F438544
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 415 | 220 | 414 | 282 |
Family's Representative Sequence
| Representative Sequence | 3300009101|Ga0105247_10009786|Ga0105247_100097862 |
| Length | 302 |
| Sequence | MSEALVAEGPDMGHCHASLLPSRAVLRIGGADARKFLQGLLTNDIDKARGGAAVHTGLLSPQGKILFDFFAVPDGDGFLIDVAEDKAAELMQRLGFYRLRAAVEIAVAPSLAVAAAWGALPRLIEGAILYADPRLPELGFRLLVPKATNAADLGCEPSSEADYQALRIRLGVPEGGRDYAFGDAFPHEALFDQLNGVDFAKGCYIGQEVVSRMEHRGTARKRIVPVAGDAPLPASGTSIEADGMPIGTLGSVSGAAGLGLIRLDRAEEALAQAKTLTAGGVKIALRRPAFARFAVPVAEALA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2842698319 | Methylobacterium sp. R-72139 | Isolate | Unclassified |
| 2 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 24 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 25 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 31 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 33 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 34 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 35 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 36 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 37 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 38 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 39 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 40 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 41 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 42 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 45 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 46 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 47 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 49 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 113 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 117 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 118 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 119 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 120 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 121 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 122 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 123 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 124 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 125 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 126 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 127 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 128 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 129 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 130 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 131 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 132 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 133 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 134 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 135 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 136 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 137 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 138 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 161 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 162 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 163 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 164 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 165 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 166 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 167 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 168 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 169 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 170 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 171 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 172 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 173 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 174 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 175 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 176 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 177 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 178 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 179 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 180 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 181 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 182 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 183 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 184 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 185 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 186 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 187 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 188 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 189 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 190 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 191 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 192 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 193 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 194 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 195 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 196 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 197 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 198 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 199 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 