F438745

General Info

Members Datasets Scaffolds Average Seq Length
416 213 832 502

Family's Representative Sequence

Representative Sequence 3300005536|Ga0070697_100045360|Ga0070697_1000453602
Length 549
Sequence MAEAVTAPRFEMHGVRKTFGATVALDAVDLSVGAGEVCALVGQNGAGKSTLMAMLAGALAPDAGLMRLDGAAYAPRNPLDARQAGVAMIYQELSLAPHLSVMENIVLGVEPARRGIVLRARMREIAVAALGELGHTDIAPETRVGDLPPAAQQLVEIARALAIGCRVLVLDEPTSSLGHADVAILFELIARLKARGLAIVYISHFIEEVKAVSDRFVVLRDGRNAGAGVTSTTPATDIVGLMVGRAFDEMYPRGTRTPGDPVLLLNDVVPGAATLALRRGEILGLAGLLGAGRTRLLRAIFGLEPVMRGTITVGAFSGPSTPPDRWRQGLGMLSEDRAGEGLALGLSVADNMTLTRLEPLGPAFTVVPSRQQAAAERWIDRLGIRCAHPRQTIGELSGGNQQKVAVARLLHHDVDVLVLDEPTRGIDVASKAQIYRLIDELVCGGPVTRGDGDANSVVDLHRAGAGRPVPPVARLGSARASAKIAEAPEAPGGRGRKSVLLVSSYLPELLGVCDRIAVMSRGRLGPARPVEEWTEHSLLMEASGARAAS

