F438544

General Info

Members Datasets Scaffolds Average Seq Length
415 220 414 282

Family's Representative Sequence

Representative Sequence 3300009101|Ga0105247_10009786|Ga0105247_100097862
Length 302
Sequence MSEALVAEGPDMGHCHASLLPSRAVLRIGGADARKFLQGLLTNDIDKARGGAAVHTGLLSPQGKILFDFFAVPDGDGFLIDVAEDKAAELMQRLGFYRLRAAVEIAVAPSLAVAAAWGALPRLIEGAILYADPRLPELGFRLLVPKATNAADLGCEPSSEADYQALRIRLGVPEGGRDYAFGDAFPHEALFDQLNGVDFAKGCYIGQEVVSRMEHRGTARKRIVPVAGDAPLPASGTSIEADGMPIGTLGSVSGAAGLGLIRLDRAEEALAQAKTLTAGGVKIALRRPAFARFAVPVAEALA

Samples

Sample ID Description Type Environment
1 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
2 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
75 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
76 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
113 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
117 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
118 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
119 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
120 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
121 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
122 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
123 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
124 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
125 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
126 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
127 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
128 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
129 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
130 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
131 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
132 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
133 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
134 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
135 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
136 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
137 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
138 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
139 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
140 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
141 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
142 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
143 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
144 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
145 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
146 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
147 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
148 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
149 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
150 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
151 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
152 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
153 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
154 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
155 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
156 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
157 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
158 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
159 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
160 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
161 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
162 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
163 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
164 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
165 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
166 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
167 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
168 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
169 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
170 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
171 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
172 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
173 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
174 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
175 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
176 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
177 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
190 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
191 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
192 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
193 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
194 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
195 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
196 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
197 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
198 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
199 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
200 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
201 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
202 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
203 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
206 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
207 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
208 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
209 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
210 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
211 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
212 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
213 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
214 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
215 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
216 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
217 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
218 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
219 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
220 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.52
Metatranscriptomes 0.24
Isolates 0.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.65
Nodule 0
Rhizoplane 9.16
Rhizosphere 87.71
Stem 0
Stem Tuber 0
Unclassified 0.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25165J46597_1000003 3300003214 Bacteria 694080
2 Ga0070658_10280186 3300005327 Bacteria 1419
3 Ga0070676_10006897 3300005328 Bacteria 6080
4 Ga0070683_100238102 3300005329 Bacteria 1731
5 Ga0070683_100628057 3300005329 Bacteria 1028
6 Ga0070690_100018348 3300005330 Bacteria 4225
7 Ga0070690_100177297 3300005330 Bacteria 1471
8 Ga0068869_100009237 3300005334 Bacteria 6390
9 Ga0068869_100149207 3300005334 Bacteria 1812
10 Ga0068869_100274785 3300005334 Bacteria 1353
11 Ga0070666_10273388 3300005335 Bacteria 1200
12 Ga0070666_10287475 3300005335 Bacteria 1169
13 Ga0068868_100126159 3300005338 Bacteria 2091
14 Ga0070668_100009459 3300005347 Bacteria 7229
15 Ga0070668_100122064 3300005347 Bacteria 2084
16 Ga0070669_100302418 3300005353 Bacteria 1287
17 Ga0070675_100041531 3300005354 Bacteria 3757
18 Ga0070671_100052025 3300005355 Bacteria 3406
19 Ga0070674_100083127 3300005356 Bacteria 2292
20 Ga0070674_100105886 3300005356 Bacteria 2057
21 Ga0070673_100050167 3300005364 Bacteria 3262
22 Ga0070673_100139298 3300005364 Bacteria 2045
23 Ga0070673_100516261 3300005364 Bacteria 1082
24 Ga0070688_100017102 3300005365 Bacteria 4160
25 Ga0070659_100169508 3300005366 Bacteria 1788
26 Ga0070667_100149992 3300005367 Bacteria 2047
27 Ga0070667_100288528 3300005367 Bacteria 1475
28 Ga0070667_100385398 3300005367 Bacteria 1274
29 Ga0070710_10142184 3300005437 Bacteria 1472
30 Ga0070705_100066873 3300005440 Bacteria 2157
31 Ga0070694_100044641 3300005444 Bacteria 2967
32 Ga0070678_100067775 3300005456 Bacteria 2658
33 Ga0068867_100018214 3300005459 Bacteria 4990
34 Ga0068867_100021718 3300005459 Bacteria 4581
35 Ga0068867_100321530 3300005459 Bacteria 1282
36 Ga0068853_100027244 3300005539 Bacteria 4801
37 Ga0068853_100129002 3300005539 Bacteria 2262
38 Ga0070672_100258966 3300005543 Bacteria 1467
39 Ga0070686_100201879 3300005544 Bacteria 1426
40 Ga0070695_100014677 3300005545 Bacteria 4723
41 Ga0070665_100010107 3300005548 Bacteria 9545
42 Ga0070665_100018459 3300005548 Bacteria 6991
43 Ga0070665_100345297 3300005548 Bacteria 1493
44 Ga0070704_100195940 3300005549 Bacteria 1627
45 Ga0068855_100198469 3300005563 Bacteria 2260
46 Ga0070664_100368693 3300005564 Bacteria 1309
47 Ga0070664_100508640 3300005564 Bacteria 1111
48 Ga0068857_100286512 3300005577 Bacteria 1516
49 Ga0068856_100237542 3300005614 Bacteria 1838
