272818 3300003320 Bacteria 1780
3 rootH1_10334336 3300003323 Bacteria 2391
4 Ga0058859_11211166 3300004798 Bacteria 1167
5 Ga0068869_100006638 3300005334 Bacteria 7347
6 Ga0068869_100129224 3300005334 Bacteria 1940
7 Ga0068868_100002768 3300005338 Bacteria 12147
8 Ga0068868_100006865 3300005338 Bacteria 8086
9 Ga0070709_10000280 3300005434 Bacteria 32475
10 Ga0070709_10028029 3300005434 Bacteria 3355
11 Ga0070709_10085687 3300005434 Bacteria 2066
12 Ga0070709_10142911 3300005434 Bacteria 1646
13 Ga0070709_10465535 3300005434 Bacteria 955
14 Ga0070714_100001068 3300005435 Bacteria 19579
15 Ga0070714_100029064 3300005435 Bacteria 4592
16 Ga0070714_100030726 3300005435 Bacteria 4474
17 Ga0070714_100079762 3300005435 Bacteria 2846
18 Ga0070714_100164372 3300005435 Bacteria 2010
19 Ga0070714_100174318 3300005435 Unclassified 1953
20 Ga0070714_100359336 3300005435 Bacteria 1369
21 Ga0070714_100390127 3300005435 Bacteria 1314
22 Ga0070714_100451712 3300005435 Bacteria 1221
23 Ga0070714_100545406 3300005435 Bacteria 1110
24 Ga0070714_100603600 3300005435 Unclassified 1054
25 Ga0070714_100662723 3300005435 Bacteria 1005
26 Ga0070713_100000330 3300005436 Bacteria 31020
27 Ga0070713_100000377 3300005436 Bacteria 28531
28 Ga0070713_100007769 3300005436 Bacteria 7555
29 Ga0070713_100040330 3300005436 Bacteria 3796
30 Ga0070713_100063893 3300005436 Bacteria 3088
31 Ga0070713_100190960 3300005436 Bacteria 1845
32 Ga0070713_100195236 3300005436 Bacteria 1826
33 Ga0070713_100549354 3300005436 Bacteria 1093
34 Ga0070710_10007404 3300005437 Bacteria 5314
35 Ga0070710_10041494 3300005437 Bacteria 2541
36 Ga0070710_10181224 3300005437 Bacteria 1319
37 Ga0070710_10247027 3300005437 Bacteria 1146
38 Ga0070711_100012895 3300005439 Bacteria 5236
39 Ga0070711_100033265 3300005439 Bacteria 3433
40 Ga0070711_100035165 3300005439 Bacteria 3347
41 Ga0070711_100091507 3300005439 Bacteria 2193
42 Ga0070711_100091831 3300005439 Bacteria 2190
43 Ga0070711_100125498 3300005439 Bacteria 1905
44 Ga0070711_100184455 3300005439 Bacteria 1599
45 Ga0070711_100222164 3300005439 Bacteria 1469
46 Ga0070711_100958218 3300005439 Bacteria 733
47 Ga0070711_101102154 3300005439 Unclassified 684
48 Ga0070708_100014747 3300005445 Bacteria 6438
49 Ga0070708_100264669 3300005445 Bacteria 1617
50 Ga0070708_100395740 3300005445 Bacteria 1303
51 Ga0070681_10048226 3300005458 Bacteria 4257
52 Ga0070685_10012868 3300005466 Bacteria 4403
53 Ga0070706_100067571 3300005467 Unclassified 3306
54 Ga0070706_100579195 3300005467 Bacteria 1043
55 Ga0070707_100002160 3300005468 Bacteria 18834
56 Ga0070707_100098790 3300005468 Bacteria 2827
57 Ga0070707_100402642 3300005468 Unclassified 1329
58 Ga0070698_100001299 3300005471 Bacteria 27844
59 Ga0070698_100524835 3300005471 Unclassified 1123
60 Ga0070699_100007200 3300005518 Bacteria 9674
61 Ga0070699_100228473 3300005518 Bacteria 1659
62 Ga0070699_100937029 3300005518 Bacteria 793
63 Ga0070679_100602679 3300005530 Bacteria 1042
64 Ga0070697_100000760 3300005536 Bacteria 24123
65 Ga0070697_100004310 3300005536 Bacteria 10918
66 Ga0070697_100009307 3300005536 Bacteria 7679
67 Ga0070697_100074907 3300005536 Bacteria 2781
68 Ga0068853_100098964 3300005539 Bacteria 2576
69 Ga0070665_100434891 3300005548 Bacteria 1321
70 Ga0070664_100208796 3300005564 Unclassified 1745
71 Ga0068857_100682071 3300005577 Bacteria 975
72 Ga0068856_100021243 3300005614 Bacteria 6307
73 Ga0068856_100071379 3300005614 Unclassified 3437
74 Ga0068856_100667902 3300005614 Bacteria 1060
75 Ga0068856_101034096 3300005614 Bacteria 839
76 Ga0068856_101773881 3300005614 Unclassified 629
77 Ga0068859_100050773 3300005617 Bacteria 4167
78 Ga0068861_100084284 3300005719 Bacteria 2495