200 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 201 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 202 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 203 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 204 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 205 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 206 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 207 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 208 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 212 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 213 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 214 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 215 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 216 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 217 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 218 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 219 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 220 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.52 |
| Metatranscriptomes | 0.24 |
| Isolates | 0.24 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.65 |
| Nodule | 0 |
| Rhizoplane | 9.16 |
| Rhizosphere | 87.71 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.48 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25165J46597_1000003 | 3300003214 | Bacteria | 694080 |
| 2 | Ga0070658_10280186 | 3300005327 | Bacteria | 1419 |
| 3 | Ga0070676_10006897 | 3300005328 | Bacteria | 6080 |
| 4 | Ga0070683_100238102 | 3300005329 | Bacteria | 1731 |
| 5 | Ga0070683_100628057 | 3300005329 | Bacteria | 1028 |
| 6 | Ga0070690_100018348 | 3300005330 | Bacteria | 4225 |
| 7 | Ga0070690_100177297 | 3300005330 | Bacteria | 1471 |
| 8 | Ga0068869_100009237 | 3300005334 | Bacteria | 6390 |
| 9 | Ga0068869_100149207 | 3300005334 | Bacteria | 1812 |
| 10 | Ga0068869_100274785 | 3300005334 | Bacteria | 1353 |
| 11 | Ga0070666_10273388 | 3300005335 | Bacteria | 1200 |
| 12 | Ga0070666_10287475 | 3300005335 | Bacteria | 1169 |
| 13 | Ga0068868_100126159 | 3300005338 | Bacteria | 2091 |
| 14 | Ga0070668_100009459 | 3300005347 | Bacteria | 7229 |
| 15 | Ga0070668_100122064 | 3300005347 | Bacteria | 2084 |
| 16 | Ga0070669_100302418 | 3300005353 | Bacteria | 1287 |
| 17 | Ga0070675_100041531 | 3300005354 | Bacteria | 3757 |
| 18 | Ga0070671_100052025 | 3300005355 | Bacteria | 3406 |
| 19 | Ga0070674_100083127 | 3300005356 | Bacteria | 2292 |
| 20 | Ga0070674_100105886 | 3300005356 | Bacteria | 2057 |
| 21 | Ga0070673_100050167 | 3300005364 | Bacteria | 3262 |
| 22 | Ga0070673_100139298 | 3300005364 | Bacteria | 2045 |
| 23 | Ga0070673_100516261 | 3300005364 | Bacteria | 1082 |
| 24 | Ga0070688_100017102 | 3300005365 | Bacteria | 4160 |
| 25 | Ga0070659_100169508 | 3300005366 | Bacteria | 1788 |
| 26 | Ga0070667_100149992 | 3300005367 | Bacteria | 2047 |
| 27 | Ga0070667_100288528 | 3300005367 | Bacteria | 1475 |
| 28 | Ga0070667_100385398 | 3300005367 | Bacteria | 1274 |
| 29 | Ga0070710_10142184 | 3300005437 | Bacteria | 1472 |
| 30 | Ga0070705_100066873 | 3300005440 | Bacteria | 2157 |
| 31 | Ga0070694_100044641 | 3300005444 | Bacteria | 2967 |
| 32 | Ga0070678_100067775 | 3300005456 | Bacteria | 2658 |
| 33 | Ga0068867_100018214 | 3300005459 | Bacteria | 4990 |
| 34 | Ga0068867_100021718 | 3300005459 | Bacteria | 4581 |
| 35 | Ga0068867_100321530 | 3300005459 | Bacteria | 1282 |
| 36 | Ga0068853_100027244 | 3300005539 | Bacteria | 4801 |
| 37 | Ga0068853_100129002 | 3300005539 | Bacteria | 2262 |
| 38 | Ga0070672_100258966 | 3300005543 | Bacteria | 1467 |
| 39 | Ga0070686_100201879 | 3300005544 | Bacteria | 1426 |
| 40 | Ga0070695_100014677 | 3300005545 | Bacteria | 4723 |
| 41 | Ga0070665_100010107 | 3300005548 | Bacteria | 9545 |
| 42 | Ga0070665_100018459 | 3300005548 | Bacteria | 6991 |
| 43 | Ga0070665_100345297 | 3300005548 | Bacteria | 1493 |
| 44 | Ga0070704_100195940 | 3300005549 | Bacteria | 1627 |
| 45 | Ga0068855_100198469 | 3300005563 | Bacteria | 2260 |
| 46 | Ga0070664_100368693 | 3300005564 | Bacteria | 1309 |
| 47 | Ga0070664_100508640 | 3300005564 | Bacteria | 1111 |
| 48 | Ga0068857_100286512 | 3300005577 | Bacteria | 1516 |
| 49 | Ga0068856_100237542 | 3300005614 | Bacteria | 1838 |
| 50 | Ga0068856_100487497 | 3300005614 | Bacteria | 1254 |
| 51 | Ga0068852_100224273 | 3300005616 | Bacteria | 1789 |
| 52 | Ga0068859_100499942 | 3300005617 | Bacteria | 1311 |
| 53 | Ga0068864_100012779 | 3300005618 | Bacteria | 6940 |
| 54 | Ga0068866_10022310 | 3300005718 | Bacteria | 2928 |
| 55 | Ga0068861_100249487 | 3300005719 | Bacteria | 1514 |
| 56 | Ga0068851_10050839 | 3300005834 | Bacteria | 2105 |
| 57 | Ga0068870_10020200 | 3300005840 | Bacteria | 3240 |
| 58 | Ga0068858_100015939 | 3300005842 | Bacteria | 7060 |
| 59 | Ga0068858_100035019 | 3300005842 | Bacteria | 4657 |
| 60 | Ga0070715_10142679 | 3300006163 | Bacteria | 1165 |
| 61 | Ga0097621_100224264 | 3300006237 | Bacteria | 1639 |
| 62 | Ga0068871_100071410 | 3300006358 | Bacteria | 2855 |
| 63 | Ga0068871_100106690 | 3300006358 | Bacteria | 2352 |
| 64 | Ga0068871_100434102 | 3300006358 | Bacteria | 1175 |
| 65 | Ga0075434_100124026 | 3300006871 | Bacteria | 2600 |
| 66 | Ga0068865_100007677 | 3300006881 | Bacteria | 6643 |