50 Ga0068856_100487497 3300005614 Bacteria 1254
51 Ga0068852_100224273 3300005616 Bacteria 1789
52 Ga0068859_100499942 3300005617 Bacteria 1311
53 Ga0068864_100012779 3300005618 Bacteria 6940
54 Ga0068866_10022310 3300005718 Bacteria 2928
55 Ga0068861_100249487 3300005719 Bacteria 1514
56 Ga0068851_10050839 3300005834 Bacteria 2105
57 Ga0068870_10020200 3300005840 Bacteria 3240
58 Ga0068858_100015939 3300005842 Bacteria 7060
59 Ga0068858_100035019 3300005842 Bacteria 4657
60 Ga0070715_10142679 3300006163 Bacteria 1165
61 Ga0097621_100224264 3300006237 Bacteria 1639
62 Ga0068871_100071410 3300006358 Bacteria 2855
63 Ga0068871_100106690 3300006358 Bacteria 2352
64 Ga0068871_100434102 3300006358 Bacteria 1175
65 Ga0075434_100124026 3300006871 Bacteria 2600
66 Ga0068865_100007677 3300006881 Bacteria 6643
67 Ga0068865_100046407 3300006881 Bacteria 2981
68 Ga0097620_100499909 3300006931 Bacteria 1311
69 Ga0075435_100496458 3300007076 Bacteria 1055
70 Ga0105240_10098447 3300009093 Bacteria 3562
71 Ga0105240_10124883 3300009093 Bacteria 3094
72 Ga0105240_10557027 3300009093 Bacteria 1268
73 Ga0105245_10079194 3300009098 Bacteria 3000
74 Ga0105245_10136141 3300009098 Bacteria 2308
75 Ga0105245_10139774 3300009098 Bacteria 2279
76 Ga0105245_10367489 3300009098 Bacteria 1429
77 Ga0105247_10009786 3300009101 Bacteria 5809
78 Ga0114129_10271700 3300009147 Bacteria 2268
79 Ga0105243_10020489 3300009148 Bacteria 5013
80 Ga0105243_10057822 3300009148 Bacteria 3089
81 Ga0105241_10047328 3300009174 Bacteria 3270
82 Ga0105241_10152357 3300009174 Bacteria 1892
83 Ga0105241_10421414 3300009174 Bacteria 1175
84 Ga0105242_10046008 3300009176 Bacteria 3539
85 Ga0105242_10290337 3300009176 Bacteria 1489
86 Ga0105248_10022362 3300009177 Bacteria 7014
87 Ga0105248_10103092 3300009177 Bacteria 3215
88 Ga0105248_10247822 3300009177 Bacteria 2005
89 Ga0105237_10216880 3300009545 Bacteria 1913
90 Ga0105237_10231700 3300009545 Bacteria 1848
91 Ga0105238_10083910 3300009551 Bacteria 3175
92 Ga0105249_10007044 3300009553 Bacteria 9808
93 Ga0105249_10026075 3300009553 Bacteria 5265
94 Ga0105239_10020993 3300010375 Bacteria 7208
95 Ga0105239_10234681 3300010375 Bacteria 2058
96 Ga0105239_10251698 3300010375 Bacteria 1984
97 Ga0105246_10084843 3300011119 Bacteria 2267
98 Ga0105246_10090749 3300011119 Bacteria 2201
99 Ga0105246_10111631 3300011119 Bacteria 2009
100 Ga0105246_10115914 3300011119 Bacteria 1977
101 Ga0105246_10193982 3300011119 Bacteria 1574
102 Ga0157373_10216964 3300013100 Bacteria 1349
103 Ga0157369_10050758 3300013105 Bacteria 4490
104 Ga0157374_10044710 3300013296 Bacteria 4094
105 Ga0157374_10128034 3300013296 Bacteria 2455
106 Ga0157378_10008350 3300013297 Bacteria 9019
107 Ga0157378_10055308 3300013297 Bacteria 3535
108 Ga0157378_10055669 3300013297 Bacteria 3523
109 Ga0157378_10764113 3300013297 Unclassified 990
110 Ga0163162_10106038 3300013306 Bacteria 2905
111 Ga0163162_10139878 3300013306 Bacteria 2533
112 Ga0157372_10159961 3300013307 Bacteria 2602
113 Ga0157375_10011387 3300013308 Bacteria 7851
114 Ga0157375_10043821 3300013308 Bacteria 4342
115 Ga0157375_10176959 3300013308 Bacteria 2283
116 Ga0163163_10000002 3300014325 Bacteria 609846
117 Ga0163163_10223786 3300014325 Bacteria 1930
118 Ga0163163_10272775 3300014325 Bacteria 1743
119 Ga0157380_10059777 3300014326 Bacteria 3043
120 Ga0157380_10362609 3300014326 Bacteria 1360
121 Ga0157379_10004819 3300014968 Bacteria 11593
122 Ga0157379_10012165 3300014968 Bacteria 7516
123 Ga0157379_10029085 3300014968 Bacteria 4914
124 Ga0157379_10204566 3300014968 Bacteria 1786
125 Ga0157379_10348628 3300014968 Bacteria 1355
126 Ga0157376_10023632 3300014969 Bacteria 4814
127 Ga0157376_10087910 3300014969 Bacteria 2683
128 Ga0157376_10099032 3300014969 Bacteria 2542
129 Ga0163161_10036697 3300017792 Bacteria 3511
130 Ga0163161_10055557 3300017792 Bacteria 2874
131 Ga0207427_108006 3300025231 Bacteria 1203
132 Ga0209233_1000015 3300025261 Bacteria 980563
133 Ga0207710_10038632 3300025900 Bacteria 2111
134 Ga0207680_10093859 3300025903 Bacteria 1915
135 Ga0207680_10131896 3300025903 Bacteria 1648
136 Ga0207685_10056016 3300025905 Bacteria 1541
137 Ga0207645_10214335 3300025907 Bacteria 1269
138 Ga0207654_10028949 3300025911 Bacteria 3025
139 Ga0207654_10198440 3300025911 Bacteria 1320
140 Ga0207695_10090821 3300025913 Bacteria 3069
141 Ga0207695_10161212 3300025913 Bacteria 2174
142 Ga0207671_10442426 3300025914 Bacteria 1035
143 Ga0207693_10132156 3300025915 Bacteria 1962
144 Ga0207663_10095785 3300025916 Bacteria 1981
145 Ga0207687_10014900 3300025927 Bacteria 5092
146 Ga0207687_10337679 3300025927 Bacteria 1224
147 Ga0207706_10358038 3300025933 Bacteria 1268
148 Ga0207686_10251036 3300025934 Bacteria 1292
149 Ga0207709_10093253 3300025935 Bacteria 1974
150 Ga0207670_10192105 3300025936 Bacteria 1545
151 Ga0207669_10070111 3300025937 Bacteria 2196
152 Ga0207669_10098087 3300025937 Bacteria 1929
153 Ga0207704_10084201 3300025938 Bacteria 2066
154 Ga0207665_10086132 3300025939 Bacteria 2169
155 Ga0207691_10193169 3300025940 Bacteria 1775
156 Ga0207711_10008568 3300025941 Bacteria 8555
157 Ga0207689_10014919 3300025942 Bacteria 6592
158 Ga0207661_10159882 3300025944 Bacteria 1954
159 Ga0207679_10294762 3300025945 Bacteria 1396
160 Ga0207651_10118540 3300025960 Bacteria 2002
161 Ga0207651_10408829 3300025960 Bacteria 1156
162 Ga0207712_10022283 3300025961 Bacteria 4169
163 Ga0207712_10024580 3300025961 Bacteria 3992
164 Ga0207668_10199231 3300025972 Bacteria 1593
165 Ga0207658_10030336 3300025986 Bacteria 3827
166 Ga0207658_10102293 3300025986 Bacteria 2247
167 Ga0207658_10173370 3300025986 Bacteria 1779
168 Ga0207677_10076614 3300026023 Bacteria 2382
169 Ga0207677_10164599 3300026023 Bacteria 1727
170 Ga0207677_10338640 3300026023 Bacteria 1256
171 Ga0207703_10009813 3300026035 Bacteria 7510
172 Ga0207703_10028431 3300026035 Bacteria 4407
173 Ga0207703_10031546 3300026035 Bacteria 4191
174 Ga0207703_10101025 3300026035 Bacteria 2445
175 Ga0207639_10133979 3300026041 Bacteria 2055
176 Ga0207639_10379299 3300026041 Bacteria 1269
177 Ga0207678_10302121 3300026067 Bacteria 1375
178 Ga0207641_10214245 3300026088 Bacteria 1783
179 Ga0207648_10016758 3300026089 Bacteria 6684
180 Ga0207648_10023606 3300026089 Bacteria 5506
181 Ga0207674_10373769 3300026116 Bacteria 1378
182 Ga0207675_100006648 3300026118 Bacteria 10937
183 Ga0207675_100283965 3300026118 Bacteria 1609
184 Ga0207683_10033624 3300026121 Bacteria 4454
185 Ga0207683_10076085 3300026121 Bacteria 2972
186 Ga0209998_10007078 3300027717 Bacteria 2326
187 Ga0207428_10330529 3300027907 Bacteria 1124
188 Ga0268266_10007372 3300028379 Bacteria 9934
189 Ga0268266_10110992 3300028379 Bacteria 2429
190 Ga0268266_10414376 3300028379 Bacteria 1276
191 Ga0268265_10063206 3300028380 Bacteria 2847
192 Ga0268265_10222495 3300028380 Bacteria 1653
193 Ga0268264_10049906 3300028381 Bacteria 3483
194 Ga0268264_10374963 3300028381 Bacteria 1361
195 Ga0316575_10001036 3300031665 Bacteria 8625
196 Ga0316575_10095245 3300031665 Bacteria 1208
197 Ga0316576_10012661 3300031727 Bacteria 5579
198 Ga0316576_10015543 3300031727 Bacteria 5112
199 Ga0316578_10184949 3300031728 Bacteria 1255
200 Ga0316577_10004330 3300031733 Bacteria 7320
201 Ga0316577_10109070 3300031733 Bacteria 1553
202 Ga0316577_10179623 3300031733 Bacteria 1195
203 Ga0307406_10067991 3300031901 Bacteria 2325
204 Ga0307415_100398132 3300032126 Bacteria 1175
205 Ga0316583_10016582 3300032133 Bacteria 2650
206 Ga0316588_1046351 3300033528 Bacteria 1048
207 Ga0373941_0021320 3300035115 Bacteria 1827
208 Ga0373953_0062377 3300035117 Bacteria 1526
209 Ga0373954_0092828 3300035118 Bacteria 1451
210 Ga0373943_0001595 3300035170 Bacteria 10270
211 Ga0316574_0003206 3300035398 Bacteria 8382
212 Ga0316574_0087384 3300035398 Bacteria 1985
213 Ga0373927_0002114 3300035695 Bacteria 14645
214 Ga0373927_0118861 3300035695 Bacteria 1725
215 Ga0373933_0254557 3300035724 Bacteria 1131
216 Ga0373947_0002223 3300035725 Bacteria 11746
217 Ga0373937_0013033 3300036401 Bacteria 7322
218 Ga0373937_0030125 3300036401 Bacteria 4916
219 Ga0373937_0464566 3300036401 Bacteria 1202
220 Ga0316582_0346049 3300036647 Bacteria 1022
221 Ga0316584_0002158 3300036712 Bacteria 12317
222 Ga0316584_0021539 3300036712 Bacteria 4686
223 Ga0316584_0039347 3300036712 Bacteria 3520
224 Ga0373925_0027368 3300037068 Bacteria 4173
225 Ga0316581_0003709 3300037588 Bacteria 3828
226 Ga0436360_0796979 3300039438 Bacteria 6362
227 Ga0495603_0000388 3300046455 Bacteria 24093
228 Ga0495641_0011172 3300046461 Bacteria 5139
229 Ga0495580_0010115 3300046472 Bacteria 7368
230 Ga0495582_0001097 3300046473 Bacteria 15190
231 Ga0495639_0001533 3300046475 Bacteria 10306