79 Ga0068863_100045848 3300005841 Bacteria 4149
80 Ga0068863_100200723 3300005841 Bacteria 1918
81 Ga0068858_100024565 3300005842 Bacteria 5615
82 Ga0068860_100016789 3300005843 Bacteria 7136
83 Ga0068860_100329213 3300005843 Bacteria 1500
84 Ga0070717_10002741 3300006028 Bacteria 12449
85 Ga0070717_10004921 3300006028 Bacteria 9717
86 Ga0070717_10007935 3300006028 Bacteria 7907
87 Ga0070717_10017146 3300006028 Bacteria 5627
88 Ga0070717_10064630 3300006028 Bacteria 3039
89 Ga0070717_10126797 3300006028 Bacteria 2192
90 Ga0070717_10268419 3300006028 Bacteria 1511
91 Ga0070717_10454147 3300006028 Bacteria 1155
92 Ga0070717_10549439 3300006028 Unclassified 1046
93 Ga0070715_10011627 3300006163 Bacteria 3175
94 Ga0070715_10016409 3300006163 Unclassified 2782
95 Ga0070715_10485526 3300006163 Bacteria 704
96 Ga0070716_100001062 3300006173 Bacteria 12042
97 Ga0070716_100002829 3300006173 Bacteria 8072
98 Ga0070716_100005192 3300006173 Bacteria 6296
99 Ga0070716_100007231 3300006173 Bacteria 5460
100 Ga0070716_100067539 3300006173 Bacteria 2089
101 Ga0070716_100093584 3300006173 Bacteria 1825
102 Ga0070716_100238300 3300006173 Bacteria 1232
103 Ga0070716_100438847 3300006173 Bacteria 949
104 Ga0070712_100000271 3300006175 Bacteria 29126
105 Ga0070712_100001197 3300006175 Bacteria 15673
106 Ga0070712_100002994 3300006175 Bacteria 10456
107 Ga0070712_100011576 3300006175 Bacteria 5599
108 Ga0070712_100041909 3300006175 Bacteria 3146
109 Ga0070712_100210227 3300006175 Bacteria 1534
110 Ga0070712_100365660 3300006175 Bacteria 1184
111 Ga0070712_100432588 3300006175 Bacteria 1093
112 Ga0070712_100665985 3300006175 Bacteria 885
113 Ga0070712_101225453 3300006175 Unclassified 653
114 Ga0097621_100205059 3300006237 Bacteria 1713
115 Ga0068871_100073890 3300006358 Bacteria 2812
116 Ga0068871_100101700 3300006358 Bacteria 2408
117 Ga0068871_100204948 3300006358 Bacteria 1704
118 Ga0068871_100318957 3300006358 Bacteria 1368
119 Ga0075433_10000577 3300006852 Bacteria 24283
120 Ga0075434_100000087 3300006871 Bacteria 50514
121 Ga0075434_100000680 3300006871 Bacteria 26440
122 Ga0075434_100102736 3300006871 Bacteria 2866
123 Ga0068865_100410198 3300006881 Unclassified 1111
124 Ga0075436_100075350 3300006914 Bacteria 2336
125 Ga0075436_100262009 3300006914 Bacteria 1233
126 Ga0097620_100050773 3300006931 Bacteria 4167
127 Ga0075435_100002121 3300007076 Bacteria 13065
128 Ga0075435_100079212 3300007076 Bacteria 2696
129 Ga0075435_100310666 3300007076 Bacteria 1349
130 Ga0075435_100569276 3300007076 Bacteria 982
131 Ga0105240_10202645 3300009093 Bacteria 2324
132 Ga0105240_10449265 3300009093 Bacteria 1443
133 Ga0105245_10057947 3300009098 Bacteria 3486
134 Ga0105241_10084545 3300009174 Bacteria 2491
135 Ga0105237_10043853 3300009545 Bacteria 4503
136 Ga0105237_10107272 3300009545 Bacteria 2785
137 Ga0105237_10514393 3300009545 Bacteria 1204
138 Ga0105238_10112678 3300009551 Bacteria 2700
139 Ga0105249_10070983 3300009553 Bacteria 3216
140 Ga0099796_10013514 3300010159 Bacteria 2334
141 Ga0105239_10025138 3300010375 Bacteria 6559
142 Ga0105239_10612939 3300010375 Bacteria 1242
143 Ga0105246_10332949 3300011119 Bacteria 1238
144 Ga0157373_10074299 3300013100 Bacteria 2398
145 Ga0157373_10154505 3300013100 Bacteria 1614
146 Ga0157371_10383495 3300013102 Bacteria 1026
147 Ga0157370_10004929 3300013104 Bacteria 15107
148 Ga0157369_10159752 3300013105 Bacteria 2379
149 Ga0157369_10163707 3300013105 Unclassified 2347
150 Ga0157369_10239446 3300013105 Bacteria 1896
151 Ga0157369_10598731 3300013105 Bacteria 1138
152 Ga0157374_10004787 3300013296 Bacteria 11356
153 Ga0157374_10015821 3300013296 Bacteria 6627
154 Ga0157374_10478108 3300013296 Bacteria 1249
155 Ga0157374_10703354 3300013296 Bacteria 1024