Samples

Sample ID Description Type Environment
1 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
50 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
51 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
52 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
53 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
116 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
120 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
121 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
122 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
123 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
124 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
125 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
126 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
127 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
128 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
129 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
130 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
131 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
132 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
133 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
134 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
135 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
136 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
137 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
138 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
139 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
140 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
141 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
142 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
143 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
144 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
145 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
146 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
147 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
148 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
149 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
150 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
151 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
152 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
153 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
154 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
155 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
156 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
157 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
158 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
159 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
160 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
161 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
162 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
163 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
164 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
165 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
166 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
180 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
181 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
182 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
183 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
184 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
185 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
186 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
187 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
188 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
189 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
190 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
191 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
192 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
193 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
196 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
197 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
198 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
199 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
200 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
201 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
202 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
203 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
204 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
205 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
206 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
207 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
208 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
209 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
210 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
211 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
212 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
213 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.12
Nodule 0
Rhizoplane 1.2
Rhizosphere 94.71
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070697_100045360 3300005536 Bacteria 3562
2 rootH2_10000294 3300003320 Bacteria 37975
3 rootH1_10053077 3300003323 Bacteria 7078
4 Ga0065712_10087413 3300005290 Bacteria 2550
5 Ga0065715_10118842 3300005293 Bacteria 2304
6 Ga0070658_10011193 3300005327 Bacteria 7190
7 Ga0070676_10011010 3300005328 Bacteria 4914
8 Ga0070670_100029371 3300005331 Bacteria 4733
9 Ga0070666_10007712 3300005335 Bacteria 6646
10 Ga0070666_10105082 3300005335 Bacteria 1950
11 Ga0068868_100028299 3300005338 Bacteria 4284
12 Ga0070689_100119522 3300005340 Bacteria 2104
13 Ga0070691_10026304 3300005341 Bacteria 2712
14 Ga0070687_100019910 3300005343 Bacteria 3130
15 Ga0070687_100050290 3300005343 Bacteria 2152