232 Ga0495594_0000118 3300046499 Bacteria 37004
233 Ga0495596_0030928 3300046500 Bacteria 2141
234 Ga0495666_0031793 3300046526 Bacteria 2586
235 Ga0495652_0039078 3300046529 Bacteria 4105
236 Ga0495665_0012636 3300046531 Bacteria 4572
237 Ga0495587_0110070 3300046536 Bacteria 1583
238 Ga0495587_0246405 3300046536 Bacteria 1005
239 Ga0495621_0037542 3300046539 Bacteria 1685
240 Ga0495622_0001418 3300046557 Bacteria 12117
241 Ga0495634_0004076 3300046642 Bacteria 11574
242 Ga0495635_0045769 3300046663 Bacteria 3019
243 Ga0495623_0082928 3300046679 Bacteria 1981
244 Ga0495647_0004404 3300046681 Bacteria 4576
245 Ga0495658_0005399 3300046683 Bacteria 6282
246 Ga0495613_0011228 3300046689 Bacteria 6654
247 Ga0495581_0007319 3300047315 Bacteria 6387
248 Ga0495680_0009556 3300047322 Bacteria 8712
249 Ga0495614_0000925 3300048089 Bacteria 12513
250 Ga0496100_0065541 3300048903 Bacteria 2407
251 Ga0496101_0007361 3300048904 Bacteria 7128
252 Ga0496101_0144012 3300048904 Bacteria 1819
253 Ga0496101_0198217 3300048904 Bacteria 1551
254 Ga0496101_0205173 3300048904 Bacteria 1525
255 Ga0496102_0024870 3300048905 Bacteria 5326
256 Ga0496102_0211073 3300048905 Bacteria 1830
257 Ga0496102_0523112 3300048905 Bacteria 1109
258 Ga0496103_0019299 3300048906 Bacteria 4094
259 Ga0496104_0004903 3300048907 Bacteria 11670
260 Ga0496104_0260976 3300048907 Bacteria 1645
261 Ga0496104_0580793 3300048907 Bacteria 1031
262 Ga0496105_0011302 3300048908 Bacteria 7049
263 Ga0496105_0052737 3300048908 Bacteria 3359
264 Ga0496105_0231166 3300048908 Bacteria 1503
265 Ga0496106_0003035 3300048909 Bacteria 12500
266 Ga0496106_0052580 3300048909 Bacteria 3074
267 Ga0496107_0005889 3300048910 Bacteria 8398
268 Ga0496107_0018935 3300048910 Bacteria 4853
269 Ga0496108_0031199 3300048911 Bacteria 4420
270 Ga0496108_0186953 3300048911 Bacteria 1795
271 Ga0496108_0391301 3300048911 Bacteria 1214
272 Ga0496109_0023691 3300048912 Bacteria 5450
273 Ga0496109_0047722 3300048912 Bacteria 3895
274 Ga0496109_0079389 3300048912 Bacteria 3023
275 Ga0496110_0067575 3300048913 Bacteria 3163
276 Ga0496110_0159263 3300048913 Bacteria 2046
277 Ga0496111_0369489 3300048914 Bacteria 1061
278 Ga0496112_0034229 3300048915 Bacteria 4942
279 Ga0496112_0035579 3300048915 Bacteria 4852
280 Ga0496113_0014438 3300048916 Bacteria 5388
281 Ga0496113_0064399 3300048916 Bacteria 2772
282 Ga0496114_0005047 3300048917 Bacteria 10292
283 Ga0496114_0091618 3300048917 Bacteria 2582
284 Ga0496115_0033333 3300048918 Bacteria 4066
285 Ga0496115_0099299 3300048918 Bacteria 2385
286 Ga0496115_0102387 3300048918 Bacteria 2349
287 Ga0496115_0155602 3300048918 Bacteria 1889
288 Ga0496124_0103005 3300048927 Bacteria 2309
289 Ga0501031_0017500 3300049568 Bacteria 4659
290 Ga0501031_0082039 3300049568 Bacteria 2102
291 Ga0501033_0016928 3300049570 Bacteria 5510
292 Ga0501036_0033117 3300049572 Bacteria 4370
293 Ga0501036_0071399 3300049572 Bacteria 2936
294 Ga0501036_0074588 3300049572 Bacteria 2869
295 Ga0501036_0274922 3300049572 Bacteria 1410
296 Ga0501036_0284791 3300049572 Bacteria 1383
297 Ga0501036_0381264 3300049572 Bacteria 1177
298 Ga0501037_0039247 3300049573 Bacteria 3487
299 Ga0501037_0039397 3300049573 Bacteria 3479
300 Ga0501038_0024712 3300049574 Bacteria 5357
301 Ga0501038_0033207 3300049574 Bacteria 4546
302 Ga0501038_0064021 3300049574 Bacteria 3137
303 Ga0501039_0045565 3300049575 Bacteria 3388
304 Ga0501039_0083265 3300049575 Bacteria 2491
305 Ga0501039_0152852 3300049575 Bacteria 1813
306 Ga0501039_0170946 3300049575 Bacteria 1708
307 Ga0501041_0003093 3300049577 Bacteria 9567
308 Ga0501041_0015747 3300049577 Bacteria 4491
309 Ga0501041_0033982 3300049577 Bacteria 3086
310 Ga0501041_0089245 3300049577 Bacteria 1903
311 Ga0501041_0091580 3300049577 Bacteria 1877
312 Ga0501042_0014448 3300049578 Bacteria 5390
313 Ga0501042_0016684 3300049578 Bacteria 5048
314 Ga0501042_0025356 3300049578 Bacteria 4163
315 Ga0501042_0032669 3300049578 Bacteria 3686
316 Ga0501042_0039133 3300049578 Bacteria 3369
317 Ga0501043_0036186 3300049579 Bacteria 3883
318 Ga0501043_0091188 3300049579 Bacteria 2396
319 Ga0501046_0000063 3300049580 Bacteria 117905
320 Ga0501046_0060187 3300049580 Bacteria 2972
321 Ga0501046_0062330 3300049580 Bacteria 2914
322 Ga0501046_0087786 3300049580 Bacteria 2396
323 Ga0501046_0152276 3300049580 Bacteria 1744
324 Ga0501047_0163375 3300049581 Bacteria 2098
325 Ga0501048_0003852 3300049582 Bacteria 11430
326 Ga0501048_0022132 3300049582 Bacteria 4651
327 Ga0501048_0041088 3300049582 Bacteria 3313
328 Ga0501068_0015038 3300049584 Bacteria 4437
329 Ga0501068_0038096 3300049584 Bacteria 2879
330 Ga0501068_0077877 3300049584 Bacteria 2031
331 Ga0501069_0108801 3300049585 Bacteria 1577
332 Ga0501070_0207858 3300049586 Bacteria 1607
333 Ga0501071_0009755 3300049587 Bacteria 6406
334 Ga0501071_0012163 3300049587 Bacteria 5824
335 Ga0501071_0018521 3300049587 Bacteria 4823
336 Ga0501071_0019353 3300049587 Bacteria 4723
337 Ga0501072_0013339 3300049588 Bacteria 6291
338 Ga0501072_0016718 3300049588 Bacteria 5637
339 Ga0501072_0017692 3300049588 Bacteria 5481
340 Ga0501072_0043557 3300049588 Bacteria 3527
341 Ga0501072_0086906 3300049588 Bacteria 2481
342 Ga0501072_0291727 3300049588 Bacteria 1297
343 Ga0501073_0095111 3300049589 Bacteria 2069
344 Ga0501074_0044405 3300049590 Bacteria 3217
345 Ga0501074_0064624 3300049590 Bacteria 2634
346 Ga0501074_0113471 3300049590 Bacteria 1939
347 Ga0501074_0166161 3300049590 Bacteria 1575
348 Ga0501074_0238099 3300049590 Bacteria 1295
349 Ga0501074_0339879 3300049590 Bacteria 1066
350 Ga0501075_0000593 3300049591 Bacteria 22110
351 Ga0501075_0023346 3300049591 Bacteria 4527
352 Ga0501075_0053044 3300049591 Bacteria 3049
353 Ga0501075_0111228 3300049591 Bacteria 2083
354 Ga0501076_0001620 3300049592 Bacteria 15188
355 Ga0501076_0135678 3300049592 Bacteria 1997
356 Ga0501076_0441486 3300049592 Bacteria 1071
357 Ga0501077_0027178 3300049593 Bacteria 3633
358 Ga0501077_0029522 3300049593 Bacteria 3486
359 Ga0501077_0029965 3300049593 Bacteria 3462
360 Ga0501077_0042908 3300049593 Bacteria 2874
361 Ga0501077_0070512 3300049593 Bacteria 2215
362 Ga0501079_0008944 3300049741 Bacteria 7581
363 Ga0501079_0024709 3300049741 Bacteria 4610
364 Ga0501079_0028920 3300049741 Bacteria 4253
365 Ga0501079_0070923 3300049741 Bacteria 2691
366 Ga0501080_0027493 3300049742 Bacteria 5290
367 Ga0501080_0079915 3300049742 Bacteria 3040
368 Ga0501080_0166625 3300049742 Bacteria 2033
369 Ga0501080_0626763 3300049742 Bacteria 953
370 Ga0501081_0006774 3300049743 Bacteria 7451
371 Ga0501081_0030181 3300049743 Bacteria 3668
372 Ga0501081_0037357 3300049743 Bacteria 3313
373 Ga0501081_0038781 3300049743 Bacteria 3257
374 Ga0501081_0047675 3300049743 Bacteria 2947
375 Ga0501081_0071025 3300049743 Bacteria 2427
376 Ga0501083_0040632 3300049744 Bacteria 3157
377 Ga0501083_0084700 3300049744 Bacteria 2098
378 Ga0501035_0021365 3300049822 Bacteria 5950
379 Ga0501035_0065420 3300049822 Bacteria 3229
380 Ga0501035_0192917 3300049822 Bacteria 1751
381 Ga0501035_0390836 3300049822 Bacteria 1159
382 Ga0501044_0352991 3300049823 Bacteria 1390
383 Ga0501045_0004697 3300049824 Bacteria 9436
384 Ga0501045_0040015 3300049824 Bacteria 3411
385 Ga0501045_0054898 3300049824 Bacteria 2913
386 Ga0501045_0137094 3300049824 Bacteria 1819
387 nmdc:mga0qj67_213676_c1 3300050509 Bacteria 1566
388 nmdc:mga06r32_225753_c1 3300050510 Bacteria 1861
389 Ga0495612_0020047 3300053078 Bacteria 2679
390 Ga0495595_0045531 3300053084 Bacteria 2018
391 Ga0495619_0045154 3300053085 Bacteria 2894
392 Ga0495619_0143611 3300053085 Bacteria 1645
393 Ga0500643_000003 3300053087 Bacteria 876659
394 Ga0500556_0000326 3300053104 Bacteria 35770
395 Ga0500562_007605 3300053108 Bacteria 2732
396 Ga0500595_011061 3300053119 Bacteria 3552
397 Ga0500573_0000025 3300053140 Bacteria 144473
398 Ga0500616_0002793 3300053153 Bacteria 14061
399 Ga0500616_0051166 3300053153 Bacteria 2178
400 Ga0500645_023978 3300053730 Bacteria 1868
401 Ga0501084_0005112 3300054114 Bacteria 10739
402 Ga0501084_0036083 3300054114 Bacteria 4131
403 Ga0501084_0244821 3300054114 Bacteria 1513
404 Ga0501084_0247970 3300054114 Bacteria 1503
405 Ga0501082_0008121 3300060353 Bacteria 9055
406 Ga0501082_0056422 3300060353 Bacteria 3383
407 Ga0501082_0087985 3300060353 Bacteria 2680
408 Ga0530510_0005370 3300061734 Bacteria 8867
409 Ga0530510_0016845 3300061734 Bacteria 5176
410 Ga0530510_0024140 3300061734 Bacteria 4337
411 Ga0530510_0036968 3300061734 Bacteria 3518
412 Ga0530510_0049778 3300061734 Bacteria 3026
413 Ga0530510_0058523 3300061734 Bacteria 2786
414 Ga0530510_0209142 3300061734 Bacteria 1450