156 Ga0157378_10441430 3300013297 Unclassified 1290
157 Ga0163162_10007966 3300013306 Bacteria 10329
158 Ga0157372_10061707 3300013307 Bacteria 4199
159 Ga0157372_10221624 3300013307 Bacteria 2192
160 Ga0157372_10432156 3300013307 Bacteria 1535
161 Ga0157372_10702294 3300013307 Bacteria 1177
162 Ga0157375_10307250 3300013308 Bacteria 1750
163 Ga0163163_10008746 3300014325 Bacteria 9010
164 Ga0157380_11567641 3300014326 Unclassified 713
165 Ga0157376_10170467 3300014969 Bacteria 1982
166 Ga0182007_10026804 3300015262 Bacteria 1993
167 Ga0224572_1002709 3300024225 Bacteria 2904
168 Ga0224572_1043489 3300024225 Unclassified 843
169 Ga0228598_1001581 3300024227 Bacteria 4984
170 Ga0228598_1002776 3300024227 Bacteria 3792
171 Ga0207692_10006710 3300025898 Bacteria 4678
172 Ga0207692_10051046 3300025898 Bacteria 2095
173 Ga0207692_10179707 3300025898 Bacteria 1232
174 Ga0207647_10018278 3300025904 Bacteria 4747
175 Ga0207685_10022701 3300025905 Bacteria 2125
176 Ga0207699_10000674 3300025906 Bacteria 16388
177 Ga0207699_10037554 3300025906 Bacteria 2770
178 Ga0207699_10059278 3300025906 Bacteria 2293
179 Ga0207699_10153720 3300025906 Bacteria 1525
180 Ga0207699_10153796 3300025906 Bacteria 1525
181 Ga0207699_10239764 3300025906 Bacteria 1245
182 Ga0207699_10243075 3300025906 Bacteria 1237
183 Ga0207699_10407332 3300025906 Bacteria 969
184 Ga0207684_10002188 3300025910 Bacteria 19999
185 Ga0207684_10017324 3300025910 Bacteria 6180
186 Ga0207654_10195017 3300025911 Unclassified 1330
187 Ga0207707_10055108 3300025912 Unclassified 3459
188 Ga0207695_10017824 3300025913 Bacteria 8234
189 Ga0207671_10112833 3300025914 Bacteria 2070
190 Ga0207693_10000024 3300025915 Bacteria 125885
191 Ga0207693_10000752 3300025915 Bacteria 29157
192 Ga0207693_10018833 3300025915 Bacteria 5494
193 Ga0207693_10045309 3300025915 Bacteria 3456
194 Ga0207693_10046324 3300025915 Bacteria 3416
195 Ga0207693_10053070 3300025915 Bacteria 3180
196 Ga0207693_10054734 3300025915 Bacteria 3129
197 Ga0207693_10086430 3300025915 Bacteria 2457
198 Ga0207693_10355197 3300025915 Bacteria 1147
199 Ga0207663_10005000 3300025916 Bacteria 6649
200 Ga0207663_10013465 3300025916 Bacteria 4446
201 Ga0207663_10036751 3300025916 Bacteria 2948
202 Ga0207663_10074466 3300025916 Bacteria 2200
203 Ga0207663_10095217 3300025916 Bacteria 1986
204 Ga0207663_10249586 3300025916 Bacteria 1305
205 Ga0207663_10274668 3300025916 Bacteria 1250
206 Ga0207660_10030727 3300025917 Bacteria 3693
207 Ga0207652_10197564 3300025921 Bacteria 1810
208 Ga0207646_10003770 3300025922 Bacteria 16885
209 Ga0207646_10019879 3300025922 Bacteria 6233
210 Ga0207694_10422756 3300025924 Bacteria 1110
211 Ga0207687_10024000 3300025927 Bacteria 4069
212 Ga0207700_10000675 3300025928 Bacteria 19910
213 Ga0207700_10000932 3300025928 Bacteria 16816
214 Ga0207700_10003009 3300025928 Bacteria 9715
215 Ga0207700_10017210 3300025928 Bacteria 4824
216 Ga0207700_10069309 3300025928 Bacteria 2706
217 Ga0207700_10486257 3300025928 Bacteria 1091
218 Ga0207664_10000935 3300025929 Bacteria 19600
219 Ga0207664_10007719 3300025929 Bacteria 7467
220 Ga0207664_10081527 3300025929 Unclassified 2633
221 Ga0207664_10306404 3300025929 Unclassified 1398
222 Ga0207706_10514599 3300025933 Bacteria 1032
223 Ga0207665_10002025 3300025939 Bacteria 13641
224 Ga0207665_10003370 3300025939 Bacteria 10698
225 Ga0207665_10007971 3300025939 Bacteria 6992
226 Ga0207665_10054450 3300025939 Bacteria 2698
227 Ga0207665_10064691 3300025939 Bacteria 2485
228 Ga0207665_10103765 3300025939 Bacteria 1989
229 Ga0207665_10105034 3300025939 Bacteria 1978
230 Ga0207711_10077712 3300025941 Bacteria 2894
231 Ga0207689_10000695 3300025942 Bacteria 32215