| 67 | Ga0068865_100046407 | 3300006881 | Bacteria | 2981 |
| 68 | Ga0097620_100499909 | 3300006931 | Bacteria | 1311 |
| 69 | Ga0075435_100496458 | 3300007076 | Bacteria | 1055 |
| 70 | Ga0105240_10098447 | 3300009093 | Bacteria | 3562 |
| 71 | Ga0105240_10124883 | 3300009093 | Bacteria | 3094 |
| 72 | Ga0105240_10557027 | 3300009093 | Bacteria | 1268 |
| 73 | Ga0105245_10079194 | 3300009098 | Bacteria | 3000 |
| 74 | Ga0105245_10136141 | 3300009098 | Bacteria | 2308 |
| 75 | Ga0105245_10139774 | 3300009098 | Bacteria | 2279 |
| 76 | Ga0105245_10367489 | 3300009098 | Bacteria | 1429 |
| 77 | Ga0105247_10009786 | 3300009101 | Bacteria | 5809 |
| 78 | Ga0114129_10271700 | 3300009147 | Bacteria | 2268 |
| 79 | Ga0105243_10020489 | 3300009148 | Bacteria | 5013 |
| 80 | Ga0105243_10057822 | 3300009148 | Bacteria | 3089 |
| 81 | Ga0105241_10047328 | 3300009174 | Bacteria | 3270 |
| 82 | Ga0105241_10152357 | 3300009174 | Bacteria | 1892 |
| 83 | Ga0105241_10421414 | 3300009174 | Bacteria | 1175 |
| 84 | Ga0105242_10046008 | 3300009176 | Bacteria | 3539 |
| 85 | Ga0105242_10290337 | 3300009176 | Bacteria | 1489 |
| 86 | Ga0105248_10022362 | 3300009177 | Bacteria | 7014 |
| 87 | Ga0105248_10103092 | 3300009177 | Bacteria | 3215 |
| 88 | Ga0105248_10247822 | 3300009177 | Bacteria | 2005 |
| 89 | Ga0105237_10216880 | 3300009545 | Bacteria | 1913 |
| 90 | Ga0105237_10231700 | 3300009545 | Bacteria | 1848 |
| 91 | Ga0105238_10083910 | 3300009551 | Bacteria | 3175 |
| 92 | Ga0105249_10007044 | 3300009553 | Bacteria | 9808 |
| 93 | Ga0105249_10026075 | 3300009553 | Bacteria | 5265 |
| 94 | Ga0105239_10020993 | 3300010375 | Bacteria | 7208 |
| 95 | Ga0105239_10234681 | 3300010375 | Bacteria | 2058 |
| 96 | Ga0105239_10251698 | 3300010375 | Bacteria | 1984 |
| 97 | Ga0105246_10084843 | 3300011119 | Bacteria | 2267 |
| 98 | Ga0105246_10090749 | 3300011119 | Bacteria | 2201 |
| 99 | Ga0105246_10111631 | 3300011119 | Bacteria | 2009 |
| 100 | Ga0105246_10115914 | 3300011119 | Bacteria | 1977 |
| 101 | Ga0105246_10193982 | 3300011119 | Bacteria | 1574 |
| 102 | Ga0157373_10216964 | 3300013100 | Bacteria | 1349 |
| 103 | Ga0157369_10050758 | 3300013105 | Bacteria | 4490 |
| 104 | Ga0157374_10044710 | 3300013296 | Bacteria | 4094 |
| 105 | Ga0157374_10128034 | 3300013296 | Bacteria | 2455 |
| 106 | Ga0157378_10008350 | 3300013297 | Bacteria | 9019 |
| 107 | Ga0157378_10055308 | 3300013297 | Bacteria | 3535 |
| 108 | Ga0157378_10055669 | 3300013297 | Bacteria | 3523 |
| 109 | Ga0157378_10764113 | 3300013297 | Unclassified | 990 |
| 110 | Ga0163162_10106038 | 3300013306 | Bacteria | 2905 |
| 111 | Ga0163162_10139878 | 3300013306 | Bacteria | 2533 |
| 112 | Ga0157372_10159961 | 3300013307 | Bacteria | 2602 |
| 113 | Ga0157375_10011387 | 3300013308 | Bacteria | 7851 |
| 114 | Ga0157375_10043821 | 3300013308 | Bacteria | 4342 |
| 115 | Ga0157375_10176959 | 3300013308 | Bacteria | 2283 |
| 116 | Ga0163163_10000002 | 3300014325 | Bacteria | 609846 |
| 117 | Ga0163163_10223786 | 3300014325 | Bacteria | 1930 |
| 118 | Ga0163163_10272775 | 3300014325 | Bacteria | 1743 |
| 119 | Ga0157380_10059777 | 3300014326 | Bacteria | 3043 |
| 120 | Ga0157380_10362609 | 3300014326 | Bacteria | 1360 |
| 121 | Ga0157379_10004819 | 3300014968 | Bacteria | 11593 |
| 122 | Ga0157379_10012165 | 3300014968 | Bacteria | 7516 |
| 123 | Ga0157379_10029085 | 3300014968 | Bacteria | 4914 |
| 124 | Ga0157379_10204566 | 3300014968 | Bacteria | 1786 |
| 125 | Ga0157379_10348628 | 3300014968 | Bacteria | 1355 |
| 126 | Ga0157376_10023632 | 3300014969 | Bacteria | 4814 |
| 127 | Ga0157376_10087910 | 3300014969 | Bacteria | 2683 |
| 128 | Ga0157376_10099032 | 3300014969 | Bacteria | 2542 |
| 129 | Ga0163161_10036697 | 3300017792 | Bacteria | 3511 |
| 130 | Ga0163161_10055557 | 3300017792 | Bacteria | 2874 |
| 131 | Ga0207427_108006 | 3300025231 | Bacteria | 1203 |
| 132 | Ga0209233_1000015 | 3300025261 | Bacteria | 980563 |
| 133 | Ga0207710_10038632 | 3300025900 | Bacteria | 2111 |
| 134 | Ga0207680_10093859 | 3300025903 | Bacteria | 1915 |
| 135 | Ga0207680_10131896 | 3300025903 | Bacteria | 1648 |
| 136 | Ga0207685_10056016 | 3300025905 | Bacteria | 1541 |
| 137 | Ga0207645_10214335 | 3300025907 | Bacteria | 1269 |
| 138 | Ga0207654_10028949 | 3300025911 | Bacteria | 3025 |
| 139 | Ga0207654_10198440 | 3300025911 | Bacteria | 1320 |
| 140 | Ga0207695_10090821 | 3300025913 | Bacteria | 3069 |
| 141 | Ga0207695_10161212 | 3300025913 | Bacteria | 2174 |
| 142 | Ga0207671_10442426 | 3300025914 | Bacteria | 1035 |
| 143 | Ga0207693_10132156 | 3300025915 | Bacteria | 1962 |
| 144 | Ga0207663_10095785 | 3300025916 | Bacteria | 1981 |
| 145 | Ga0207687_10014900 | 3300025927 | Bacteria | 5092 |
| 146 | Ga0207687_10337679 | 3300025927 | Bacteria | 1224 |
| 147 | Ga0207706_10358038 | 3300025933 | Bacteria | 1268 |
| 148 | Ga0207686_10251036 | 3300025934 | Bacteria | 1292 |
| 149 | Ga0207709_10093253 | 3300025935 | Bacteria | 1974 |
| 150 | Ga0207670_10192105 | 3300025936 | Bacteria | 1545 |
| 151 | Ga0207669_10070111 | 3300025937 | Bacteria | 2196 |
| 152 | Ga0207669_10098087 | 3300025937 | Bacteria | 1929 |
| 153 | Ga0207704_10084201 | 3300025938 | Bacteria | 2066 |
| 154 | Ga0207665_10086132 | 3300025939 | Bacteria | 2169 |