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048918 Ga0496115_0099299 Ga0496115_0099299_1596_2345 228
2 3300025915 Ga0207693_10132156 Ga0207693_101321563 236
3 3300049578 Ga0501042_0039133 Ga0501042_0039133_1538_2413 238
4 3300049743 Ga0501081_0037357 Ga0501081_0037357_2018_2893 238
5 3300049578 Ga0501042_0014448 Ga0501042_0014448_2211_3083 239
6 3300049585 Ga0501069_0108801 Ga0501069_0108801_234_1106 239
7 3300049593 Ga0501077_0027178 Ga0501077_0027178_365_1237 239
8 3300049742 Ga0501080_0626763 Ga0501080_0626763_18_893 239
9 3300050509 nmdc:mga0qj67_213676_c1 nmdc:mga0qj67_213676_c1_48_899 239
10 3300049574 Ga0501038_0064021 Ga0501038_0064021_1771_2646 240
11 3300049587 Ga0501071_0019353 Ga0501071_0019353_3002_3877 240
12 3300049588 Ga0501072_0043557 Ga0501072_0043557_301_1176 240
13 3300049590 Ga0501074_0113471 Ga0501074_0113471_313_1188 240
14 3300049822 Ga0501035_0192917 Ga0501035_0192917_226_1101 240
15 3300054114 Ga0501084_0247970 Ga0501084_0247970_552_1427 240
16 3300061734 Ga0530510_0036968 Ga0530510_0036968_1921_2796 240
17 3300048911 Ga0496108_0391301 Ga0496108_0391301_363_1190 245
18 3300049577 Ga0501041_0091580 Ga0501041_0091580_34_909 245
19 3300053153 Ga0500616_0002793 Ga0500616_0002793_2401_3297 245
20 3300005330 Ga0070690_100177297 Ga0070690_1001772972 246
21 3300005353 Ga0070669_100302418 Ga0070669_1003024181 246
22 3300005444 Ga0070694_100044641 Ga0070694_1000446412 246
23 3300005545 Ga0070695_100014677 Ga0070695_1000146774 246
24 3300005549 Ga0070704_100195940 Ga0070704_1001959402 246
25 3300005614 Ga0068856_100487497 Ga0068856_1004874972 246
26 3300010375 Ga0105239_10020993 Ga0105239_100209932 246
27 3300013297 Ga0157378_10055308 Ga0157378_100553083 246
28 3300014968 Ga0157379_10029085 Ga0157379_100290853 246
29 3300025933 Ga0207706_10358038 Ga0207706_103580382 246
30 3300028381 Ga0268264_10049906 Ga0268264_100499063 246
31 3300035115 Ga0373941_0021320 Ga0373941_0021320_375_1262 246
32 3300048904 Ga0496101_0205173 Ga0496101_0205173_193_1071 246
33 3300048905 Ga0496102_0211073 Ga0496102_0211073_192_1070 246
34 3300048911 Ga0496108_0186953 Ga0496108_0186953_152_1030 246
35 3300048913 Ga0496110_0159263 Ga0496110_0159263_836_1714 246
36 3300048914 Ga0496111_0369489 Ga0496111_0369489_170_1048 246
37 3300048918 Ga0496115_0155602 Ga0496115_0155602_821_1699 246
38 3300010375 Ga0105239_10251698 Ga0105239_102516982 247
39 3300011119 Ga0105246_10111631 Ga0105246_101116312 247
40 3300031728 Ga0316578_10184949 Ga0316578_101849492 247
41 3300031733 Ga0316577_10004330 Ga0316577_100043308 247
42 3300032133 Ga0316583_10016582 Ga0316583_100165823 247
43 3300036712 Ga0316584_0039347 Ga0316584_0039347_1397_2281 247
44 3300037588 Ga0316581_0003709 Ga0316581_0003709_460_1344 247
45 3300048911 Ga0496108_0031199 Ga0496108_0031199_3086_3994 247
46 3300048913 Ga0496110_0067575 Ga0496110_0067575_565_1473 247
47 3300048915 Ga0496112_0034229 Ga0496112_0034229_3574_4482 247
48 3300048916 Ga0496113_0014438 Ga0496113_0014438_194_1102 247
49 3300049572 Ga0501036_0274922 Ga0501036_0274922_186_1061 247
50 3300049575 Ga0501039_0083265 Ga0501039_0083265_28_909 247
51 3300049580 Ga0501046_0062330 Ga0501046_0062330_1367_2248 247
52 3300049743 Ga0501081_0038781 Ga0501081_0038781_217_1098 247
53 3300049744 Ga0501083_0040632 Ga0501083_0040632_809_1690 247
54 3300049824 Ga0501045_0137094 Ga0501045_0137094_408_1289 247
55 3300060353 Ga0501082_0056422 Ga0501082_0056422_354_1235 247
56 3300049590 Ga0501074_0339879 Ga0501074_0339879_71_946 248
57 3300031665 Ga0316575_10001036 Ga0316575_100010368 249
58 3300048912 Ga0496109_0079389 Ga0496109_0079389_1351_2259 249
59 3300049575 Ga0501039_0045565 Ga0501039_0045565_1952_2833 249
60 3300049590 Ga0501074_0044405 Ga0501074_0044405_851_1732 249
61 3300049592 Ga0501076_0135678 Ga0501076_0135678_1009_1890 249
62 3300049568 Ga0501031_0082039 Ga0501031_0082039_394_1266 250
63 3300049572 Ga0501036_0033117 Ga0501036_0033117_2322_3194 250
64 3300049573 Ga0501037_0039397 Ga0501037_0039397_1756_2628 250
65 3300049574 Ga0501038_0033207 Ga0501038_0033207_2252_3124 250
66 3300049575 Ga0501039_0170946 Ga0501039_0170946_462_1334 250
67 3300049577 Ga0501041_0003093 Ga0501041_0003093_6424_7296 250
68 3300049579 Ga0501043_0091188 Ga0501043_0091188_68_940 250
69 3300049580 Ga0501046_0060187 Ga0501046_0060187_757_1629 250
70 3300049582 Ga0501048_0022132 Ga0501048_0022132_2758_3630 250
71 3300049584 Ga0501068_0015038 Ga0501068_0015038_2210_3082 250
72 3300049587 Ga0501071_0012163 Ga0501071_0012163_1264_2136 250
73 3300049590 Ga0501074_0064624 Ga0501074_0064624_1132_2004 250
74 3300049591 Ga0501075_0023346 Ga0501075_0023346_2328_3200 250
75 3300049741 Ga0501079_0024709 Ga0501079_0024709_2477_3349 250
76 3300049742 Ga0501080_0027493 Ga0501080_0027493_4346_5218 250
77 3300049743 Ga0501081_0030181 Ga0501081_0030181_736_1608 250
78 3300049744 Ga0501083_0084700 Ga0501083_0084700_517_1389 250
79 3300049822 Ga0501035_0065420 Ga0501035_0065420_355_1227 250
80 3300049823 Ga0501044_0352991 Ga0501044_0352991_187_1059 250
81 3300049824 Ga0501045_0054898 Ga0501045_0054898_1703_2575 250
82 3300054114 Ga0501084_0244821 Ga0501084_0244821_235_1107 250
83 3300060353 Ga0501082_0087985 Ga0501082_0087985_1395_2267 250
84 3300061734 Ga0530510_0016845 Ga0530510_0016845_3977_4849 250
85 3300049573 Ga0501037_0039247 Ga0501037_0039247_1643_2521 251
86 3300049588 Ga0501072_0013339 Ga0501072_0013339_5044_5922 251
87 3300049591 Ga0501075_0053044 Ga0501075_0053044_1779_2657 251
88 3300049742 Ga0501080_0166625 Ga0501080_0166625_331_1209 251
89 3300061734 Ga0530510_0058523 Ga0530510_0058523_503_1381 251
90 3300049572 Ga0501036_0071399 Ga0501036_0071399_684_1508 252
91 3300049577 Ga0501041_0033982 Ga0501041_0033982_1906_2730 252
92 3300049578 Ga0501042_0016684 Ga0501042_0016684_1870_2694 252
93 3300049582 Ga0501048_0041088 Ga0501048_0041088_1311_2135 252
94 3300049584 Ga0501068_0077877 Ga0501068_0077877_239_1063 252
95 3300049588 Ga0501072_0086906 Ga0501072_0086906_1376_2200 252
96 3300049591 Ga0501075_0000593 Ga0501075_0000593_14869_15693 252
97 3300049592 Ga0501076_0001620 Ga0501076_0001620_13277_14101 252
98 3300049593 Ga0501077_0029522 Ga0501077_0029522_17_841 252
99 3300049741 Ga0501079_0008944 Ga0501079_0008944_5525_6349 252
100 3300049824 Ga0501045_0040015 Ga0501045_0040015_502_1326 252
101 3300054114 Ga0501084_0005112 Ga0501084_0005112_6383_7207 252