232 Ga0207689_10130862 3300025942 Unclassified 2065
233 Ga0207679_10190828 3300025945 Unclassified 1703
234 Ga0207677_10400597 3300026023 Bacteria 1164
235 Ga0207703_10017846 3300026035 Bacteria 5542
236 Ga0207639_10180473 3300026041 Bacteria 1795
237 Ga0207639_10564225 3300026041 Bacteria 1046
238 Ga0207702_10020755 3300026078 Bacteria 5433
239 Ga0207702_10238337 3300026078 Bacteria 1703
240 Ga0207641_10821114 3300026088 Unclassified 920
241 Ga0207648_10071612 3300026089 Bacteria 3021
242 Ga0207675_100551966 3300026118 Bacteria 1151
243 Ga0207698_10052736 3300026142 Bacteria 3118
244 Ga0265356_1000477 3300028017 Bacteria 7219
245 Ga0265356_1010591 3300028017 Bacteria 1027
246 Ga0268266_10512715 3300028379 Unclassified 1146
247 Ga0268264_10021821 3300028381 Bacteria 5227
248 Ga0268264_10041646 3300028381 Bacteria 3800
249 Ga0265338_10023922 3300028800 Bacteria 6260
250 Ga0265762_1002431 3300030760 Bacteria 3368
251 Ga0265770_1007417 3300030878 Bacteria 1544
252 Ga0265770_1014459 3300030878 Bacteria 1191
253 Ga0265769_102725 3300030888 Unclassified 944
254 Ga0265760_10004671 3300031090 Bacteria 3920
255 Ga0265760_10027148 3300031090 Unclassified 1677
256 Ga0265325_10023533 3300031241 Bacteria 3361
257 Ga0265325_10127458 3300031241 Bacteria 1222
258 Ga0265339_10184946 3300031249 Bacteria 1036
259 Ga0265342_10011573 3300031712 Bacteria 6028
260 Ga0316212_1008901 3300033547 Bacteria 1442
261 Ga0373926_0003608 3300035083 Bacteria 5023
262 Ga0373926_0052724 3300035083 Bacteria 1470
263 Ga0373934_0010011 3300035086 Bacteria 3558
264 Ga0373934_0018210 3300035086 Bacteria 2687
265 Ga0373944_0132851 3300035089 Bacteria 866
266 Ga0373944_0172945 3300035089 Bacteria 771
267 Ga0373923_0126501 3300035111 Unclassified 1146
268 Ga0373936_0000450 3300035113 Bacteria 13790
269 Ga0373936_0046993 3300035113 Bacteria 1740
270 Ga0373936_0119042 3300035113 Unclassified 1126
271 Ga0373945_0002394 3300035116 Bacteria 5884
272 Ga0373953_0015630 3300035117 Bacteria 2755
273 Ga0373954_0019545 3300035118 Bacteria 3056
274 Ga0373956_0078905 3300035119 Bacteria 1508
275 Ga0373956_0084210 3300035119 Bacteria 1462
276 Ga0373957_0083885 3300035120 Bacteria 1260
277 Ga0373943_0000456 3300035170 Bacteria 17336
278 Ga0373943_0011676 3300035170 Bacteria 3954
279 Ga0373943_0129023 3300035170 Bacteria 1351
280 Ga0373943_0200385 3300035170 Unclassified 1105
281 Ga0373943_0372953 3300035170 Unclassified 821
282 Ga0373943_0392290 3300035170 Unclassified 800
283 Ga0373946_0067384 3300035171 Bacteria 1537
284 Ga0373946_0240402 3300035171 Unclassified 880
285 Ga0373955_0179829 3300035172 Bacteria 1255
286 Ga0373924_0007184 3300035410 Bacteria 4013
287 Ga0373935_0003026 3300035692 Bacteria 9697
288 Ga0373935_0004041 3300035692 Bacteria 8570
289 Ga0373935_0012694 3300035692 Bacteria 5070
290 Ga0373935_1029328 3300035692 Unclassified 612
291 Ga0373927_0000241 3300035695 Bacteria 42965
292 Ga0373927_0006672 3300035695 Bacteria 7856
293 Ga0373927_0182573 3300035695 Bacteria 1376
294 Ga0373927_0198794 3300035695 Unclassified 1316
295 Ga0373927_0203797 3300035695 Unclassified 1299
296 Ga0373927_0319410 3300035695 Bacteria 1022
297 Ga0373933_0017213 3300035724 Bacteria 4052
298 Ga0373933_0282451 3300035724 Unclassified 1073
299 Ga0373933_0300338 3300035724 Unclassified 1039
300 Ga0373947_0000699 3300035725 Bacteria 20023
301 Ga0373947_0027538 3300035725 Bacteria 3327
302 Ga0373947_0051064 3300035725 Bacteria 2487
303 Ga0373947_0133076 3300035725 Unclassified 1589
304 Ga0373947_0253139 3300035725 Unclassified 1165
305 Ga0373937_0009611 3300036401 Bacteria 8419
306 Ga0373937_0017501 3300036401 Bacteria 6388
307 Ga0373937_0117484 3300036401 Bacteria 2477
308 Ga0373937_0314431 3300036401 Bacteria 1481