16 Ga0070669_100007157 3300005353 Bacteria 8017
17 Ga0070675_100000083 3300005354 Bacteria 55614
18 Ga0070675_100027388 3300005354 Bacteria 4579
19 Ga0070674_100001468 3300005356 Bacteria 12579
20 Ga0070674_100009903 3300005356 Bacteria 5737
21 Ga0070673_100007413 3300005364 Bacteria 7231
22 Ga0070673_100162350 3300005364 Bacteria 1901
23 Ga0070673_100191280 3300005364 Bacteria 1758
24 Ga0070659_100108891 3300005366 Bacteria 2235
25 Ga0070659_100188387 3300005366 Bacteria 1695
26 Ga0070667_100016931 3300005367 Bacteria 6032
27 Ga0070714_100019178 3300005435 Bacteria 5567
28 Ga0070705_100036072 3300005440 Bacteria 2777
29 Ga0070705_100099683 3300005440 Bacteria 1831
30 Ga0070700_100018325 3300005441 Bacteria 4024
31 Ga0070708_100037617 3300005445 Bacteria 4223
32 Ga0070681_10159281 3300005458 Bacteria 2181
33 Ga0070685_10018493 3300005466 Bacteria 3748
34 Ga0070706_100008256 3300005467 Bacteria 9713
35 Ga0070706_100013739 3300005467 Bacteria 7486
36 Ga0070707_100004281 3300005468 Bacteria 13373
37 Ga0070707_100005838 3300005468 Bacteria 11479
38 Ga0070698_100001691 3300005471 Bacteria 24608
39 Ga0070698_100112943 3300005471 Bacteria 2681
40 Ga0070699_100008450 3300005518 Bacteria 8922
41 Ga0070697_100014426 3300005536 Bacteria 6206
42 Ga0070672_100001350 3300005543 Bacteria 15134
43 Ga0070686_100000585 3300005544 Bacteria 21569
44 Ga0070695_100020495 3300005545 Bacteria 4038
45 Ga0070693_100014820 3300005547 Bacteria 4005
46 Ga0070693_100062033 3300005547 Bacteria 2175
47 Ga0070665_100001505 3300005548 Bacteria 27126
48 Ga0070665_100009316 3300005548 Bacteria 9938
49 Ga0070665_100204550 3300005548 Bacteria 1975
50 Ga0070704_100008952 3300005549 Bacteria 6031
51 Ga0068855_100003757 3300005563 Bacteria 18557
52 Ga0068855_100172615 3300005563 Bacteria 2448
53 Ga0068857_100027350 3300005577 Bacteria 5032
54 Ga0068854_100020086 3300005578 Bacteria 4512
55 Ga0068856_100014106 3300005614 Bacteria 7726
56 Ga0068856_100037853 3300005614 Bacteria 4734
57 Ga0070702_100001873 3300005615 Bacteria 8801
58 Ga0068859_100056624 3300005617 Bacteria 3947
59 Ga0068859_100171472 3300005617 Bacteria 2251
60 Ga0068861_100032639 3300005719 Bacteria 3834
61 Ga0068863_100010821 3300005841 Bacteria 8846
62 Ga0068858_100014483 3300005842 Bacteria 7430
63 Ga0068858_100058087 3300005842 Bacteria 3576
64 Ga0068858_100079241 3300005842 Bacteria 3053
65 Ga0068860_100061089 3300005843 Bacteria 3580
66 Ga0068862_100022786 3300005844 Bacteria 5240
67 Ga0081539_10004763 3300005985 Bacteria 14649
68 Ga0070717_10000148 3300006028 Bacteria 52362
69 Ga0075363_100063205 3300006048 Bacteria 1997
70 Ga0075364_10009846 3300006051 Bacteria 5749
71 Ga0075364_10060757 3300006051 Bacteria 2478
72 Ga0075362_10000274 3300006177 Bacteria 14383
73 Ga0075367_10005961 3300006178 Bacteria 6117
74 Ga0075366_10015752 3300006195 Bacteria 4339
75 Ga0097621_100111232 3300006237 Bacteria 2315
76 Ga0068871_100008766 3300006358 Bacteria 7282
77 Ga0075428_100179034 3300006844 Bacteria 2295
78 Ga0075431_100138276 3300006847 Bacteria 2511
79 Ga0075433_10027832 3300006852 Bacteria 4800
80 Ga0075433_10034152 3300006852 Bacteria 4366
81 Ga0075433_10079959 3300006852 Bacteria 2881
82 Ga0075433_10119104 3300006852 Bacteria 2343
83 Ga0075433_10184682 3300006852 Bacteria 1855
84 Ga0075434_100000056 3300006871 Bacteria 55889
85 Ga0075434_100003640 3300006871 Bacteria 13761
86 Ga0075434_100004060 3300006871 Bacteria 13124
87 Ga0075434_100007438 3300006871 Bacteria 10135
88 Ga0075434_100026273 3300006871 Bacteria 5702
89 Ga0075429_100009633 3300006880 Bacteria 8381
90 Ga0068865_100020611 3300006881 Bacteria 4277
91 Ga0075436_100000178 3300006914 Bacteria 39723
92 Ga0075436_100060520 3300006914 Bacteria 2616
93 Ga0097620_100056624 3300006931 Bacteria 3947
94 Ga0097620_100171474 3300006931 Bacteria 2251
95 Ga0075435_100000008 3300007076 Bacteria 115376
96 Ga0075435_100001012 3300007076 Bacteria 17824
97 Ga0075435_100001364 3300007076 Bacteria 15748
98 Ga0075435_100068419 3300007076 Bacteria 2893
99 Ga0105240_10000412 3300009093 Bacteria 79783
100 Ga0105240_10107689 3300009093 Bacteria 3379
101 Ga0105240_10183055 3300009093 Bacteria 2471
102 Ga0105240_10216473 3300009093 Bacteria 2234
103 Ga0111539_10000938 3300009094 Bacteria 38192
104 Ga0111539_10005268 3300009094 Bacteria 16742
105 Ga0111539_10146047 3300009094 Bacteria 2769
106 Ga0105245_10002289 3300009098 Bacteria 17333
107 Ga0105245_10196786 3300009098 Bacteria 1934
108 Ga0114129_10001468 3300009147 Bacteria 31889
109 Ga0114129_10002276 3300009147 Bacteria 26562
110 Ga0114129_10019392 3300009147 Bacteria 9685
111 Ga0114129_10019888 3300009147 Bacteria 9555
112 Ga0114129_10057540 3300009147 Bacteria 5440
113 Ga0114129_10081673 3300009147 Bacteria 4493
114 Ga0114129_10099976 3300009147 Bacteria 4013
115 Ga0114129_10114412 3300009147 Bacteria 3720
116 Ga0114129_10157577 3300009147 Bacteria 3104
117 Ga0114129_10189190 3300009147 Bacteria 2796
118 Ga0105243_10011158 3300009148 Bacteria 6796
119 Ga0105241_10012649 3300009174 Bacteria 6193
120 Ga0105248_10003548 3300009177 Bacteria 17288
121 Ga0105248_10021472 3300009177 Bacteria 7151
122 Ga0105249_10132811 3300009553 Bacteria 2378
123 Ga0105249_10179211 3300009553 Bacteria 2060
124 Ga0105249_10215309 3300009553 Bacteria 1887
125 Ga0157370_10178321 3300013104 Bacteria 1975
126 Ga0157374_10009099 3300013296 Bacteria 8512
127 Ga0157374_10201245 3300013296 Bacteria 1950
128 Ga0163162_10073240 3300013306 Bacteria 3481
129 Ga0157372_10062119 3300013307 Bacteria 4184
130 Ga0157372_10124820 3300013307 Bacteria 2959
131 Ga0157380_10093823 3300014326 Bacteria 2483
132 Ga0157376_10114497 3300014969 Bacteria 2379
133 Ga0207697_10000533 3300025315 Bacteria 21517
134 Ga0207697_10017896 3300025315 Bacteria 2910
135 Ga0207680_10022242 3300025903 Bacteria 3445
136 Ga0207645_10010107 3300025907 Bacteria 6495