102 3300060353 Ga0501082_0008121 Ga0501082_0008121_1172_1996 252
103 3300061734 Ga0530510_0024140 Ga0530510_0024140_2095_2919 252
104 3300049572 Ga0501036_0284791 Ga0501036_0284791_291_1112 255
105 iso_pu_bacteria 2842698319 2842702827 255
106 3300036647 Ga0316582_0346049 Ga0316582_0346049_15_845 256
107 3300053104 Ga0500556_0000326 Ga0500556_0000326_13425_14327 256
108 3300053730 Ga0500645_023978 Ga0500645_023978_632_1534 256
109 3300049590 Ga0501074_0166161 Ga0501074_0166161_712_1542 257
110 3300048905 Ga0496102_0523112 Ga0496102_0523112_182_1060 258
111 3300048908 Ga0496105_0231166 Ga0496105_0231166_132_1010 258
112 3300048915 Ga0496112_0035579 Ga0496112_0035579_2020_2898 258
113 3300049593 Ga0501077_0070512 Ga0501077_0070512_954_1790 258
114 3300039438 Ga0436360_0796979 Ga0436360_0796979_1647_2474 259
115 3300049572 Ga0501036_0381264 Ga0501036_0381264_145_1053 259
116 3300005539 Ga0068853_100129002 Ga0068853_1001290022 260
117 3300010375 Ga0105239_10234681 Ga0105239_102346812 260
118 3300026041 Ga0207639_10379299 Ga0207639_103792992 260
119 3300035695 Ga0373927_0118861 Ga0373927_0118861_551_1429 260
120 3300048904 Ga0496101_0144012 Ga0496101_0144012_184_1065 260
121 3300048917 Ga0496114_0091618 Ga0496114_0091618_797_1675 260
122 3300049580 Ga0501046_0000063 Ga0501046_0000063_23092_23967 260
123 3300036401 Ga0373937_0464566 Ga0373937_0464566_145_1020 261
124 3300035398 Ga0316574_0087384 Ga0316574_0087384_35_907 262
125 3300049588 Ga0501072_0291727 Ga0501072_0291727_22_873 262
126 3300005329 Ga0070683_100628057 Ga0070683_1006280571 264
127 3300031727 Ga0316576_10012661 Ga0316576_100126613 264
128 3300031733 Ga0316577_10109070 Ga0316577_101090702 264
129 3300036712 Ga0316584_0002158 Ga0316584_0002158_10115_10984 264
130 3300049589 Ga0501073_0095111 Ga0501073_0095111_735_1610 264
131 3300031665 Ga0316575_10095245 Ga0316575_100952452 265
132 3300031727 Ga0316576_10015543 Ga0316576_100155435 265
133 3300031733 Ga0316577_10179623 Ga0316577_101796232 265
134 3300035398 Ga0316574_0003206 Ga0316574_0003206_4028_4897 265
135 3300036712 Ga0316584_0021539 Ga0316584_0021539_1971_2840 265
136 3300005347 Ga0070668_100009459 Ga0070668_1000094592 266
137 3300005356 Ga0070674_100105886 Ga0070674_1001058863 266
138 3300005842 Ga0068858_100015939 Ga0068858_1000159396 266
139 3300009553 Ga0105249_10007044 Ga0105249_100070447 266
140 3300011119 Ga0105246_10084843 Ga0105246_100848432 266
141 3300013308 Ga0157375_10176959 Ga0157375_101769592 266
142 3300014326 Ga0157380_10362609 Ga0157380_103626092 266
143 3300014969 Ga0157376_10087910 Ga0157376_100879102 266
144 3300017792 Ga0163161_10055557 Ga0163161_100555572 266
145 3300025937 Ga0207669_10070111 Ga0207669_100701112 266
146 3300025961 Ga0207712_10024580 Ga0207712_100245805 266
147 3300026035 Ga0207703_10031546 Ga0207703_100315466 266
148 3300026118 Ga0207675_100006648 Ga0207675_1000066489 266
149 3300027717 Ga0209998_10007078 Ga0209998_100070781 266
150 3300028380 Ga0268265_10063206 Ga0268265_100632063 266
151 3300033528 Ga0316588_1046351 Ga0316588_10463511 266
152 3300046500 Ga0495596_0030928 Ga0495596_0030928_1240_2112 266
153 3300048903 Ga0496100_0065541 Ga0496100_0065541_277_1149 266
154 3300048907 Ga0496104_0580793 Ga0496104_0580793_129_1001 266
155 3300048909 Ga0496106_0052580 Ga0496106_0052580_449_1321 266
156 3300048910 Ga0496107_0005889 Ga0496107_0005889_7147_8019 266
157 3300048918 Ga0496115_0033333 Ga0496115_0033333_1027_1899 266
158 3300049591 Ga0501075_0111228 Ga0501075_0111228_351_1253 266
159 3300005347 Ga0070668_100122064 Ga0070668_1001220643 267
160 3300005355 Ga0070671_100052025 Ga0070671_1000520252 267
161 3300005356 Ga0070674_100083127 Ga0070674_1000831272 267
162 3300005364 Ga0070673_100516261 Ga0070673_1005162612 267
163 3300005365 Ga0070688_100017102 Ga0070688_1000171022 267
164 3300005366 Ga0070659_100169508 Ga0070659_1001695082 267
165 3300005367 Ga0070667_100385398 Ga0070667_1003853981 267
166 3300005437 Ga0070710_10142184 Ga0070710_101421842 267
167 3300005440 Ga0070705_100066873 Ga0070705_1000668732 267
168 3300005539 Ga0068853_100027244 Ga0068853_1000272443 267
169 3300005543 Ga0070672_100258966 Ga0070672_1002589662 267
170 3300005544 Ga0070686_100201879 Ga0070686_1002018792 267
171 3300005564 Ga0070664_100508640 Ga0070664_1005086402 267
172 3300005617 Ga0068859_100499942 Ga0068859_1004999422 267
173 3300005718 Ga0068866_10022310 Ga0068866_100223102 267
174 3300005842 Ga0068858_100035019 Ga0068858_1000350192 267
175 3300006163 Ga0070715_10142679 Ga0070715_101426792 267
176 3300006871 Ga0075434_100124026 Ga0075434_1001240262 267
177 3300006881 Ga0068865_100007677 Ga0068865_1000076777 267
178 3300006931 Ga0097620_100499909 Ga0097620_1004999092 267
179 3300007076 Ga0075435_100496458 Ga0075435_1004964582 267
180 3300009101 Ga0105247_10009786 Ga0105247_100097862 267
181 3300009147 Ga0114129_10271700 Ga0114129_102717002 267
182 3300009148 Ga0105243_10057822 Ga0105243_100578225 267
183 3300009174 Ga0105241_10047328 Ga0105241_100473282 267
184 3300009177 Ga0105248_10022362 Ga0105248_100223624 267
185 3300011119 Ga0105246_10193982 Ga0105246_101939822 267
186 3300013297 Ga0157378_10008350 Ga0157378_100083502 267
187 3300013308 Ga0157375_10011387 Ga0157375_100113875 267
188 3300014326 Ga0157380_10059777 Ga0157380_100597772 267
189 3300014968 Ga0157379_10004819 Ga0157379_100048199 267
190 3300014969 Ga0157376_10099032 Ga0157376_100990322 267
191 3300025900 Ga0207710_10038632 Ga0207710_100386322 267
192 3300025903 Ga0207680_10131896 Ga0207680_101318962 267
193 3300025905 Ga0207685_10056016 Ga0207685_100560162 267
194 3300025916 Ga0207663_10095785 Ga0207663_100957852 267
195 3300025935 Ga0207709_10093253 Ga0207709_100932531 267
196 3300025936 Ga0207670_10192105 Ga0207670_101921052 267
197 3300025937 Ga0207669_10098087 Ga0207669_100980872 267
198 3300025939 Ga0207665_10086132 Ga0207665_100861322 267
199 3300025940 Ga0207691_10193169 Ga0207691_101931692 267
200 3300025960 Ga0207651_10408829 Ga0207651_104088291 267
201 3300025972 Ga0207668_10199231 Ga0207668_101992312 267
202 3300026035 Ga0207703_10101025 Ga0207703_101010252 267
203 3300026088 Ga0207641_10214245 Ga0207641_102142452 267
204 3300028379 Ga0268266_10414376 Ga0268266_104143762 267
205 3300028381 Ga0268264_10374963 Ga0268264_103749632 267
206 3300035170 Ga0373943_0001595 Ga0373943_0001595_4777_5652 267
207 3300035695 Ga0373927_0002114 Ga0373927_0002114_2773_3648 267