309 Ga0373937_0412403 3300036401 Bacteria 1282
310 Ga0373937_0710647 3300036401 Bacteria 952
311 Ga0373937_0809833 3300036401 Bacteria 885
312 Ga0373925_0000250 3300037068 Bacteria 56937
313 Ga0373925_0020136 3300037068 Unclassified 4855
314 Ga0373925_0083534 3300037068 Bacteria 2432
315 Ga0373925_0304425 3300037068 Bacteria 1287
316 Ga0373925_0426489 3300037068 Bacteria 1084
317 Ga0436364_0695127 3300037853 Bacteria 6498
318 Ga0395901_1178891 3300038443 Unclassified 733
319 Ga0436360_0370716 3300039438 Bacteria 1662
320 Ga0436363_1432888 3300039450 Bacteria 1161
321 Ga0436363_1465399 3300039450 Unclassified 1192
322 Ga0466961_0108207 3300044693 Bacteria 1750
323 Ga0466963_0012471 3300044694 Bacteria 5204
324 Ga0466963_0058615 3300044694 Bacteria 2568
325 Ga0466957_0737240 3300044842 Unclassified 697
326 Ga0466967_0057399 3300045976 Bacteria 3437
327 Ga0466967_0065144 3300045976 Bacteria 3242
328 Ga0466967_0076824 3300045976 Bacteria 3005
329 Ga0466967_1301458 3300045976 Unclassified 724
330 Ga0495603_0110109 3300046455 Bacteria 1607
331 Ga0495629_0009003 3300046459 Bacteria 7327
332 Ga0495651_0160075 3300046462 Bacteria 1614
333 Ga0495653_0065546 3300046463 Bacteria 2734
334 Ga0495580_0000169 3300046472 Bacteria 48745
335 Ga0495580_0001304 3300046472 Bacteria 22025
336 Ga0495580_0001648 3300046472 Bacteria 19643
337 Ga0495580_0001724 3300046472 Bacteria 19216
338 Ga0495580_0005034 3300046472 Bacteria 11017
339 Ga0495580_0005276 3300046472 Bacteria 10732
340 Ga0495580_0012212 3300046472 Bacteria 6597
341 Ga0495580_0023031 3300046472 Bacteria 4579
342 Ga0495580_0051780 3300046472 Unclassified 2902
343 Ga0495580_0104724 3300046472 Bacteria 1966
344 Ga0495580_0168681 3300046472 Bacteria 1514
345 Ga0495580_0183142 3300046472 Bacteria 1446
346 Ga0495582_0004417 3300046473 Bacteria 7912
347 Ga0495582_0051472 3300046473 Bacteria 2270
348 Ga0495662_0129000 3300046476 Bacteria 1243
349 Ga0495664_0002363 3300046477 Bacteria 10112
350 Ga0495628_0108853 3300046516 Bacteria 2133
351 Ga0495630_0137085 3300046517 Bacteria 1860
352 Ga0495630_0327994 3300046517 Unclassified 1170
353 Ga0495630_0509820 3300046517 Bacteria 922
354 Ga0495630_0835389 3300046517 Unclassified 703
355 Ga0495666_0028767 3300046526 Bacteria 2734
356 Ga0495666_0116648 3300046526 Bacteria 1252
357 Ga0495665_0025062 3300046531 Bacteria 3205
358 Ga0495665_0113420 3300046531 Bacteria 1421
359 Ga0495665_0241303 3300046531 Bacteria 931
360 Ga0495640_0354193 3300046533 Unclassified 906
361 Ga0495645_0239716 3300046543 Unclassified 1211
362 Ga0495645_0253116 3300046543 Bacteria 1170
363 Ga0495667_0182598 3300046559 Bacteria 1346
364 Ga0495657_0231452 3300046675 Bacteria 1118
365 Ga0495657_0259323 3300046675 Bacteria 1045
366 Ga0495623_0026651 3300046679 Bacteria 3719
367 Ga0495646_0168389 3300046680 Unclassified 1209
368 Ga0495647_0260486 3300046681 Bacteria 774
369 Ga0495658_0016885 3300046683 Bacteria 3761
370 Ga0495669_0195094 3300046684 Bacteria 967
371 Ga0495613_0449942 3300046689 Unclassified 873
372 Ga0495624_0281384 3300046690 Bacteria 1004
373 Ga0495624_0770713 3300046690 Unclassified 569
374 Ga0495581_0106939 3300047315 Bacteria 1626
375 Ga0495581_0191879 3300047315 Bacteria 1195
376 Ga0495604_0109240 3300047317 Bacteria 2019
377 Ga0495604_0205114 3300047317 Bacteria 1365
378 Ga0495674_0009714 3300047319 Bacteria 9135
379 Ga0495674_0045718 3300047319 Bacteria 3887
380 Ga0495674_0157709 3300047319 Bacteria 1900
381 Ga0495674_0174854 3300047319 Unclassified 1790
382 Ga0495674_0612270 3300047319 Bacteria 862
383 Ga0495684_0448475 3300047471 Bacteria 897
384 Ga0495593_0038115 3300047673 Bacteria 2597
385 Ga0495593_0067316 3300047673 Bacteria 1865
386 Ga0495602_0228148 3300048088 Bacteria 1401