| 155 | Ga0207691_10193169 | 3300025940 | Bacteria | 1775 |
| 156 | Ga0207711_10008568 | 3300025941 | Bacteria | 8555 |
| 157 | Ga0207689_10014919 | 3300025942 | Bacteria | 6592 |
| 158 | Ga0207661_10159882 | 3300025944 | Bacteria | 1954 |
| 159 | Ga0207679_10294762 | 3300025945 | Bacteria | 1396 |
| 160 | Ga0207651_10118540 | 3300025960 | Bacteria | 2002 |
| 161 | Ga0207651_10408829 | 3300025960 | Bacteria | 1156 |
| 162 | Ga0207712_10022283 | 3300025961 | Bacteria | 4169 |
| 163 | Ga0207712_10024580 | 3300025961 | Bacteria | 3992 |
| 164 | Ga0207668_10199231 | 3300025972 | Bacteria | 1593 |
| 165 | Ga0207658_10030336 | 3300025986 | Bacteria | 3827 |
| 166 | Ga0207658_10102293 | 3300025986 | Bacteria | 2247 |
| 167 | Ga0207658_10173370 | 3300025986 | Bacteria | 1779 |
| 168 | Ga0207677_10076614 | 3300026023 | Bacteria | 2382 |
| 169 | Ga0207677_10164599 | 3300026023 | Bacteria | 1727 |
| 170 | Ga0207677_10338640 | 3300026023 | Bacteria | 1256 |
| 171 | Ga0207703_10009813 | 3300026035 | Bacteria | 7510 |
| 172 | Ga0207703_10028431 | 3300026035 | Bacteria | 4407 |
| 173 | Ga0207703_10031546 | 3300026035 | Bacteria | 4191 |
| 174 | Ga0207703_10101025 | 3300026035 | Bacteria | 2445 |
| 175 | Ga0207639_10133979 | 3300026041 | Bacteria | 2055 |
| 176 | Ga0207639_10379299 | 3300026041 | Bacteria | 1269 |
| 177 | Ga0207678_10302121 | 3300026067 | Bacteria | 1375 |
| 178 | Ga0207641_10214245 | 3300026088 | Bacteria | 1783 |
| 179 | Ga0207648_10016758 | 3300026089 | Bacteria | 6684 |
| 180 | Ga0207648_10023606 | 3300026089 | Bacteria | 5506 |
| 181 | Ga0207674_10373769 | 3300026116 | Bacteria | 1378 |
| 182 | Ga0207675_100006648 | 3300026118 | Bacteria | 10937 |
| 183 | Ga0207675_100283965 | 3300026118 | Bacteria | 1609 |
| 184 | Ga0207683_10033624 | 3300026121 | Bacteria | 4454 |
| 185 | Ga0207683_10076085 | 3300026121 | Bacteria | 2972 |
| 186 | Ga0209998_10007078 | 3300027717 | Bacteria | 2326 |
| 187 | Ga0207428_10330529 | 3300027907 | Bacteria | 1124 |
| 188 | Ga0268266_10007372 | 3300028379 | Bacteria | 9934 |
| 189 | Ga0268266_10110992 | 3300028379 | Bacteria | 2429 |
| 190 | Ga0268266_10414376 | 3300028379 | Bacteria | 1276 |
| 191 | Ga0268265_10063206 | 3300028380 | Bacteria | 2847 |
| 192 | Ga0268265_10222495 | 3300028380 | Bacteria | 1653 |
| 193 | Ga0268264_10049906 | 3300028381 | Bacteria | 3483 |
| 194 | Ga0268264_10374963 | 3300028381 | Bacteria | 1361 |
| 195 | Ga0316575_10001036 | 3300031665 | Bacteria | 8625 |
| 196 | Ga0316575_10095245 | 3300031665 | Bacteria | 1208 |
| 197 | Ga0316576_10012661 | 3300031727 | Bacteria | 5579 |
| 198 | Ga0316576_10015543 | 3300031727 | Bacteria | 5112 |
| 199 | Ga0316578_10184949 | 3300031728 | Bacteria | 1255 |
| 200 | Ga0316577_10004330 | 3300031733 | Bacteria | 7320 |
| 201 | Ga0316577_10109070 | 3300031733 | Bacteria | 1553 |
| 202 | Ga0316577_10179623 | 3300031733 | Bacteria | 1195 |
| 203 | Ga0307406_10067991 | 3300031901 | Bacteria | 2325 |
| 204 | Ga0307415_100398132 | 3300032126 | Bacteria | 1175 |
| 205 | Ga0316583_10016582 | 3300032133 | Bacteria | 2650 |
| 206 | Ga0316588_1046351 | 3300033528 | Bacteria | 1048 |
| 207 | Ga0373941_0021320 | 3300035115 | Bacteria | 1827 |
| 208 | Ga0373953_0062377 | 3300035117 | Bacteria | 1526 |
| 209 | Ga0373954_0092828 | 3300035118 | Bacteria | 1451 |
| 210 | Ga0373943_0001595 | 3300035170 | Bacteria | 10270 |
| 211 | Ga0316574_0003206 | 3300035398 | Bacteria | 8382 |
| 212 | Ga0316574_0087384 | 3300035398 | Bacteria | 1985 |
| 213 | Ga0373927_0002114 | 3300035695 | Bacteria | 14645 |
| 214 | Ga0373927_0118861 | 3300035695 | Bacteria | 1725 |
| 215 | Ga0373933_0254557 | 3300035724 | Bacteria | 1131 |
| 216 | Ga0373947_0002223 | 3300035725 | Bacteria | 11746 |
| 217 | Ga0373937_0013033 | 3300036401 | Bacteria | 7322 |
| 218 | Ga0373937_0030125 | 3300036401 | Bacteria | 4916 |
| 219 | Ga0373937_0464566 | 3300036401 | Bacteria | 1202 |
| 220 | Ga0316582_0346049 | 3300036647 | Bacteria | 1022 |
| 221 | Ga0316584_0002158 | 3300036712 | Bacteria | 12317 |
| 222 | Ga0316584_0021539 | 3300036712 | Bacteria | 4686 |
| 223 | Ga0316584_0039347 | 3300036712 | Bacteria | 3520 |
| 224 | Ga0373925_0027368 | 3300037068 | Bacteria | 4173 |
| 225 | Ga0316581_0003709 | 3300037588 | Bacteria | 3828 |
| 226 | Ga0436360_0796979 | 3300039438 | Bacteria | 6362 |
| 227 | Ga0495603_0000388 | 3300046455 | Bacteria | 24093 |
| 228 | Ga0495641_0011172 | 3300046461 | Bacteria | 5139 |
| 229 | Ga0495580_0010115 | 3300046472 | Bacteria | 7368 |
| 230 | Ga0495582_0001097 | 3300046473 | Bacteria | 15190 |
| 231 | Ga0495639_0001533 | 3300046475 | Bacteria | 10306 |
| 232 | Ga0495594_0000118 | 3300046499 | Bacteria | 37004 |
| 233 | Ga0495596_0030928 | 3300046500 | Bacteria | 2141 |
| 234 | Ga0495666_0031793 | 3300046526 | Bacteria | 2586 |
| 235 | Ga0495652_0039078 | 3300046529 | Bacteria | 4105 |
| 236 | Ga0495665_0012636 | 3300046531 | Bacteria | 4572 |
| 237 | Ga0495587_0110070 | 3300046536 | Bacteria | 1583 |
| 238 | Ga0495587_0246405 | 3300046536 | Bacteria | 1005 |
| 239 | Ga0495621_0037542 | 3300046539 | Bacteria | 1685 |
| 240 | Ga0495622_0001418 | 3300046557 | Bacteria | 12117 |
| 241 | Ga0495634_0004076 | 3300046642 | Bacteria | 11574 |
| 242 | Ga0495635_0045769 | 3300046663 | Bacteria | 3019 |