208 3300035725 Ga0373947_0002223 Ga0373947_0002223_6083_6958 267
209 3300037068 Ga0373925_0027368 Ga0373925_0027368_528_1403 267
210 3300046455 Ga0495603_0000388 Ga0495603_0000388_9064_9939 267
211 3300046461 Ga0495641_0011172 Ga0495641_0011172_733_1608 267
212 3300046472 Ga0495580_0010115 Ga0495580_0010115_3240_4115 267
213 3300046473 Ga0495582_0001097 Ga0495582_0001097_11003_11878 267
214 3300046475 Ga0495639_0001533 Ga0495639_0001533_6252_7127 267
215 3300046499 Ga0495594_0000118 Ga0495594_0000118_6683_7558 267
216 3300046526 Ga0495666_0031793 Ga0495666_0031793_374_1249 267
217 3300046531 Ga0495665_0012636 Ga0495665_0012636_3439_4314 267
218 3300046557 Ga0495622_0001418 Ga0495622_0001418_3628_4503 267
219 3300046642 Ga0495634_0004076 Ga0495634_0004076_3240_4115 267
220 3300046663 Ga0495635_0045769 Ga0495635_0045769_101_976 267
221 3300046681 Ga0495647_0004404 Ga0495647_0004404_1550_2425 267
222 3300046683 Ga0495658_0005399 Ga0495658_0005399_4840_5715 267
223 3300046689 Ga0495613_0011228 Ga0495613_0011228_4308_5183 267
224 3300047315 Ga0495581_0007319 Ga0495581_0007319_1199_2074 267
225 3300047322 Ga0495680_0009556 Ga0495680_0009556_3975_4850 267
226 3300048089 Ga0495614_0000925 Ga0495614_0000925_7510_8385 267
227 3300048904 Ga0496101_0007361 Ga0496101_0007361_3682_4590 267
228 3300048904 Ga0496101_0198217 Ga0496101_0198217_424_1302 267
229 3300048905 Ga0496102_0024870 Ga0496102_0024870_2535_3443 267
230 3300048906 Ga0496103_0019299 Ga0496103_0019299_889_1797 267
231 3300048907 Ga0496104_0004903 Ga0496104_0004903_8021_8929 267
232 3300048907 Ga0496104_0260976 Ga0496104_0260976_26_904 267
233 3300048908 Ga0496105_0011302 Ga0496105_0011302_6098_7006 267
234 3300048908 Ga0496105_0052737 Ga0496105_0052737_1063_1941 267
235 3300048909 Ga0496106_0003035 Ga0496106_0003035_3771_4679 267
236 3300048910 Ga0496107_0018935 Ga0496107_0018935_746_1654 267
237 3300048912 Ga0496109_0023691 Ga0496109_0023691_2525_3403 267
238 3300048916 Ga0496113_0064399 Ga0496113_0064399_1322_2200 267
239 3300048917 Ga0496114_0005047 Ga0496114_0005047_3560_4468 267
240 3300049568 Ga0501031_0017500 Ga0501031_0017500_2171_3040 267
241 3300049570 Ga0501033_0016928 Ga0501033_0016928_3294_4163 267
242 3300049572 Ga0501036_0074588 Ga0501036_0074588_990_1859 267
243 3300049574 Ga0501038_0024712 Ga0501038_0024712_1714_2583 267
244 3300049575 Ga0501039_0152852 Ga0501039_0152852_783_1661 267
245 3300049577 Ga0501041_0015747 Ga0501041_0015747_1451_2320 267
246 3300049577 Ga0501041_0089245 Ga0501041_0089245_485_1393 267
247 3300049578 Ga0501042_0025356 Ga0501042_0025356_1349_2218 267
248 3300049578 Ga0501042_0032669 Ga0501042_0032669_1658_2566 267
249 3300049579 Ga0501043_0036186 Ga0501043_0036186_941_1810 267
250 3300049580 Ga0501046_0087786 Ga0501046_0087786_45_953 267
251 3300049580 Ga0501046_0152276 Ga0501046_0152276_595_1464 267
252 3300049582 Ga0501048_0003852 Ga0501048_0003852_745_1614 267
253 3300049584 Ga0501068_0038096 Ga0501068_0038096_1250_2119 267
254 3300049586 Ga0501070_0207858 Ga0501070_0207858_646_1515 267
255 3300049587 Ga0501071_0009755 Ga0501071_0009755_358_1227 267
256 3300049587 Ga0501071_0018521 Ga0501071_0018521_2202_3080 267
257 3300049588 Ga0501072_0016718 Ga0501072_0016718_4411_5319 267
258 3300049588 Ga0501072_0017692 Ga0501072_0017692_2262_3131 267
259 3300049590 Ga0501074_0238099 Ga0501074_0238099_142_1050 267
260 3300049592 Ga0501076_0441486 Ga0501076_0441486_174_1052 267
261 3300049593 Ga0501077_0029965 Ga0501077_0029965_1681_2589 267
262 3300049593 Ga0501077_0042908 Ga0501077_0042908_1024_1893 267
263 3300049741 Ga0501079_0028920 Ga0501079_0028920_1353_2222 267
264 3300049741 Ga0501079_0070923 Ga0501079_0070923_99_1007 267
265 3300049742 Ga0501080_0079915 Ga0501080_0079915_874_1743 267
266 3300049743 Ga0501081_0006774 Ga0501081_0006774_1272_2180 267
267 3300049743 Ga0501081_0047675 Ga0501081_0047675_1323_2192 267
268 3300049743 Ga0501081_0071025 Ga0501081_0071025_1524_2402 267
269 3300049822 Ga0501035_0021365 Ga0501035_0021365_3045_3914 267
270 3300049822 Ga0501035_0390836 Ga0501035_0390836_202_1080 267
271 3300049824 Ga0501045_0004697 Ga0501045_0004697_1907_2776 267
272 3300050510 nmdc:mga06r32_225753_c1 nmdc:mga06r32_225753_c1_668_1540 267
273 3300053085 Ga0495619_0045154 Ga0495619_0045154_298_1173 267
274 3300053153 Ga0500616_0051166 Ga0500616_0051166_273_1139 267
275 3300054114 Ga0501084_0036083 Ga0501084_0036083_1496_2404 267
276 3300061734 Ga0530510_0005370 Ga0530510_0005370_558_1436 267
277 3300061734 Ga0530510_0049778 Ga0530510_0049778_1462_2331 267
278 3300061734 Ga0530510_0209142 Ga0530510_0209142_468_1340 267
279 3300005459 Ga0068867_100321530 Ga0068867_1003215302 269
280 3300009093 Ga0105240_10124883 Ga0105240_101248832 269
281 3300027907 Ga0207428_10330529 Ga0207428_103305292 269
282 3300028380 Ga0268265_10222495 Ga0268265_102224952 269
283 3300031901 Ga0307406_10067991 Ga0307406_100679912 269
284 3300032126 Ga0307415_100398132 Ga0307415_1003981322 269
285 3300035118 Ga0373954_0092828 Ga0373954_0092828_177_1085 269
286 3300046529 Ga0495652_0039078 Ga0495652_0039078_2382_3290 269
287 3300046536 Ga0495587_0110070 Ga0495587_0110070_425_1333 269
288 3300046679 Ga0495623_0082928 Ga0495623_0082928_33_941 269
289 3300048912 Ga0496109_0047722 Ga0496109_0047722_180_1073 269
290 3300048927 Ga0496124_0103005 Ga0496124_0103005_761_1654 269
291 3300053078 Ga0495612_0020047 Ga0495612_0020047_507_1415 269
292 3300053084 Ga0495595_0045531 Ga0495595_0045531_385_1293 269
293 3300053108 Ga0500562_007605 Ga0500562_007605_410_1312 269
294 3300035117 Ga0373953_0062377 Ga0373953_0062377_388_1221 271
295 3300035724 Ga0373933_0254557 Ga0373933_0254557_112_945 271
296 3300036401 Ga0373937_0013033 Ga0373937_0013033_6445_7278 271
297 3300036401 Ga0373937_0030125 Ga0373937_0030125_3297_4130 271
298 3300046536 Ga0495587_0246405 Ga0495587_0246405_46_879 271
299 3300053085 Ga0495619_0143611 Ga0495619_0143611_413_1246 271
300 3300005327 Ga0070658_10280186 Ga0070658_102801861 275
301 3300005329 Ga0070683_100238102 Ga0070683_1002381021 275
302 3300005330 Ga0070690_100018348 Ga0070690_1000183484 275
303 3300005334 Ga0068869_100149207 Ga0068869_1001492071 275
304 3300005335 Ga0070666_10273388 Ga0070666_102733881 275
305 3300005335 Ga0070666_10287475 Ga0070666_102874751 275
306 3300005367 Ga0070667_100149992 Ga0070667_1001499922 275
307 3300005367 Ga0070667_100288528 Ga0070667_1002885282 275