137 Ga0207684_10007958 3300025910 Bacteria 9474
138 Ga0207684_10019002 3300025910 Bacteria 5879
139 Ga0207654_10010606 3300025911 Bacteria 4692
140 Ga0207707_10140842 3300025912 Bacteria 2109
141 Ga0207695_10000337 3300025913 Bacteria 110325
142 Ga0207695_10000783 3300025913 Bacteria 60141
143 Ga0207695_10111327 3300025913 Bacteria 2717
144 Ga0207662_10006926 3300025918 Bacteria 6147
145 Ga0207662_10061586 3300025918 Bacteria 2253
146 Ga0207646_10005054 3300025922 Bacteria 14028
147 Ga0207646_10052525 3300025922 Bacteria 3647
148 Ga0207681_10004053 3300025923 Bacteria 9090
149 Ga0207681_10008729 3300025923 Bacteria 6192
150 Ga0207650_10026290 3300025925 Bacteria 4150
151 Ga0207659_10000621 3300025926 Bacteria 21047
152 Ga0207659_10029832 3300025926 Bacteria 3721
153 Ga0207687_10002013 3300025927 Bacteria 13949
154 Ga0207687_10082015 3300025927 Bacteria 2332
155 Ga0207664_10116424 3300025929 Bacteria 2230
156 Ga0207644_10042192 3300025931 Bacteria 3232
157 Ga0207690_10032845 3300025932 Bacteria 3333
158 Ga0207706_10063781 3300025933 Bacteria 3243
159 Ga0207670_10021297 3300025936 Bacteria 3998
160 Ga0207669_10004265 3300025937 Bacteria 6276
161 Ga0207704_10042878 3300025938 Bacteria 2667
162 Ga0207704_10071587 3300025938 Bacteria 2201
163 Ga0207691_10001794 3300025940 Bacteria 21072
164 Ga0207691_10003567 3300025940 Bacteria 15141
165 Ga0207691_10009896 3300025940 Bacteria 9153
166 Ga0207691_10103564 3300025940 Bacteria 2538
167 Ga0207691_10117928 3300025940 Bacteria 2355
168 Ga0207711_10005357 3300025941 Bacteria 10864
169 Ga0207711_10234035 3300025941 Bacteria 1683
170 Ga0207661_10001995 3300025944 Bacteria 14046
171 Ga0207679_10026340 3300025945 Bacteria 4008
172 Ga0207679_10061874 3300025945 Bacteria 2788
173 Ga0207667_10007769 3300025949 Bacteria 12820
174 Ga0207667_10139439 3300025949 Bacteria 2497
175 Ga0207651_10018776 3300025960 Bacteria 4125
176 Ga0207640_10001726 3300025981 Bacteria 11726
177 Ga0207677_10059022 3300026023 Bacteria 2644
178 Ga0207677_10170134 3300026023 Bacteria 1703
179 Ga0207703_10044093 3300026035 Bacteria 3583
180 Ga0207703_10045359 3300026035 Bacteria 3536
181 Ga0207708_10002297 3300026075 Bacteria 14057
182 Ga0207708_10029910 3300026075 Bacteria 4130
183 Ga0207708_10038070 3300026075 Bacteria 3664
184 Ga0207708_10059067 3300026075 Bacteria 2927
185 Ga0207702_10000487 3300026078 Bacteria 44675
186 Ga0207641_10082418 3300026088 Bacteria 2795
187 Ga0207641_10099331 3300026088 Bacteria 2561
188 Ga0207648_10025986 3300026089 Bacteria 5207
189 Ga0207648_10028663 3300026089 Bacteria 4935
190 Ga0207674_10052910 3300026116 Bacteria 4139
191 Ga0207675_100036360 3300026118 Bacteria 4594
192 Ga0207683_10079916 3300026121 Bacteria 2900
193 Ga0207428_10034923 3300027907 Bacteria 4115
194 Ga0207428_10043105 3300027907 Bacteria 3646
195 Ga0268266_10004932 3300028379 Bacteria 12642
196 Ga0268266_10020122 3300028379 Bacteria 5689
197 Ga0268265_10036496 3300028380 Bacteria 3601
198 Ga0268264_10076382 3300028381 Bacteria 2850
199 Ga0307515_10000056 3300028794 Bacteria 261973
200 Ga0265338_10013214 3300028800 Bacteria 9344
201 Ga0265338_10073289 3300028800 Bacteria 2919
202 Ga0265332_10010700 3300031238 Bacteria 4080
203 Ga0265320_10012334 3300031240 Bacteria 4982
204 Ga0265339_10005120 3300031249 Bacteria 8795
205 Ga0265327_10000921 3300031251 Bacteria 43096
206 Ga0265327_10019022 3300031251 Bacteria 4238
207 Ga0265316_10053924 3300031344 Bacteria 3149
208 Ga0265314_10002733 3300031711 Bacteria 17626
209 Ga0265314_10007053 3300031711 Bacteria 9809
210 Ga0265342_10000727 3300031712 Bacteria 33997
211 Ga0307410_10093686 3300031852 Bacteria 2138
212 Ga0307409_100232191 3300031995 Bacteria 1673
213 Ga0307416_100012602 3300032002 Bacteria 5706
214 Ga0307416_100130797 3300032002 Bacteria 2259
215 Ga0307416_100132319 3300032002 Bacteria 2248
216 Ga0373930_0001579 3300034816 Bacteria 3418
217 Ga0373948_0003330 3300034817 Bacteria 2462
218 Ga0373950_0000125 3300034818 Bacteria 13264
219 Ga0373959_0002052 3300034820 Bacteria 3214
220 Ga0373938_0000240 3300034957 Bacteria 8530
221 Ga0373929_0001025 3300035085 Bacteria 5425
222 Ga0373940_0010681 3300035088 Bacteria 2165
223 Ga0373949_0000368 3300035090 Bacteria 15951
224 Ga0373951_0006438 3300035091 Bacteria 2685
225 Ga0373952_0000893 3300035092 Bacteria 5425
226 Ga0373932_0001404 3300035112 Bacteria 6747
227 Ga0373941_0000812 3300035115 Bacteria 6403
228 Ga0373942_0000385 3300035207 Bacteria 12202
229 Ga0373961_0001950 3300035241 Bacteria 5590
230 Ga0373962_0004865 3300035242 Bacteria 3246
231 Ga0373931_0033312 3300035691 Bacteria 2669
232 Ga0373937_0001733 3300036401 Bacteria 18338
233 Ga0373937_0168800 3300036401 Bacteria 2053
234 Ga0395905_0000239 3300037471 Bacteria 83128
235 Ga0436365_0366145 3300039437 Bacteria 6188
236 Ga0451791_0923904 3300041451 Bacteria 1868
237 Ga0451807_1063097 3300041486 Bacteria 17634
238 Ga0439431_0004721 3300041997 Bacteria 2997
239 Ga0439464_0000947 3300042439 Bacteria 6547
240 Ga0451577_0000226 3300042876 Bacteria 114990
241 Ga0451577_0014641 3300042876 Bacteria 7308
242 Ga0451576_0002360 3300045051 Bacteria 28451
243 Ga0451576_0195633 3300045051 Bacteria 2112
244 Ga0495582_0080046 3300046473 Bacteria 1814
245 Ga0495618_0018505 3300046514 Bacteria 4277
246 Ga0495630_0256566 3300046517 Bacteria 1336
247 Ga0495586_0027355 3300046535 Bacteria 3052
248 Ga0495633_0064541 3300046558 Bacteria 1712
249 Ga0495613_0015814 3300046689 Bacteria 5617
250 Ga0495674_0145857 3300047319 Bacteria 1987
251 Ga0496106_0108739 3300048909 Bacteria 2156
252 Ga0496107_0181056 3300048910 Bacteria 1565
253 Ga0496108_0030105 3300048911 Bacteria 4499
254 Ga0501031_0001679 3300049568 Bacteria 13904
255 Ga0501031_0015515 3300049568 Bacteria 4945
256 Ga0501031_0033073 3300049568 Bacteria 3372