| 243 | Ga0495623_0082928 | 3300046679 | Bacteria | 1981 |
| 244 | Ga0495647_0004404 | 3300046681 | Bacteria | 4576 |
| 245 | Ga0495658_0005399 | 3300046683 | Bacteria | 6282 |
| 246 | Ga0495613_0011228 | 3300046689 | Bacteria | 6654 |
| 247 | Ga0495581_0007319 | 3300047315 | Bacteria | 6387 |
| 248 | Ga0495680_0009556 | 3300047322 | Bacteria | 8712 |
| 249 | Ga0495614_0000925 | 3300048089 | Bacteria | 12513 |
| 250 | Ga0496100_0065541 | 3300048903 | Bacteria | 2407 |
| 251 | Ga0496101_0007361 | 3300048904 | Bacteria | 7128 |
| 252 | Ga0496101_0144012 | 3300048904 | Bacteria | 1819 |
| 253 | Ga0496101_0198217 | 3300048904 | Bacteria | 1551 |
| 254 | Ga0496101_0205173 | 3300048904 | Bacteria | 1525 |
| 255 | Ga0496102_0024870 | 3300048905 | Bacteria | 5326 |
| 256 | Ga0496102_0211073 | 3300048905 | Bacteria | 1830 |
| 257 | Ga0496102_0523112 | 3300048905 | Bacteria | 1109 |
| 258 | Ga0496103_0019299 | 3300048906 | Bacteria | 4094 |
| 259 | Ga0496104_0004903 | 3300048907 | Bacteria | 11670 |
| 260 | Ga0496104_0260976 | 3300048907 | Bacteria | 1645 |
| 261 | Ga0496104_0580793 | 3300048907 | Bacteria | 1031 |
| 262 | Ga0496105_0011302 | 3300048908 | Bacteria | 7049 |
| 263 | Ga0496105_0052737 | 3300048908 | Bacteria | 3359 |
| 264 | Ga0496105_0231166 | 3300048908 | Bacteria | 1503 |
| 265 | Ga0496106_0003035 | 3300048909 | Bacteria | 12500 |
| 266 | Ga0496106_0052580 | 3300048909 | Bacteria | 3074 |
| 267 | Ga0496107_0005889 | 3300048910 | Bacteria | 8398 |
| 268 | Ga0496107_0018935 | 3300048910 | Bacteria | 4853 |
| 269 | Ga0496108_0031199 | 3300048911 | Bacteria | 4420 |
| 270 | Ga0496108_0186953 | 3300048911 | Bacteria | 1795 |
| 271 | Ga0496108_0391301 | 3300048911 | Bacteria | 1214 |
| 272 | Ga0496109_0023691 | 3300048912 | Bacteria | 5450 |
| 273 | Ga0496109_0047722 | 3300048912 | Bacteria | 3895 |
| 274 | Ga0496109_0079389 | 3300048912 | Bacteria | 3023 |
| 275 | Ga0496110_0067575 | 3300048913 | Bacteria | 3163 |
| 276 | Ga0496110_0159263 | 3300048913 | Bacteria | 2046 |
| 277 | Ga0496111_0369489 | 3300048914 | Bacteria | 1061 |
| 278 | Ga0496112_0034229 | 3300048915 | Bacteria | 4942 |
| 279 | Ga0496112_0035579 | 3300048915 | Bacteria | 4852 |
| 280 | Ga0496113_0014438 | 3300048916 | Bacteria | 5388 |
| 281 | Ga0496113_0064399 | 3300048916 | Bacteria | 2772 |
| 282 | Ga0496114_0005047 | 3300048917 | Bacteria | 10292 |
| 283 | Ga0496114_0091618 | 3300048917 | Bacteria | 2582 |
| 284 | Ga0496115_0033333 | 3300048918 | Bacteria | 4066 |
| 285 | Ga0496115_0099299 | 3300048918 | Bacteria | 2385 |
| 286 | Ga0496115_0102387 | 3300048918 | Bacteria | 2349 |
| 287 | Ga0496115_0155602 | 3300048918 | Bacteria | 1889 |
| 288 | Ga0496124_0103005 | 3300048927 | Bacteria | 2309 |
| 289 | Ga0501031_0017500 | 3300049568 | Bacteria | 4659 |
| 290 | Ga0501031_0082039 | 3300049568 | Bacteria | 2102 |
| 291 | Ga0501033_0016928 | 3300049570 | Bacteria | 5510 |
| 292 | Ga0501036_0033117 | 3300049572 | Bacteria | 4370 |
| 293 | Ga0501036_0071399 | 3300049572 | Bacteria | 2936 |
| 294 | Ga0501036_0074588 | 3300049572 | Bacteria | 2869 |
| 295 | Ga0501036_0274922 | 3300049572 | Bacteria | 1410 |
| 296 | Ga0501036_0284791 | 3300049572 | Bacteria | 1383 |
| 297 | Ga0501036_0381264 | 3300049572 | Bacteria | 1177 |
| 298 | Ga0501037_0039247 | 3300049573 | Bacteria | 3487 |
| 299 | Ga0501037_0039397 | 3300049573 | Bacteria | 3479 |
| 300 | Ga0501038_0024712 | 3300049574 | Bacteria | 5357 |
| 301 | Ga0501038_0033207 | 3300049574 | Bacteria | 4546 |
| 302 | Ga0501038_0064021 | 3300049574 | Bacteria | 3137 |
| 303 | Ga0501039_0045565 | 3300049575 | Bacteria | 3388 |
| 304 | Ga0501039_0083265 | 3300049575 | Bacteria | 2491 |
| 305 | Ga0501039_0152852 | 3300049575 | Bacteria | 1813 |
| 306 | Ga0501039_0170946 | 3300049575 | Bacteria | 1708 |
| 307 | Ga0501041_0003093 | 3300049577 | Bacteria | 9567 |
| 308 | Ga0501041_0015747 | 3300049577 | Bacteria | 4491 |
| 309 | Ga0501041_0033982 | 3300049577 | Bacteria | 3086 |
| 310 | Ga0501041_0089245 | 3300049577 | Bacteria | 1903 |
| 311 | Ga0501041_0091580 | 3300049577 | Bacteria | 1877 |
| 312 | Ga0501042_0014448 | 3300049578 | Bacteria | 5390 |
| 313 | Ga0501042_0016684 | 3300049578 | Bacteria | 5048 |
| 314 | Ga0501042_0025356 | 3300049578 | Bacteria | 4163 |
| 315 | Ga0501042_0032669 | 3300049578 | Bacteria | 3686 |
| 316 | Ga0501042_0039133 | 3300049578 | Bacteria | 3369 |
| 317 | Ga0501043_0036186 | 3300049579 | Bacteria | 3883 |
| 318 | Ga0501043_0091188 | 3300049579 | Bacteria | 2396 |
| 319 | Ga0501046_0000063 | 3300049580 | Bacteria | 117905 |
| 320 | Ga0501046_0060187 | 3300049580 | Bacteria | 2972 |
| 321 | Ga0501046_0062330 | 3300049580 | Bacteria | 2914 |
| 322 | Ga0501046_0087786 | 3300049580 | Bacteria | 2396 |
| 323 | Ga0501046_0152276 | 3300049580 | Bacteria | 1744 |
| 324 | Ga0501047_0163375 | 3300049581 | Bacteria | 2098 |
| 325 | Ga0501048_0003852 | 3300049582 | Bacteria | 11430 |
| 326 | Ga0501048_0022132 | 3300049582 | Bacteria | 4651 |
| 327 | Ga0501048_0041088 | 3300049582 | Bacteria | 3313 |
| 328 | Ga0501068_0015038 | 3300049584 | Bacteria | 4437 |
| 329 | Ga0501068_0038096 | 3300049584 | Bacteria | 2879 |
| 330 | Ga0501068_0077877 | 3300049584 | Bacteria | 2031 |
| 331 | Ga0501069_0108801 | 3300049585 | Bacteria | 1577 |
| 332 | Ga0501070_0207858 | 3300049586 | Bacteria | 1607 |