387 Ga0496100_0953857 3300048903 Unclassified 674
388 Ga0496102_0045836 3300048905 Bacteria 3970
389 Ga0496102_0266028 3300048905 Bacteria 1617
390 Ga0496104_0539554 3300048907 Bacteria 1077
391 Ga0496108_0772854 3300048911 Unclassified 830
392 Ga0496112_0011333 3300048915 Bacteria 8137
393 Ga0496112_0254457 3300048915 Bacteria 1707
394 Ga0496114_0479995 3300048917 Bacteria 1100
395 Ga0496115_0001948 3300048918 Bacteria 14722
396 Ga0501083_0097768 3300049744 Unclassified 1937
397 nmdc:mga0n895_10847_c1 3300050512 Bacteria 8086
398 nmdc:mga0n895_128_c1 3300050512 Bacteria 45048
399 nmdc:mga0rr50_106_c1 3300050513 Bacteria 46345
400 nmdc:mga0rr50_497034_c1 3300050513 Bacteria 1037
401 nmdc:mga0rr50_740891_c1 3300050513 Unclassified 839
402 nmdc:mga08x19_247763_c1 3300050514 Bacteria 1229
403 nmdc:mga08x19_2848_c1 3300050514 Bacteria 10425
404 nmdc:mga08x19_594454_c1 3300050514 Bacteria 784
405 nmdc:mga0a205_814_c2 3300050515 Bacteria 21402
406 Ga0495601_0013517 3300053077 Bacteria 4911
407 Ga0495612_0079406 3300053078 Bacteria 1378
408 Ga0495595_0429197 3300053084 Unclassified 671
409 Ga0587077_076312 3300059493 Bacteria 760
410 Ga0587082_062990 3300059504 Bacteria 735
411 Ga0587090_048120 3300059510 Bacteria 773
412 Ga0587128_013200 3300059630 Bacteria 1162
413 Ga0587075_007852 3300059644 Bacteria 1350
414 Ga0587076_013635 3300059645 Bacteria 1237
415 Ga0587079_066538 3300059647 Bacteria 794
416 Ga0587071_087808 3300060344 Bacteria 702
417 Ga0075433_10058803
418 rootH2_10272818
419 rootH1_10334336
420 Ga0058859_11211166
421 Ga0068869_100006638
422 Ga0068869_100129224
423 Ga0068868_100002768
424 Ga0068868_100006865
425 Ga0070709_10000280
426 Ga0070709_10028029
427 Ga0070709_10085687
428 Ga0070709_10142911
429 Ga0070709_10465535
430 Ga0070714_100001068
431 Ga0070714_100029064
432 Ga0070714_100030726
433 Ga0070714_100079762
434 Ga0070714_100164372
435 Ga0070714_100174318
436 Ga0070714_100359336
437 Ga0070714_100390127
438 Ga0070714_100451712
439 Ga0070714_100545406
440 Ga0070714_100603600
441 Ga0070714_100662723
442 Ga0070713_100000330
443 Ga0070713_100000377
444 Ga0070713_100007769
445 Ga0070713_100040330
446 Ga0070713_100063893
447 Ga0070713_100190960
448 Ga0070713_100195236
449 Ga0070713_100549354
450 Ga0070710_10007404
451 Ga0070710_10041494
452 Ga0070710_10181224
453 Ga0070710_10247027
454 Ga0070711_100012895
455 Ga0070711_100033265
456 Ga0070711_100035165
457 Ga0070711_100091507
458 Ga0070711_100091831
459 Ga0070711_100125498
460 Ga0070711_100184455
461 Ga0070711_100222164
462 Ga0070711_100958218
463 Ga0070711_101102154
464 Ga0070708_100014747
465 Ga0070708_100264669
466 Ga0070708_100395740
467 Ga0070681_10048226
468 Ga0070685_10012868
469 Ga0070706_100067571
470 Ga0070706_100579195
471 Ga0070707_100002160
472 Ga0070707_100098790
473 Ga0070707_100402642
474 Ga0070698_100001299
475 Ga0070698_100524835
476 Ga0070699_100007200
477 Ga0070699_100228473
478 Ga0070699_100937029
479 Ga0070679_100602679
480 Ga0070697_100000760
481 Ga0070697_100004310
482 Ga0070697_100009307
483 Ga0070697_100074907
484 Ga0068853_100098964
485 Ga0070665_100434891
486 Ga0070664_100208796
487 Ga0068857_100682071
488 Ga0068856_100021243
489 Ga0068856_100071379
490 Ga0068856_100667902
491 Ga0068856_101034096
492 Ga0068856_101773881
493 Ga0068859_100050773
494 Ga0068861_100084284
495 Ga0068863_100045848
496 Ga0068863_100200723
497 Ga0068858_100024565
498 Ga0068860_100016789
499 Ga0068860_100329213
500 Ga0070717_10002741
501 Ga0070717_10004921
502 Ga0070717_10007935
503 Ga0070717_10017146
504 Ga0070717_10064630
505 Ga0070717_10126797
506 Ga0070717_10268419
507 Ga0070717_10454147
508 Ga0070717_10549439
509 Ga0070715_10011627
510 Ga0070715_10016409
511 Ga0070715_10485526