257 Ga0501031_0099430 3300049568 Bacteria 1898
258 Ga0501032_0002401 3300049569 Bacteria 14600
259 Ga0501032_0003440 3300049569 Bacteria 12122
260 Ga0501032_0062657 3300049569 Bacteria 2491
261 Ga0501033_0001958 3300049570 Bacteria 17926
262 Ga0501033_0003935 3300049570 Bacteria 12047
263 Ga0501033_0003983 3300049570 Bacteria 11956
264 Ga0501034_0000132 3300049571 Bacteria 138635
265 Ga0501034_0013451 3300049571 Bacteria 8423
266 Ga0501034_0037125 3300049571 Bacteria 4933
267 Ga0501034_0050258 3300049571 Bacteria 4205
268 Ga0501034_0111554 3300049571 Bacteria 2725
269 Ga0501034_0114048 3300049571 Bacteria 2691
270 Ga0501036_0004098 3300049572 Bacteria 11726
271 Ga0501036_0005270 3300049572 Bacteria 10459
272 Ga0501036_0083091 3300049572 Bacteria 2707
273 Ga0501037_0002390 3300049573 Bacteria 13548
274 Ga0501037_0041087 3300049573 Bacteria 3401
275 Ga0501037_0049580 3300049573 Bacteria 3074
276 Ga0501037_0060411 3300049573 Bacteria 2764
277 Ga0501038_0001699 3300049574 Bacteria 20423
278 Ga0501038_0004305 3300049574 Bacteria 13232
279 Ga0501038_0005063 3300049574 Bacteria 12246
280 Ga0501038_0129919 3300049574 Bacteria 2069
281 Ga0501039_0027027 3300049575 Bacteria 4411
282 Ga0501039_0033258 3300049575 Bacteria 3977
283 Ga0501039_0052917 3300049575 Bacteria 3141
284 Ga0501039_0072802 3300049575 Bacteria 2670
285 Ga0501042_0009631 3300049578 Bacteria 6451
286 Ga0501042_0017494 3300049578 Bacteria 4944
287 Ga0501042_0079707 3300049578 Bacteria 2346
288 Ga0501043_0002446 3300049579 Bacteria 15716
289 Ga0501043_0010660 3300049579 Bacteria 7199
290 Ga0501043_0015333 3300049579 Bacteria 6002
291 Ga0501043_0054187 3300049579 Bacteria 3149
292 Ga0501043_0076610 3300049579 Bacteria 2628
293 Ga0501046_0000083 3300049580 Bacteria 100973
294 Ga0501046_0004988 3300049580 Bacteria 11917
295 Ga0501046_0019031 3300049580 Bacteria 5699
296 Ga0501046_0020629 3300049580 Bacteria 5447
297 Ga0501046_0021570 3300049580 Bacteria 5315
298 Ga0501046_0069175 3300049580 Bacteria 2747
299 Ga0501047_0000916 3300049581 Bacteria 30163
300 Ga0501047_0001748 3300049581 Bacteria 21043
301 Ga0501047_0005339 3300049581 Bacteria 12080
302 Ga0501047_0006868 3300049581 Bacteria 10696
303 Ga0501047_0011744 3300049581 Bacteria 8282
304 Ga0501048_0002372 3300049582 Bacteria 14390
305 Ga0501048_0007682 3300049582 Bacteria 8174
306 Ga0501067_0008144 3300049583 Bacteria 5823
307 Ga0501067_0054598 3300049583 Bacteria 2213
308 Ga0501067_0054651 3300049583 Bacteria 2212
309 Ga0501068_0002920 3300049584 Bacteria 9099
310 Ga0501068_0004743 3300049584 Bacteria 7394
311 Ga0501068_0060016 3300049584 Bacteria 2309
312 Ga0501069_0001387 3300049585 Bacteria 11891
313 Ga0501069_0045465 3300049585 Bacteria 2433
314 Ga0501070_0009070 3300049586 Bacteria 8415
315 Ga0501070_0029465 3300049586 Bacteria 4601
316 Ga0501070_0065077 3300049586 Bacteria 3019
317 Ga0501070_0128913 3300049586 Bacteria 2090
318 Ga0501071_0000319 3300049587 Bacteria 23183
319 Ga0501071_0029416 3300049587 Bacteria 3877
320 Ga0501072_0016429 3300049588 Bacteria 5683
321 Ga0501072_0018360 3300049588 Bacteria 5384
322 Ga0501072_0026227 3300049588 Bacteria 4543
323 Ga0501072_0039206 3300049588 Bacteria 3720
324 Ga0501073_0004059 3300049589 Bacteria 11003
325 Ga0501073_0012601 3300049589 Bacteria 6168
326 Ga0501073_0046912 3300049589 Bacteria 3037
327 Ga0501073_0066962 3300049589 Bacteria 2503
328 Ga0501073_0093313 3300049589 Bacteria 2091
329 Ga0501074_0000628 3300049590 Bacteria 21897
330 Ga0501074_0002392 3300049590 Bacteria 13083
331 Ga0501074_0023402 3300049590 Bacteria 4492
332 Ga0501074_0053611 3300049590 Bacteria 2908
333 Ga0501075_0023594 3300049591 Bacteria 4506
334 Ga0501076_0005560 3300049592 Bacteria 9081
335 Ga0501076_0028437 3300049592 Bacteria 4341
336 Ga0501076_0068639 3300049592 Bacteria 2831
337 Ga0501076_0141584 3300049592 Bacteria 1954
338 Ga0501079_0002828 3300049741 Bacteria 12657
339 Ga0501079_0006308 3300049741 Bacteria 8892
340 Ga0501079_0030731 3300049741 Bacteria 4127
341 Ga0501079_0093140 3300049741 Bacteria 2334
342 Ga0501080_0019420 3300049742 Bacteria 6295
343 Ga0501080_0024164 3300049742 Bacteria 5634
344 Ga0501080_0037283 3300049742 Bacteria 4539
345 Ga0501080_0078790 3300049742 Bacteria 3064
346 Ga0501080_0089015 3300049742 Bacteria 2867
347 Ga0501081_0018006 3300049743 Bacteria 4687
348 Ga0501083_0000007 3300049744 Bacteria 198507
349 Ga0501083_0009745 3300049744 Bacteria 6783
350 Ga0501083_0012529 3300049744 Bacteria 5932
351 Ga0501083_0032322 3300049744 Bacteria 3589
352 Ga0501035_0003980 3300049822 Bacteria 14084
353 Ga0501035_0004046 3300049822 Bacteria 13964
354 Ga0501035_0060823 3300049822 Bacteria 3362
355 Ga0501035_0119653 3300049822 Bacteria 2303
356 Ga0501044_0000143 3300049823 Bacteria 87885
357 Ga0501044_0009112 3300049823 Bacteria 10840
358 Ga0501044_0009797 3300049823 Bacteria 10419
359 Ga0501044_0011849 3300049823 Bacteria 9448
360 Ga0501044_0029304 3300049823 Bacteria 5804
361 Ga0501044_0117286 3300049823 Bacteria 2666
362 Ga0501044_0146431 3300049823 Bacteria 2347
363 Ga0501045_0003373 3300049824 Bacteria 10931
364 Ga0501045_0073258 3300049824 Bacteria 2522
365 nmdc:mga03683_339_c1 3300050489 Bacteria 13705
366 nmdc:mga03n38_9116_c1 3300050490 Bacteria 3592
367 nmdc:mga00v17_19116_c1 3300050491 Bacteria 3905
368 nmdc:mga00v17_3462_c1 3300050491 Bacteria 8169
369 nmdc:mga0k408_1910_c1 3300050493 Bacteria 11149
370 nmdc:mga05p37_102540_c1 3300050507 Bacteria 3524
371 nmdc:mga05p37_104760_c1 3300050507 Bacteria 3480
372 nmdc:mga05p37_16312_c1 3300050507 Bacteria 8942
373 nmdc:mga05p37_195176_c1 3300050507 Bacteria 2455
374 nmdc:mga05p37_22199_c1 3300050507 Bacteria 7694
375 nmdc:mga05p37_38721_c1 3300050507 Bacteria 5849
376 nmdc:mga05p37_40284_c1 3300050507 Bacteria 5736
377 nmdc:mga05p37_43831_c1 3300050507 Bacteria 5505