| 333 | Ga0501071_0009755 | 3300049587 | Bacteria | 6406 |
| 334 | Ga0501071_0012163 | 3300049587 | Bacteria | 5824 |
| 335 | Ga0501071_0018521 | 3300049587 | Bacteria | 4823 |
| 336 | Ga0501071_0019353 | 3300049587 | Bacteria | 4723 |
| 337 | Ga0501072_0013339 | 3300049588 | Bacteria | 6291 |
| 338 | Ga0501072_0016718 | 3300049588 | Bacteria | 5637 |
| 339 | Ga0501072_0017692 | 3300049588 | Bacteria | 5481 |
| 340 | Ga0501072_0043557 | 3300049588 | Bacteria | 3527 |
| 341 | Ga0501072_0086906 | 3300049588 | Bacteria | 2481 |
| 342 | Ga0501072_0291727 | 3300049588 | Bacteria | 1297 |
| 343 | Ga0501073_0095111 | 3300049589 | Bacteria | 2069 |
| 344 | Ga0501074_0044405 | 3300049590 | Bacteria | 3217 |
| 345 | Ga0501074_0064624 | 3300049590 | Bacteria | 2634 |
| 346 | Ga0501074_0113471 | 3300049590 | Bacteria | 1939 |
| 347 | Ga0501074_0166161 | 3300049590 | Bacteria | 1575 |
| 348 | Ga0501074_0238099 | 3300049590 | Bacteria | 1295 |
| 349 | Ga0501074_0339879 | 3300049590 | Bacteria | 1066 |
| 350 | Ga0501075_0000593 | 3300049591 | Bacteria | 22110 |
| 351 | Ga0501075_0023346 | 3300049591 | Bacteria | 4527 |
| 352 | Ga0501075_0053044 | 3300049591 | Bacteria | 3049 |
| 353 | Ga0501075_0111228 | 3300049591 | Bacteria | 2083 |
| 354 | Ga0501076_0001620 | 3300049592 | Bacteria | 15188 |
| 355 | Ga0501076_0135678 | 3300049592 | Bacteria | 1997 |
| 356 | Ga0501076_0441486 | 3300049592 | Bacteria | 1071 |
| 357 | Ga0501077_0027178 | 3300049593 | Bacteria | 3633 |
| 358 | Ga0501077_0029522 | 3300049593 | Bacteria | 3486 |
| 359 | Ga0501077_0029965 | 3300049593 | Bacteria | 3462 |
| 360 | Ga0501077_0042908 | 3300049593 | Bacteria | 2874 |
| 361 | Ga0501077_0070512 | 3300049593 | Bacteria | 2215 |
| 362 | Ga0501079_0008944 | 3300049741 | Bacteria | 7581 |
| 363 | Ga0501079_0024709 | 3300049741 | Bacteria | 4610 |
| 364 | Ga0501079_0028920 | 3300049741 | Bacteria | 4253 |
| 365 | Ga0501079_0070923 | 3300049741 | Bacteria | 2691 |
| 366 | Ga0501080_0027493 | 3300049742 | Bacteria | 5290 |
| 367 | Ga0501080_0079915 | 3300049742 | Bacteria | 3040 |
| 368 | Ga0501080_0166625 | 3300049742 | Bacteria | 2033 |
| 369 | Ga0501080_0626763 | 3300049742 | Bacteria | 953 |
| 370 | Ga0501081_0006774 | 3300049743 | Bacteria | 7451 |
| 371 | Ga0501081_0030181 | 3300049743 | Bacteria | 3668 |
| 372 | Ga0501081_0037357 | 3300049743 | Bacteria | 3313 |
| 373 | Ga0501081_0038781 | 3300049743 | Bacteria | 3257 |
| 374 | Ga0501081_0047675 | 3300049743 | Bacteria | 2947 |
| 375 | Ga0501081_0071025 | 3300049743 | Bacteria | 2427 |
| 376 | Ga0501083_0040632 | 3300049744 | Bacteria | 3157 |
| 377 | Ga0501083_0084700 | 3300049744 | Bacteria | 2098 |
| 378 | Ga0501035_0021365 | 3300049822 | Bacteria | 5950 |
| 379 | Ga0501035_0065420 | 3300049822 | Bacteria | 3229 |
| 380 | Ga0501035_0192917 | 3300049822 | Bacteria | 1751 |
| 381 | Ga0501035_0390836 | 3300049822 | Bacteria | 1159 |
| 382 | Ga0501044_0352991 | 3300049823 | Bacteria | 1390 |
| 383 | Ga0501045_0004697 | 3300049824 | Bacteria | 9436 |
| 384 | Ga0501045_0040015 | 3300049824 | Bacteria | 3411 |
| 385 | Ga0501045_0054898 | 3300049824 | Bacteria | 2913 |
| 386 | Ga0501045_0137094 | 3300049824 | Bacteria | 1819 |
| 387 | nmdc:mga0qj67_213676_c1 | 3300050509 | Bacteria | 1566 |
| 388 | nmdc:mga06r32_225753_c1 | 3300050510 | Bacteria | 1861 |
| 389 | Ga0495612_0020047 | 3300053078 | Bacteria | 2679 |
| 390 | Ga0495595_0045531 | 3300053084 | Bacteria | 2018 |
| 391 | Ga0495619_0045154 | 3300053085 | Bacteria | 2894 |
| 392 | Ga0495619_0143611 | 3300053085 | Bacteria | 1645 |
| 393 | Ga0500643_000003 | 3300053087 | Bacteria | 876659 |
| 394 | Ga0500556_0000326 | 3300053104 | Bacteria | 35770 |
| 395 | Ga0500562_007605 | 3300053108 | Bacteria | 2732 |
| 396 | Ga0500595_011061 | 3300053119 | Bacteria | 3552 |
| 397 | Ga0500573_0000025 | 3300053140 | Bacteria | 144473 |
| 398 | Ga0500616_0002793 | 3300053153 | Bacteria | 14061 |
| 399 | Ga0500616_0051166 | 3300053153 | Bacteria | 2178 |
| 400 | Ga0500645_023978 | 3300053730 | Bacteria | 1868 |
| 401 | Ga0501084_0005112 | 3300054114 | Bacteria | 10739 |
| 402 | Ga0501084_0036083 | 3300054114 | Bacteria | 4131 |
| 403 | Ga0501084_0244821 | 3300054114 | Bacteria | 1513 |
| 404 | Ga0501084_0247970 | 3300054114 | Bacteria | 1503 |
| 405 | Ga0501082_0008121 | 3300060353 | Bacteria | 9055 |
| 406 | Ga0501082_0056422 | 3300060353 | Bacteria | 3383 |
| 407 | Ga0501082_0087985 | 3300060353 | Bacteria | 2680 |
| 408 | Ga0530510_0005370 | 3300061734 | Bacteria | 8867 |
| 409 | Ga0530510_0016845 | 3300061734 | Bacteria | 5176 |
| 410 | Ga0530510_0024140 | 3300061734 | Bacteria | 4337 |
| 411 | Ga0530510_0036968 | 3300061734 | Bacteria | 3518 |
| 412 | Ga0530510_0049778 | 3300061734 | Bacteria | 3026 |
| 413 | Ga0530510_0058523 | 3300061734 | Bacteria | 2786 |
| 414 | Ga0530510_0209142 | 3300061734 | Bacteria | 1450 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048918 | Ga0496115_0099299 | Ga0496115_0099299_1596_2345 | 228 |
| 2 | 3300025915 | Ga0207693_10132156 | Ga0207693_101321563 | 236 |
| 3 | 3300049578 | Ga0501042_0039133 | Ga0501042_0039133_1538_2413 | 238 |
| 4 | 3300049743 | Ga0501081_0037357 | Ga0501081_0037357_2018_2893 | 238 |
| 5 | 3300049578 | Ga0501042_0014448 | Ga0501042_0014448_2211_3083 | 239 |