308 3300005548 Ga0070665_100010107 Ga0070665_1000101076 275
309 3300005548 Ga0070665_100345297 Ga0070665_1003452972 275
310 3300005563 Ga0068855_100198469 Ga0068855_1001984692 275
311 3300005564 Ga0070664_100368693 Ga0070664_1003686932 275
312 3300005577 Ga0068857_100286512 Ga0068857_1002865122 275
313 3300005614 Ga0068856_100237542 Ga0068856_1002375422 275
314 3300005616 Ga0068852_100224273 Ga0068852_1002242733 275
315 3300005618 Ga0068864_100012779 Ga0068864_1000127795 275
316 3300005719 Ga0068861_100249487 Ga0068861_1002494872 275
317 3300005834 Ga0068851_10050839 Ga0068851_100508392 275
318 3300006358 Ga0068871_100434102 Ga0068871_1004341022 275
319 3300009093 Ga0105240_10098447 Ga0105240_100984473 275
320 3300009098 Ga0105245_10367489 Ga0105245_103674892 275
321 3300009174 Ga0105241_10152357 Ga0105241_101523572 275
322 3300009174 Ga0105241_10421414 Ga0105241_104214142 275
323 3300009177 Ga0105248_10103092 Ga0105248_101030923 275
324 3300009177 Ga0105248_10247822 Ga0105248_102478222 275
325 3300009545 Ga0105237_10216880 Ga0105237_102168802 275
326 3300009545 Ga0105237_10231700 Ga0105237_102317003 275
327 3300009551 Ga0105238_10083910 Ga0105238_100839103 275
328 3300009553 Ga0105249_10026075 Ga0105249_100260755 275
329 3300011119 Ga0105246_10115914 Ga0105246_101159142 275
330 3300013100 Ga0157373_10216964 Ga0157373_102169642 275
331 3300013105 Ga0157369_10050758 Ga0157369_100507585 275
332 3300013296 Ga0157374_10128034 Ga0157374_101280342 275
333 3300013297 Ga0157378_10055669 Ga0157378_100556693 275
334 3300013306 Ga0163162_10106038 Ga0163162_101060382 275
335 3300013307 Ga0157372_10159961 Ga0157372_101599612 275
336 3300014325 Ga0163163_10000002 Ga0163163_10000002540 275
337 3300014325 Ga0163163_10223786 Ga0163163_102237862 275
338 3300014325 Ga0163163_10272775 Ga0163163_102727752 275
339 3300014968 Ga0157379_10204566 Ga0157379_102045662 275
340 3300025903 Ga0207680_10093859 Ga0207680_100938592 275
341 3300025911 Ga0207654_10028949 Ga0207654_100289492 275
342 3300025911 Ga0207654_10198440 Ga0207654_101984402 275
343 3300025913 Ga0207695_10090821 Ga0207695_100908212 275
344 3300025913 Ga0207695_10161212 Ga0207695_101612122 275
345 3300025914 Ga0207671_10442426 Ga0207671_104424262 275
346 3300025941 Ga0207711_10008568 Ga0207711_100085683 275
347 3300025944 Ga0207661_10159882 Ga0207661_101598822 275
348 3300025945 Ga0207679_10294762 Ga0207679_102947622 275
349 3300025961 Ga0207712_10022283 Ga0207712_100222835 275
350 3300025986 Ga0207658_10030336 Ga0207658_100303364 275
351 3300025986 Ga0207658_10102293 Ga0207658_101022932 275
352 3300025986 Ga0207658_10173370 Ga0207658_101733702 275
353 3300026023 Ga0207677_10164599 Ga0207677_101645992 275
354 3300026023 Ga0207677_10338640 Ga0207677_103386402 275
355 3300026035 Ga0207703_10009813 Ga0207703_100098132 275
356 3300026035 Ga0207703_10028431 Ga0207703_100284313 275
357 3300026067 Ga0207678_10302121 Ga0207678_103021212 275
358 3300026116 Ga0207674_10373769 Ga0207674_103737692 275
359 3300026118 Ga0207675_100283965 Ga0207675_1002839652 275
360 3300028379 Ga0268266_10007372 Ga0268266_100073725 275
361 3300049581 Ga0501047_0163375 Ga0501047_0163375_832_1659 275
362 3300053087 Ga0500643_000003 Ga0500643_000003_320412_321239 275
363 3300053119 Ga0500595_011061 Ga0500595_011061_1476_2303 275
364 3300046539 Ga0495621_0037542 Ga0495621_0037542_580_1410 276
365 3300005328 Ga0070676_10006897 Ga0070676_100068972 277
366 3300005334 Ga0068869_100009237 Ga0068869_1000092372 277
367 3300005334 Ga0068869_100274785 Ga0068869_1002747852 277
368 3300005338 Ga0068868_100126159 Ga0068868_1001261593 277
369 3300005354 Ga0070675_100041531 Ga0070675_1000415312 277
370 3300005364 Ga0070673_100050167 Ga0070673_1000501672 277
371 3300005364 Ga0070673_100139298 Ga0070673_1001392982 277
372 3300005456 Ga0070678_100067775 Ga0070678_1000677752 277
373 3300005459 Ga0068867_100018214 Ga0068867_1000182145 277
374 3300005459 Ga0068867_100021718 Ga0068867_1000217186 277
375 3300005548 Ga0070665_100018459 Ga0070665_1000184592 277
376 3300005840 Ga0068870_10020200 Ga0068870_100202002 277
377 3300006237 Ga0097621_100224264 Ga0097621_1002242642 277
378 3300006358 Ga0068871_100071410 Ga0068871_1000714102 277
379 3300006358 Ga0068871_100106690 Ga0068871_1001066902 277
380 3300006881 Ga0068865_100046407 Ga0068865_1000464072 277
381 3300009093 Ga0105240_10557027 Ga0105240_105570271 277
382 3300009098 Ga0105245_10079194 Ga0105245_100791943 277
383 3300009098 Ga0105245_10136141 Ga0105245_101361412 277
384 3300009098 Ga0105245_10139774 Ga0105245_101397741 277
385 3300009148 Ga0105243_10020489 Ga0105243_100204896 277
386 3300009176 Ga0105242_10046008 Ga0105242_100460083 277
387 3300009176 Ga0105242_10290337 Ga0105242_102903372 277
388 3300011119 Ga0105246_10090749 Ga0105246_100907492 277
389 3300013296 Ga0157374_10044710 Ga0157374_100447103 277
390 3300013297 Ga0157378_10764113 Ga0157378_107641131 277
391 3300013306 Ga0163162_10139878 Ga0163162_101398782 277
392 3300013308 Ga0157375_10043821 Ga0157375_100438212 277
393 3300014968 Ga0157379_10012165 Ga0157379_100121656 277
394 3300014968 Ga0157379_10348628 Ga0157379_103486282 277
395 3300014969 Ga0157376_10023632 Ga0157376_100236322 277
396 3300017792 Ga0163161_10036697 Ga0163161_100366974 277
397 3300025907 Ga0207645_10214335 Ga0207645_102143351 277
398 3300025927 Ga0207687_10014900 Ga0207687_100149005 277
399 3300025927 Ga0207687_10337679 Ga0207687_103376792 277
400 3300025934 Ga0207686_10251036 Ga0207686_102510362 277
401 3300025938 Ga0207704_10084201 Ga0207704_100842013 277
402 3300025942 Ga0207689_10014919 Ga0207689_100149193 277
403 3300025960 Ga0207651_10118540 Ga0207651_101185402 277
404 3300026023 Ga0207677_10076614 Ga0207677_100766142 277
405 3300026041 Ga0207639_10133979 Ga0207639_101339792 277
406 3300026089 Ga0207648_10016758 Ga0207648_100167586 277
407 3300026089 Ga0207648_10023606 Ga0207648_100236062 277
408 3300026121 Ga0207683_10033624 Ga0207683_100336242 277
409 3300026121 Ga0207683_10076085 Ga0207683_100760852 277
410 3300028379 Ga0268266_10110992 Ga0268266_101109922 277
411 3300048918 Ga0496115_0102387 Ga0496115_0102387_1348_2202 277
412 3300053140 Ga0500573_0000025 Ga0500573_0000025_43855_44694 277
413 3300003214 JGI25165J46597_1000003 JGI25165J46597_1000003660 278
414 3300025231 Ga0207427_108006 Ga0207427_1080062 278
415 3300025261 Ga0209233_1000015 Ga0209233_1000015124 278