512 Ga0070716_100001062
513 Ga0070716_100002829
514 Ga0070716_100005192
515 Ga0070716_100007231
516 Ga0070716_100067539
517 Ga0070716_100093584
518 Ga0070716_100238300
519 Ga0070716_100438847
520 Ga0070712_100000271
521 Ga0070712_100001197
522 Ga0070712_100002994
523 Ga0070712_100011576
524 Ga0070712_100041909
525 Ga0070712_100210227
526 Ga0070712_100365660
527 Ga0070712_100432588
528 Ga0070712_100665985
529 Ga0070712_101225453
530 Ga0097621_100205059
531 Ga0068871_100073890
532 Ga0068871_100101700
533 Ga0068871_100204948
534 Ga0068871_100318957
535 Ga0075433_10000577
536 Ga0075434_100000087
537 Ga0075434_100000680
538 Ga0075434_100102736
539 Ga0068865_100410198
540 Ga0075436_100075350
541 Ga0075436_100262009
542 Ga0097620_100050773
543 Ga0075435_100002121
544 Ga0075435_100079212
545 Ga0075435_100310666
546 Ga0075435_100569276
547 Ga0105240_10202645
548 Ga0105240_10449265
549 Ga0105245_10057947
550 Ga0105241_10084545
551 Ga0105237_10043853
552 Ga0105237_10107272
553 Ga0105237_10514393
554 Ga0105238_10112678
555 Ga0105249_10070983
556 Ga0099796_10013514
557 Ga0105239_10025138
558 Ga0105239_10612939
559 Ga0105246_10332949
560 Ga0157373_10074299
561 Ga0157373_10154505
562 Ga0157371_10383495
563 Ga0157370_10004929
564 Ga0157369_10159752
565 Ga0157369_10163707
566 Ga0157369_10239446
567 Ga0157369_10598731
568 Ga0157374_10004787
569 Ga0157374_10015821
570 Ga0157374_10478108
571 Ga0157374_10703354
572 Ga0157378_10441430
573 Ga0163162_10007966
574 Ga0157372_10061707
575 Ga0157372_10221624
576 Ga0157372_10432156
577 Ga0157372_10702294
578 Ga0157375_10307250
579 Ga0163163_10008746
580 Ga0157380_11567641
581 Ga0157376_10170467
582 Ga0182007_10026804
583 Ga0224572_1002709
584 Ga0224572_1043489
585 Ga0228598_1001581
586 Ga0228598_1002776
587 Ga0207692_10006710
588 Ga0207692_10051046
589 Ga0207692_10179707
590 Ga0207647_10018278
591 Ga0207685_10022701
592 Ga0207699_10000674
593 Ga0207699_10037554
594 Ga0207699_10059278
595 Ga0207699_10153720
596 Ga0207699_10153796
597 Ga0207699_10239764
598 Ga0207699_10243075
599 Ga0207699_10407332
600 Ga0207684_10002188
601 Ga0207684_10017324
602 Ga0207654_10195017
603 Ga0207707_10055108
604 Ga0207695_10017824
605 Ga0207671_10112833
606 Ga0207693_10000024
607 Ga0207693_10000752
608 Ga0207693_10018833
609 Ga0207693_10045309
610 Ga0207693_10046324
611 Ga0207693_10053070
612 Ga0207693_10054734
613 Ga0207693_10086430
614 Ga0207693_10355197
615 Ga0207663_10005000
616 Ga0207663_10013465
617 Ga0207663_10036751
618 Ga0207663_10074466
619 Ga0207663_10095217
620 Ga0207663_10249586
621 Ga0207663_10274668
622 Ga0207660_10030727
623 Ga0207652_10197564
624 Ga0207646_10003770
625 Ga0207646_10019879
626 Ga0207694_10422756
627 Ga0207687_10024000
628 Ga0207700_10000675
629 Ga0207700_10000932
630 Ga0207700_10003009
631 Ga0207700_10017210
632 Ga0207700_10069309
633 Ga0207700_10486257
634 Ga0207664_10000935
635 Ga0207664_10007719
636 Ga0207664_10081527
637 Ga0207664_10306404
638 Ga0207706_10514599
639 Ga0207665_10002025
640 Ga0207665_10003370
641 Ga0207665_10007971
642 Ga0207665_10054450
643 Ga0207665_10064691
644 Ga0207665_10103765
645 Ga0207665_10105034
646 Ga0207711_10077712
647 Ga0207689_10000695
648 Ga0207689_10130862
649 Ga0207679_10190828
650 Ga0207677_10400597
651 Ga0207703_10017846
652 Ga0207639_10180473
653 Ga0207639_10564225
654 Ga0207702_10020755
655 Ga0207702_10238337
656 Ga0207641_10821114
657 Ga0207648_10071612
658 Ga0207675_100551966
659 Ga0207698_10052736
660 Ga0265356_1000477
661 Ga0265356_1010591
662 Ga0268266_10512715
663 Ga0268264_10021821
664 Ga0268264_10041646
665 Ga0265338_10023922
666 Ga0265762_1002431
667 Ga0265770_1007417
668 Ga0265770_1014459
669 Ga0265769_102725
670 Ga0265760_10004671
671 Ga0265760_10027148