| 6 | 3300049585 | Ga0501069_0108801 | Ga0501069_0108801_234_1106 | 239 |
| 7 | 3300049593 | Ga0501077_0027178 | Ga0501077_0027178_365_1237 | 239 |
| 8 | 3300049742 | Ga0501080_0626763 | Ga0501080_0626763_18_893 | 239 |
| 9 | 3300050509 | nmdc:mga0qj67_213676_c1 | nmdc:mga0qj67_213676_c1_48_899 | 239 |
| 10 | 3300049574 | Ga0501038_0064021 | Ga0501038_0064021_1771_2646 | 240 |
| 11 | 3300049587 | Ga0501071_0019353 | Ga0501071_0019353_3002_3877 | 240 |
| 12 | 3300049588 | Ga0501072_0043557 | Ga0501072_0043557_301_1176 | 240 |
| 13 | 3300049590 | Ga0501074_0113471 | Ga0501074_0113471_313_1188 | 240 |
| 14 | 3300049822 | Ga0501035_0192917 | Ga0501035_0192917_226_1101 | 240 |
| 15 | 3300054114 | Ga0501084_0247970 | Ga0501084_0247970_552_1427 | 240 |
| 16 | 3300061734 | Ga0530510_0036968 | Ga0530510_0036968_1921_2796 | 240 |
| 17 | 3300048911 | Ga0496108_0391301 | Ga0496108_0391301_363_1190 | 245 |
| 18 | 3300049577 | Ga0501041_0091580 | Ga0501041_0091580_34_909 | 245 |
| 19 | 3300053153 | Ga0500616_0002793 | Ga0500616_0002793_2401_3297 | 245 |
| 20 | 3300005330 | Ga0070690_100177297 | Ga0070690_1001772972 | 246 |
| 21 | 3300005353 | Ga0070669_100302418 | Ga0070669_1003024181 | 246 |
| 22 | 3300005444 | Ga0070694_100044641 | Ga0070694_1000446412 | 246 |
| 23 | 3300005545 | Ga0070695_100014677 | Ga0070695_1000146774 | 246 |
| 24 | 3300005549 | Ga0070704_100195940 | Ga0070704_1001959402 | 246 |
| 25 | 3300005614 | Ga0068856_100487497 | Ga0068856_1004874972 | 246 |
| 26 | 3300010375 | Ga0105239_10020993 | Ga0105239_100209932 | 246 |
| 27 | 3300013297 | Ga0157378_10055308 | Ga0157378_100553083 | 246 |
| 28 | 3300014968 | Ga0157379_10029085 | Ga0157379_100290853 | 246 |
| 29 | 3300025933 | Ga0207706_10358038 | Ga0207706_103580382 | 246 |
| 30 | 3300028381 | Ga0268264_10049906 | Ga0268264_100499063 | 246 |
| 31 | 3300035115 | Ga0373941_0021320 | Ga0373941_0021320_375_1262 | 246 |
| 32 | 3300048904 | Ga0496101_0205173 | Ga0496101_0205173_193_1071 | 246 |
| 33 | 3300048905 | Ga0496102_0211073 | Ga0496102_0211073_192_1070 | 246 |
| 34 | 3300048911 | Ga0496108_0186953 | Ga0496108_0186953_152_1030 | 246 |
| 35 | 3300048913 | Ga0496110_0159263 | Ga0496110_0159263_836_1714 | 246 |
| 36 | 3300048914 | Ga0496111_0369489 | Ga0496111_0369489_170_1048 | 246 |
| 37 | 3300048918 | Ga0496115_0155602 | Ga0496115_0155602_821_1699 | 246 |
| 38 | 3300010375 | Ga0105239_10251698 | Ga0105239_102516982 | 247 |
| 39 | 3300011119 | Ga0105246_10111631 | Ga0105246_101116312 | 247 |
| 40 | 3300031728 | Ga0316578_10184949 | Ga0316578_101849492 | 247 |
| 41 | 3300031733 | Ga0316577_10004330 | Ga0316577_100043308 | 247 |
| 42 | 3300032133 | Ga0316583_10016582 | Ga0316583_100165823 | 247 |
| 43 | 3300036712 | Ga0316584_0039347 | Ga0316584_0039347_1397_2281 | 247 |
| 44 | 3300037588 | Ga0316581_0003709 | Ga0316581_0003709_460_1344 | 247 |
| 45 | 3300048911 | Ga0496108_0031199 | Ga0496108_0031199_3086_3994 | 247 |
| 46 | 3300048913 | Ga0496110_0067575 | Ga0496110_0067575_565_1473 | 247 |
| 47 | 3300048915 | Ga0496112_0034229 | Ga0496112_0034229_3574_4482 | 247 |
| 48 | 3300048916 | Ga0496113_0014438 | Ga0496113_0014438_194_1102 | 247 |
| 49 | 3300049572 | Ga0501036_0274922 | Ga0501036_0274922_186_1061 | 247 |
| 50 | 3300049575 | Ga0501039_0083265 | Ga0501039_0083265_28_909 | 247 |
| 51 | 3300049580 | Ga0501046_0062330 | Ga0501046_0062330_1367_2248 | 247 |
| 52 | 3300049743 | Ga0501081_0038781 | Ga0501081_0038781_217_1098 | 247 |
| 53 | 3300049744 | Ga0501083_0040632 | Ga0501083_0040632_809_1690 | 247 |
| 54 | 3300049824 | Ga0501045_0137094 | Ga0501045_0137094_408_1289 | 247 |
| 55 | 3300060353 | Ga0501082_0056422 | Ga0501082_0056422_354_1235 | 247 |
| 56 | 3300049590 | Ga0501074_0339879 | Ga0501074_0339879_71_946 | 248 |
| 57 | 3300031665 | Ga0316575_10001036 | Ga0316575_100010368 | 249 |
| 58 | 3300048912 | Ga0496109_0079389 | Ga0496109_0079389_1351_2259 | 249 |
| 59 | 3300049575 | Ga0501039_0045565 | Ga0501039_0045565_1952_2833 | 249 |
| 60 | 3300049590 | Ga0501074_0044405 | Ga0501074_0044405_851_1732 | 249 |
| 61 | 3300049592 | Ga0501076_0135678 | Ga0501076_0135678_1009_1890 | 249 |
| 62 | 3300049568 | Ga0501031_0082039 | Ga0501031_0082039_394_1266 | 250 |
| 63 | 3300049572 | Ga0501036_0033117 | Ga0501036_0033117_2322_3194 | 250 |
| 64 | 3300049573 | Ga0501037_0039397 | Ga0501037_0039397_1756_2628 | 250 |
| 65 | 3300049574 | Ga0501038_0033207 | Ga0501038_0033207_2252_3124 | 250 |
| 66 | 3300049575 | Ga0501039_0170946 | Ga0501039_0170946_462_1334 | 250 |
| 67 | 3300049577 | Ga0501041_0003093 | Ga0501041_0003093_6424_7296 | 250 |
| 68 | 3300049579 | Ga0501043_0091188 | Ga0501043_0091188_68_940 | 250 |
| 69 | 3300049580 | Ga0501046_0060187 | Ga0501046_0060187_757_1629 | 250 |
| 70 | 3300049582 | Ga0501048_0022132 | Ga0501048_0022132_2758_3630 | 250 |
| 71 | 3300049584 | Ga0501068_0015038 | Ga0501068_0015038_2210_3082 | 250 |
| 72 | 3300049587 | Ga0501071_0012163 | Ga0501071_0012163_1264_2136 | 250 |
| 73 | 3300049590 | Ga0501074_0064624 | Ga0501074_0064624_1132_2004 | 250 |
| 74 | 3300049591 | Ga0501075_0023346 | Ga0501075_0023346_2328_3200 | 250 |
| 75 | 3300049741 | Ga0501079_0024709 | Ga0501079_0024709_2477_3349 | 250 |
| 76 | 3300049742 | Ga0501080_0027493 | Ga0501080_0027493_4346_5218 | 250 |