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01571

GCV_T

Aminomethyltransferase folate-binding domain

20

124

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
7z3h-assembly2.cif.gz_B crystal structure of iba57 from chaetomium thermophilum 0.8479 3 275
7z3h-assembly5.cif.gz_E crystal structure of iba57 from chaetomium thermophilum 0.8426 3 275
7z3h-assembly4.cif.gz_D crystal structure of iba57 from chaetomium thermophilum 0.8425 3 275
7z3h-assembly6.cif.gz_F crystal structure of iba57 from chaetomium thermophilum 0.841 3 275
7z3h-assembly3.cif.gz_C crystal structure of iba57 from chaetomium thermophilum 0.8373 3 275
ID Description Score Start End Superfamily
1vlyA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Aminomethyltransferase beta-barrel domains 0.9362 10 95 3.30.70.1400
af_E9AH81_4_151_3.30.70.1400 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Aminomethyltransferase beta-barrel domains 0.9232 2 94 3.30.70.1400
1vlyA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Aminomethyltransferase beta-barrel domains 0.905 10 95 3.30.70.1400
af_G5EE11_2_112_3.30.70.1400 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Aminomethyltransferase beta-barrel domains 0.8938 3 101 3.30.70.1400
1wosA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Aminomethyltransferase beta-barrel domains 0.891 9 93 3.30.70.1400
ID Description Score Start End GO Terms
AF-A0A1Q3JMC9-F1-model_v4 deleted 0.9714 1 275
AF-A0A849E5N5-F1-model_v4 Folate-binding protein 0.9682 2 101 GO:0016226
AF-A0A1Q3JMC9-F1-model_v4 deleted 0.9543 1 275
AF-A0A846N4R4-F1-model_v4 Aminomethyltransferase folate-binding domain-containing protein 0.952 2 276 GO:0016226
AF-A0A846N4R4-F1-model_v4 Aminomethyltransferase folate-binding domain-containing protein 0.9483 2 276 GO:0016226

Feature Viewer

pLDDT pTM Quality
90.51 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map