672 Ga0265325_10023533
673 Ga0265325_10127458
674 Ga0265339_10184946
675 Ga0265342_10011573
676 Ga0316212_1008901
677 Ga0373926_0003608
678 Ga0373926_0052724
679 Ga0373934_0010011
680 Ga0373934_0018210
681 Ga0373944_0132851
682 Ga0373944_0172945
683 Ga0373923_0126501
684 Ga0373936_0000450
685 Ga0373936_0046993
686 Ga0373936_0119042
687 Ga0373945_0002394
688 Ga0373953_0015630
689 Ga0373954_0019545
690 Ga0373956_0078905
691 Ga0373956_0084210
692 Ga0373957_0083885
693 Ga0373943_0000456
694 Ga0373943_0011676
695 Ga0373943_0129023
696 Ga0373943_0200385
697 Ga0373943_0372953
698 Ga0373943_0392290
699 Ga0373946_0067384
700 Ga0373946_0240402
701 Ga0373955_0179829
702 Ga0373924_0007184
703 Ga0373935_0003026
704 Ga0373935_0004041
705 Ga0373935_0012694
706 Ga0373935_1029328
707 Ga0373927_0000241
708 Ga0373927_0006672
709 Ga0373927_0182573
710 Ga0373927_0198794
711 Ga0373927_0203797
712 Ga0373927_0319410
713 Ga0373933_0017213
714 Ga0373933_0282451
715 Ga0373933_0300338
716 Ga0373947_0000699
717 Ga0373947_0027538
718 Ga0373947_0051064
719 Ga0373947_0133076
720 Ga0373947_0253139
721 Ga0373937_0009611
722 Ga0373937_0017501
723 Ga0373937_0117484
724 Ga0373937_0314431
725 Ga0373937_0412403
726 Ga0373937_0710647
727 Ga0373937_0809833
728 Ga0373925_0000250
729 Ga0373925_0020136
730 Ga0373925_0083534
731 Ga0373925_0304425
732 Ga0373925_0426489
733 Ga0436364_0695127
734 Ga0395901_1178891
735 Ga0436360_0370716
736 Ga0436363_1432888
737 Ga0436363_1465399
738 Ga0466961_0108207
739 Ga0466963_0012471
740 Ga0466963_0058615
741 Ga0466957_0737240
742 Ga0466967_0057399
743 Ga0466967_0065144
744 Ga0466967_0076824
745 Ga0466967_1301458
746 Ga0495603_0110109
747 Ga0495629_0009003
748 Ga0495651_0160075
749 Ga0495653_0065546
750 Ga0495580_0000169
751 Ga0495580_0001304
752 Ga0495580_0001648
753 Ga0495580_0001724
754 Ga0495580_0005034
755 Ga0495580_0005276
756 Ga0495580_0012212
757 Ga0495580_0023031
758 Ga0495580_0051780
759 Ga0495580_0104724
760 Ga0495580_0168681
761 Ga0495580_0183142
762 Ga0495582_0004417
763 Ga0495582_0051472
764 Ga0495662_0129000
765 Ga0495664_0002363
766 Ga0495628_0108853
767 Ga0495630_0137085
768 Ga0495630_0327994
769 Ga0495630_0509820
770 Ga0495630_0835389
771 Ga0495666_0028767
772 Ga0495666_0116648
773 Ga0495665_0025062
774 Ga0495665_0113420
775 Ga0495665_0241303
776 Ga0495640_0354193
777 Ga0495645_0239716
778 Ga0495645_0253116
779 Ga0495667_0182598
780 Ga0495657_0231452
781 Ga0495657_0259323
782 Ga0495623_0026651
783 Ga0495646_0168389
784 Ga0495647_0260486
785 Ga0495658_0016885
786 Ga0495669_0195094
787 Ga0495613_0449942
788 Ga0495624_0281384
789 Ga0495624_0770713
790 Ga0495581_0106939
791 Ga0495581_0191879
792 Ga0495604_0109240
793 Ga0495604_0205114
794 Ga0495674_0009714
795 Ga0495674_0045718
796 Ga0495674_0157709
797 Ga0495674_0174854
798 Ga0495674_0612270
799 Ga0495684_0448475
800 Ga0495593_0038115
801 Ga0495593_0067316
802 Ga0495602_0228148
803 Ga0496100_0953857
804 Ga0496102_0045836
805 Ga0496102_0266028
806 Ga0496104_0539554
807 Ga0496108_0772854
808 Ga0496112_0011333
809 Ga0496112_0254457
810 Ga0496114_0479995
811 Ga0496115_0001948
812 Ga0501083_0097768
813 nmdc:mga0n895_10847_c1
814 nmdc:mga0n895_128_c1
815 nmdc:mga0rr50_106_c1
816 nmdc:mga0rr50_497034_c1
817 nmdc:mga0rr50_740891_c1
818 nmdc:mga08x19_247763_c1
819 nmdc:mga08x19_2848_c1
820 nmdc:mga08x19_594454_c1
821 nmdc:mga0a205_814_c2
822 Ga0495601_0013517
823 Ga0495612_0079406
824 Ga0495595_0429197
825 Ga0587077_076312
826 Ga0587082_062990
827 Ga0587090_048120
828 Ga0587128_013200
829 Ga0587075_007852
830 Ga0587076_013635
831 Ga0587079_066538
832 Ga0587071_087808

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02674

Colicin_V

Colicin V production protein

4

145

0.95

Map