378 nmdc:mga05p37_44628_c1 3300050507 Bacteria 5454
379 nmdc:mga05p37_45501_c1 3300050507 Bacteria 5397
380 nmdc:mga05p37_687_c1 3300050507 Bacteria 37482
381 nmdc:mga05p37_69565_c1 3300050507 Bacteria 3987
382 nmdc:mga09592_22383_c1 3300050508 Bacteria 5215
383 nmdc:mga09592_67782_c1 3300050508 Bacteria 3027
384 nmdc:mga08y16_17853_c2 3300050511 Bacteria 7111
385 nmdc:mga08y16_31736_c1 3300050511 Bacteria 5554
386 nmdc:mga08y16_65583_c1 3300050511 Bacteria 3790
387 nmdc:mga08y16_9106_c1 3300050511 Bacteria 10425
388 nmdc:mga0n895_100108_c1 3300050512 Bacteria 2907
389 nmdc:mga0n895_2922_c1 3300050512 Bacteria 13544
390 nmdc:mga0n895_30102_c1 3300050512 Bacteria 5184
391 nmdc:mga0n895_45978_c1 3300050512 Bacteria 4263
392 nmdc:mga0n895_7_c1 3300050512 Bacteria 121855
393 nmdc:mga0rr50_2144_c1 3300050513 Bacteria 11031
394 nmdc:mga0rr50_37639_c1 3300050513 Bacteria 3494
395 nmdc:mga0rr50_3_c1 3300050513 Bacteria 353622
396 nmdc:mga0rr50_56859_c1 3300050513 Bacteria 2924
397 nmdc:mga0rr50_73343_c1 3300050513 Bacteria 2617
398 nmdc:mga08x19_179_c1 3300050514 Bacteria 50938
399 nmdc:mga08x19_30469_c1 3300050514 Bacteria 3389
400 nmdc:mga08x19_47133_c1 3300050514 Bacteria 2758
401 nmdc:mga0a205_13765_c1 3300050515 Bacteria 7539
402 nmdc:mga0a205_15122_c1 3300050515 Bacteria 7208
403 nmdc:mga0a205_7532_c2 3300050515 Bacteria 7471
404 nmdc:mga0a205_90979_c1 3300050515 Bacteria 2948
405 Ga0495612_0007709 3300053078 Bacteria 4395
406 Ga0500555_000094 3300053103 Bacteria 41445
407 Ga0500556_0000535 3300053104 Bacteria 25895
408 Ga0501084_0033102 3300054114 Bacteria 4323
409 Ga0501084_0061352 3300054114 Bacteria 3148
410 Ga0501084_0113897 3300054114 Bacteria 2273
411 Ga0501084_0149356 3300054114 Bacteria 1969
412 Ga0590077_007490 3300059426 Bacteria 2233
413 Ga0501082_0004448 3300060353 Bacteria 12238
414 Ga0501082_0005209 3300060353 Bacteria 11303
415 Ga0501082_0100986 3300060353 Bacteria 2495
416 Ga0530510_0163920 3300061734 Bacteria 1645
417 Ga0070697_100045360
418 rootH2_10000294
419 rootH1_10053077
420 Ga0065712_10087413
421 Ga0065715_10118842
422 Ga0070658_10011193
423 Ga0070676_10011010
424 Ga0070670_100029371
425 Ga0070666_10007712
426 Ga0070666_10105082
427 Ga0068868_100028299
428 Ga0070689_100119522
429 Ga0070691_10026304
430 Ga0070687_100019910
431 Ga0070687_100050290
432 Ga0070669_100007157
433 Ga0070675_100000083
434 Ga0070675_100027388
435 Ga0070674_100001468
436 Ga0070674_100009903
437 Ga0070673_100007413
438 Ga0070673_100162350
439 Ga0070673_100191280
440 Ga0070659_100108891
441 Ga0070659_100188387
442 Ga0070667_100016931
443 Ga0070714_100019178
444 Ga0070705_100036072
445 Ga0070705_100099683
446 Ga0070700_100018325
447 Ga0070708_100037617
448 Ga0070681_10159281
449 Ga0070685_10018493
450 Ga0070706_100008256
451 Ga0070706_100013739
452 Ga0070707_100004281
453 Ga0070707_100005838
454 Ga0070698_100001691
455 Ga0070698_100112943
456 Ga0070699_100008450
457 Ga0070697_100014426
458 Ga0070672_100001350
459 Ga0070686_100000585
460 Ga0070695_100020495
461 Ga0070693_100014820
462 Ga0070693_100062033
463 Ga0070665_100001505
464 Ga0070665_100009316
465 Ga0070665_100204550
466 Ga0070704_100008952
467 Ga0068855_100003757
468 Ga0068855_100172615
469 Ga0068857_100027350
470 Ga0068854_100020086
471 Ga0068856_100014106
472 Ga0068856_100037853
473 Ga0070702_100001873
474 Ga0068859_100056624
475 Ga0068859_100171472
476 Ga0068861_100032639
477 Ga0068863_100010821
478 Ga0068858_100014483
479 Ga0068858_100058087
480 Ga0068858_100079241
481 Ga0068860_100061089
482 Ga0068862_100022786
483 Ga0081539_10004763
484 Ga0070717_10000148
485 Ga0075363_100063205
486 Ga0075364_10009846
487 Ga0075364_10060757
488 Ga0075362_10000274
489 Ga0075367_10005961
490 Ga0075366_10015752
491 Ga0097621_100111232
492 Ga0068871_100008766
493 Ga0075428_100179034
494 Ga0075431_100138276
495 Ga0075433_10027832
496 Ga0075433_10034152
497 Ga0075433_10079959
498 Ga0075433_10119104
499 Ga0075433_10184682
500 Ga0075434_100000056
501 Ga0075434_100003640
502 Ga0075434_100004060
503 Ga0075434_100007438
504 Ga0075434_100026273
505 Ga0075429_100009633
506 Ga0068865_100020611
507 Ga0075436_100000178
508 Ga0075436_100060520
509 Ga0097620_100056624
510 Ga0097620_100171474
511 Ga0075435_100000008
512 Ga0075435_100001012
513 Ga0075435_100001364
514 Ga0075435_100068419
515 Ga0105240_10000412
516 Ga0105240_10107689
517 Ga0105240_10183055
518 Ga0105240_10216473
519 Ga0111539_10000938
520 Ga0111539_10005268
521 Ga0111539_10146047
522 Ga0105245_10002289
523 Ga0105245_10196786
524 Ga0114129_10001468
525 Ga0114129_10002276
526 Ga0114129_10019392
527 Ga0114129_10019888
528 Ga0114129_10057540
529 Ga0114129_10081673
530 Ga0114129_10099976
531 Ga0114129_10114412
532 Ga0114129_10157577
533 Ga0114129_10189190
534 Ga0105243_10011158
535 Ga0105241_10012649
536 Ga0105248_10003548
537 Ga0105248_10021472
538 Ga0105249_10132811
539 Ga0105249_10179211
540 Ga0105249_10215309
541 Ga0157370_10178321
542 Ga0157374_10009099
543 Ga0157374_10201245
544 Ga0163162_10073240
545 Ga0157372_10062119
546 Ga0157372_10124820
547 Ga0157380_10093823
548 Ga0157376_10114497
549 Ga0207697_10000533
550 Ga0207697_10017896
551 Ga0207680_10022242
552 Ga0207645_10010107
553 Ga0207684_10007958
554 Ga0207684_10019002
555 Ga0207654_10010606
556 Ga0207707_10140842
557 Ga0207695_10000337
558 Ga0207695_10000783
559 Ga0207695_10111327
560 Ga0207662_10006926
561 Ga0207662_10061586
562 Ga0207646_10005054
563 Ga0207646_10052525
564 Ga0207681_10004053
565 Ga0207681_10008729
566 Ga0207650_10026290
567 Ga0207659_10000621
568 Ga0207659_10029832
569 Ga0207687_10002013
570 Ga0207687_10082015
571 Ga0207664_10116424
572 Ga0207644_10042192
573 Ga0207690_10032845
574 Ga0207706_10063781
575 Ga0207670_10021297
576 Ga0207669_10004265
577 Ga0207704_10042878
578 Ga0207704_10071587
579 Ga0207691_10001794
580 Ga0207691_10003567
581 Ga0207691_10009896
582 Ga0207691_10103564
583 Ga0207691_10117928
584 Ga0207711_10005357
585 Ga0207711_10234035
586 Ga0207661_10001995
587 Ga0207679_10026340
588 Ga0207679_10061874
589 Ga0207667_10007769
590 Ga0207667_10139439
591 Ga0207651_10018776
592 Ga0207640_10001726
593 Ga0207677_10059022
594 Ga0207677_10170134
595 Ga0207703_10044093
596 Ga0207703_10045359
597 Ga0207708_10002297
598 Ga0207708_10029910
599 Ga0207708_10038070
600 Ga0207708_10059067
601 Ga0207702_10000487
602 Ga0207641_10082418
603 Ga0207641_10099331
604 Ga0207648_10025986
605 Ga0207648_10028663
606 Ga0207674_10052910
607 Ga0207675_100036360
608 Ga0207683_10079916
609 Ga0207428_10034923
610 Ga0207428_10043105
611 Ga0268266_10004932
612 Ga0268266_10020122
613 Ga0268265_10036496
614 Ga0268264_10076382
615 Ga0307515_10000056
616 Ga0265338_10013214
617 Ga0265338_10073289
618 Ga0265332_10010700
619 Ga0265320_10012334
620 Ga0265339_10005120
621 Ga0265327_10000921
622 Ga0265327_10019022
623 Ga0265316_10053924
624 Ga0265314_10002733
625 Ga0265314_10007053
626 Ga0265342_10000727
627 Ga0307410_10093686
628 Ga0307409_100232191
629 Ga0307416_100012602
630 Ga0307416_100130797
631 Ga0307416_100132319
632 Ga0373930_0001579
633 Ga0373948_0003330
634 Ga0373950_0000125
635 Ga0373959_0002052
636 Ga0373938_0000240
637 Ga0373929_0001025
638 Ga0373940_0010681
639 Ga0373949_0000368
640 Ga0373951_0006438
641 Ga0373952_0000893
642 Ga0373932_0001404
643 Ga0373941_0000812
644 Ga0373942_0000385
645 Ga0373961_0001950
646 Ga0373962_0004865
647 Ga0373931_0033312
648 Ga0373937_0001733
649 Ga0373937_0168800
650 Ga0395905_0000239
651 Ga0436365_0366145
652 Ga0451791_0923904
653 Ga0451807_1063097
654 Ga0439431_0004721
655 Ga0439464_0000947
656 Ga0451577_0000226
657 Ga0451577_0014641
658 Ga0451576_0002360
659 Ga0451576_0195633
660 Ga0495582_0080046
661 Ga0495618_0018505
662 Ga0495630_0256566
663 Ga0495586_0027355
664 Ga0495633_0064541
665 Ga0495613_0015814
666 Ga0495674_0145857
667 Ga0496106_0108739
668 Ga0496107_0181056
669 Ga0496108_0030105
670 Ga0501031_0001679
671 Ga0501031_0015515
672 Ga0501031_0033073
673 Ga0501031_0099430
674 Ga0501032_0002401
675 Ga0501032_0003440
676 Ga0501032_0062657
677 Ga0501033_0001958
678 Ga0501033_0003935
679 Ga0501033_0003983
680 Ga0501034_0000132
681 Ga0501034_0013451
682 Ga0501034_0037125
683 Ga0501034_0050258
684 Ga0501034_0111554
685 Ga0501034_0114048
686 Ga0501036_0004098
687 Ga0501036_0005270
688 Ga0501036_0083091
689 Ga0501037_0002390
690 Ga0501037_0041087
691 Ga0501037_0049580
692 Ga0501037_0060411
693 Ga0501038_0001699
694 Ga0501038_0004305
695 Ga0501038_0005063
696 Ga0501038_0129919
697 Ga0501039_0027027
698 Ga0501039_0033258
699 Ga0501039_0052917
700 Ga0501039_0072802
701 Ga0501042_0009631
702 Ga0501042_0017494
703 Ga0501042_0079707
704 Ga0501043_0002446
705 Ga0501043_0010660
706 Ga0501043_0015333
707 Ga0501043_0054187
708 Ga0501043_0076610
709 Ga0501046_0000083
710 Ga0501046_0004988
711 Ga0501046_0019031
712 Ga0501046_0020629
713 Ga0501046_0021570
714 Ga0501046_0069175
715 Ga0501047_0000916
716 Ga0501047_0001748
717 Ga0501047_0005339
718 Ga0501047_0006868
719 Ga0501047_0011744
720 Ga0501048_0002372
721 Ga0501048_0007682
722 Ga0501067_0008144
723 Ga0501067_0054598
724 Ga0501067_0054651
725 Ga0501068_0002920
726 Ga0501068_0004743
727 Ga0501068_0060016
728 Ga0501069_0001387
729 Ga0501069_0045465
730 Ga0501070_0009070
731 Ga0501070_0029465
732 Ga0501070_0065077
733 Ga0501070_0128913
734 Ga0501071_0000319
735 Ga0501071_0029416
736 Ga0501072_0016429
737 Ga0501072_0018360
738 Ga0501072_0026227
739 Ga0501072_0039206
740 Ga0501073_0004059
741 Ga0501073_0012601
742 Ga0501073_0046912
743 Ga0501073_0066962
744 Ga0501073_0093313
745 Ga0501074_0000628
746 Ga0501074_0002392
747 Ga0501074_0023402
748 Ga0501074_0053611
749 Ga0501075_0023594
750 Ga0501076_0005560
751 Ga0501076_0028437
752 Ga0501076_0068639
753 Ga0501076_0141584
754 Ga0501079_0002828
755 Ga0501079_0006308
756 Ga0501079_0030731
757 Ga0501079_0093140
758 Ga0501080_0019420
759 Ga0501080_0024164
760 Ga0501080_0037283
761 Ga0501080_0078790
762 Ga0501080_0089015
763 Ga0501081_0018006
764 Ga0501083_0000007
765 Ga0501083_0009745
766 Ga0501083_0012529
767 Ga0501083_0032322
768 Ga0501035_0003980
769 Ga0501035_0004046
770 Ga0501035_0060823
771 Ga0501035_0119653
772 Ga0501044_0000143
773 Ga0501044_0009112
774 Ga0501044_0009797
775 Ga0501044_0011849
776 Ga0501044_0029304
777 Ga0501044_0117286
778 Ga0501044_0146431
779 Ga0501045_0003373
780 Ga0501045_0073258
781 nmdc:mga03683_339_c1
782 nmdc:mga03n38_9116_c1
783 nmdc:mga00v17_19116_c1
784 nmdc:mga00v17_3462_c1
785 nmdc:mga0k408_1910_c1
786 nmdc:mga05p37_102540_c1
787 nmdc:mga05p37_104760_c1
788 nmdc:mga05p37_16312_c1
789 nmdc:mga05p37_195176_c1
790 nmdc:mga05p37_22199_c1
791 nmdc:mga05p37_38721_c1
792 nmdc:mga05p37_40284_c1
793 nmdc:mga05p37_43831_c1
794 nmdc:mga05p37_44628_c1
795 nmdc:mga05p37_45501_c1
796 nmdc:mga05p37_687_c1
797 nmdc:mga05p37_69565_c1
798 nmdc:mga09592_22383_c1
799 nmdc:mga09592_67782_c1
800 nmdc:mga08y16_17853_c2
801 nmdc:mga08y16_31736_c1
802 nmdc:mga08y16_65583_c1
803 nmdc:mga08y16_9106_c1
804 nmdc:mga0n895_100108_c1
805 nmdc:mga0n895_2922_c1
806 nmdc:mga0n895_30102_c1
807 nmdc:mga0n895_45978_c1
808 nmdc:mga0n895_7_c1
809 nmdc:mga0rr50_2144_c1
810 nmdc:mga0rr50_37639_c1
811 nmdc:mga0rr50_3_c1
812 nmdc:mga0rr50_56859_c1
813 nmdc:mga0rr50_73343_c1
814 nmdc:mga08x19_179_c1
815 nmdc:mga08x19_30469_c1
816 nmdc:mga08x19_47133_c1
817 nmdc:mga0a205_13765_c1
818 nmdc:mga0a205_15122_c1
819 nmdc:mga0a205_7532_c2
820 nmdc:mga0a205_90979_c1
821 Ga0495612_0007709
822 Ga0500555_000094
823 Ga0500556_0000535
824 Ga0501084_0033102
825 Ga0501084_0061352
826 Ga0501084_0113897
827 Ga0501084_0149356
828 Ga0590077_007490
829 Ga0501082_0004448
830 Ga0501082_0005209
831 Ga0501082_0100986
832 Ga0530510_0163920

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

271

424

0.92

PF00005

ABC_tran

ABC transporter

25

175

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
6z67-assembly3.cif.gz_E ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution 0.9055 6 228
6b89-assembly1.cif.gz_A e. coli lptb in complex with adp and novobiocin 0.8951 8 237
5xu1-assembly1.cif.gz_A structure of a non-canonical abc transporter from streptococcus pneumoniae r6 0.8947 6 226
7caf-assembly1.cif.gz_C mycobacterium smegmatis lpqy-sugabc complex in the pre-translocation state 0.8921 7 230
6mjp-assembly1.cif.gz_B lptb(e163q)fgc from vibrio cholerae 0.8911 8 240
ID Description Score Start End Superfamily
af_P0AAF3_266_503_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9679 267 489 3.40.50.300
af_P37388_2_240_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9666 6 242 3.40.50.300
af_P77257_270_507_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9618 263 494 3.40.50.300
af_P0AAG8_265_500_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9592 260 484 3.40.50.300
af_P04983_256_497_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.956 260 494 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7X9PAI4-F1-model_v4 ATP-binding cassette domain-containing protein 0.962 275 490 GO:0005524
GO:0016887
AF-A0A2T0UCU5-F1-model_v4 Monosaccharide ABC transporter ATP-binding protein (CUT2 family) 0.96 8 242 GO:0005524
GO:0016887
AF-A0A6J6IZJ1-F1-model_v4 Unannotated protein 0.9593 4 242 GO:0005524
GO:0016887
AF-A0A7W8U6K7-F1-model_v4 Fructose transport system ATP-binding protein 0.9592 4 242 GO:0005524
GO:0016887
AF-A0A3B9RPV4-F1-model_v4 D-xylose ABC transporter ATP-binding protein 0.9575 252 490 GO:0005524
GO:0016887

Map