| 77 | 3300049743 | Ga0501081_0030181 | Ga0501081_0030181_736_1608 | 250 |
| 78 | 3300049744 | Ga0501083_0084700 | Ga0501083_0084700_517_1389 | 250 |
| 79 | 3300049822 | Ga0501035_0065420 | Ga0501035_0065420_355_1227 | 250 |
| 80 | 3300049823 | Ga0501044_0352991 | Ga0501044_0352991_187_1059 | 250 |
| 81 | 3300049824 | Ga0501045_0054898 | Ga0501045_0054898_1703_2575 | 250 |
| 82 | 3300054114 | Ga0501084_0244821 | Ga0501084_0244821_235_1107 | 250 |
| 83 | 3300060353 | Ga0501082_0087985 | Ga0501082_0087985_1395_2267 | 250 |
| 84 | 3300061734 | Ga0530510_0016845 | Ga0530510_0016845_3977_4849 | 250 |
| 85 | 3300049573 | Ga0501037_0039247 | Ga0501037_0039247_1643_2521 | 251 |
| 86 | 3300049588 | Ga0501072_0013339 | Ga0501072_0013339_5044_5922 | 251 |
| 87 | 3300049591 | Ga0501075_0053044 | Ga0501075_0053044_1779_2657 | 251 |
| 88 | 3300049742 | Ga0501080_0166625 | Ga0501080_0166625_331_1209 | 251 |
| 89 | 3300061734 | Ga0530510_0058523 | Ga0530510_0058523_503_1381 | 251 |
| 90 | 3300049572 | Ga0501036_0071399 | Ga0501036_0071399_684_1508 | 252 |
| 91 | 3300049577 | Ga0501041_0033982 | Ga0501041_0033982_1906_2730 | 252 |
| 92 | 3300049578 | Ga0501042_0016684 | Ga0501042_0016684_1870_2694 | 252 |
| 93 | 3300049582 | Ga0501048_0041088 | Ga0501048_0041088_1311_2135 | 252 |
| 94 | 3300049584 | Ga0501068_0077877 | Ga0501068_0077877_239_1063 | 252 |
| 95 | 3300049588 | Ga0501072_0086906 | Ga0501072_0086906_1376_2200 | 252 |
| 96 | 3300049591 | Ga0501075_0000593 | Ga0501075_0000593_14869_15693 | 252 |
| 97 | 3300049592 | Ga0501076_0001620 | Ga0501076_0001620_13277_14101 | 252 |
| 98 | 3300049593 | Ga0501077_0029522 | Ga0501077_0029522_17_841 | 252 |
| 99 | 3300049741 | Ga0501079_0008944 | Ga0501079_0008944_5525_6349 | 252 |
| 100 | 3300049824 | Ga0501045_0040015 | Ga0501045_0040015_502_1326 | 252 |
| 101 | 3300054114 | Ga0501084_0005112 | Ga0501084_0005112_6383_7207 | 252 |
| 102 | 3300060353 | Ga0501082_0008121 | Ga0501082_0008121_1172_1996 | 252 |
| 103 | 3300061734 | Ga0530510_0024140 | Ga0530510_0024140_2095_2919 | 252 |
| 104 | 3300049572 | Ga0501036_0284791 | Ga0501036_0284791_291_1112 | 255 |
| 105 | iso_pu_bacteria | 2842698319 | 2842702827 | 255 |
| 106 | 3300036647 | Ga0316582_0346049 | Ga0316582_0346049_15_845 | 256 |
| 107 | 3300053104 | Ga0500556_0000326 | Ga0500556_0000326_13425_14327 | 256 |
| 108 | 3300053730 | Ga0500645_023978 | Ga0500645_023978_632_1534 | 256 |
| 109 | 3300049590 | Ga0501074_0166161 | Ga0501074_0166161_712_1542 | 257 |
| 110 | 3300048905 | Ga0496102_0523112 | Ga0496102_0523112_182_1060 | 258 |
| 111 | 3300048908 | Ga0496105_0231166 | Ga0496105_0231166_132_1010 | 258 |
| 112 | 3300048915 | Ga0496112_0035579 | Ga0496112_0035579_2020_2898 | 258 |
| 113 | 3300049593 | Ga0501077_0070512 | Ga0501077_0070512_954_1790 | 258 |
| 114 | 3300039438 | Ga0436360_0796979 | Ga0436360_0796979_1647_2474 | 259 |
| 115 | 3300049572 | Ga0501036_0381264 | Ga0501036_0381264_145_1053 | 259 |
| 116 | 3300005539 | Ga0068853_100129002 | Ga0068853_1001290022 | 260 |
| 117 | 3300010375 | Ga0105239_10234681 | Ga0105239_102346812 | 260 |
| 118 | 3300026041 | Ga0207639_10379299 | Ga0207639_103792992 | 260 |
| 119 | 3300035695 | Ga0373927_0118861 | Ga0373927_0118861_551_1429 | 260 |
| 120 | 3300048904 | Ga0496101_0144012 | Ga0496101_0144012_184_1065 | 260 |
| 121 | 3300048917 | Ga0496114_0091618 | Ga0496114_0091618_797_1675 | 260 |
| 122 | 3300049580 | Ga0501046_0000063 | Ga0501046_0000063_23092_23967 | 260 |
| 123 | 3300036401 | Ga0373937_0464566 | Ga0373937_0464566_145_1020 | 261 |
| 124 | 3300035398 | Ga0316574_0087384 | Ga0316574_0087384_35_907 | 262 |
| 125 | 3300049588 | Ga0501072_0291727 | Ga0501072_0291727_22_873 | 262 |
| 126 | 3300005329 | Ga0070683_100628057 | Ga0070683_1006280571 | 264 |
| 127 | 3300031727 | Ga0316576_10012661 | Ga0316576_100126613 | 264 |
| 128 | 3300031733 | Ga0316577_10109070 | Ga0316577_101090702 | 264 |
| 129 | 3300036712 | Ga0316584_0002158 | Ga0316584_0002158_10115_10984 | 264 |
| 130 | 3300049589 | Ga0501073_0095111 | Ga0501073_0095111_735_1610 | 264 |
| 131 | 3300031665 | Ga0316575_10095245 | Ga0316575_100952452 | 265 |
| 132 | 3300031727 | Ga0316576_10015543 | Ga0316576_100155435 | 265 |
| 133 | 3300031733 | Ga0316577_10179623 | Ga0316577_101796232 | 265 |
| 134 | 3300035398 | Ga0316574_0003206 | Ga0316574_0003206_4028_4897 | 265 |
| 135 | 3300036712 | Ga0316584_0021539 | Ga0316584_0021539_1971_2840 | 265 |
| 136 | 3300005347 | Ga0070668_100009459 | Ga0070668_1000094592 | 266 |
| 137 | 3300005356 | Ga0070674_100105886 | Ga0070674_1001058863 | 266 |
| 138 | 3300005842 | Ga0068858_100015939 | Ga0068858_1000159396 | 266 |
| 139 | 3300009553 | Ga0105249_10007044 | Ga0105249_100070447 | 266 |
| 140 | 3300011119 | Ga0105246_10084843 | Ga0105246_100848432 | 266 |
| 141 | 3300013308 | Ga0157375_10176959 | Ga0157375_101769592 | 266 |
| 142 | 3300014326 | Ga0157380_10362609 | Ga0157380_103626092 | 266 |
| 143 | 3300014969 | Ga0157376_10087910 | Ga0157376_100879102 | 266 |
| 144 | 3300017792 | Ga0163161_10055557 | Ga0163161_100555572 | 266 |
| 145 | 3300025937 | Ga0207669_10070111 | Ga0207669_100701112 | 266 |
| 146 | 3300025961 | Ga0207712_10024580 | Ga0207712_100245805 | 266 |
| 147 | 3300026035 | Ga0207703_10031546 | Ga0207703_100315466 | 266 |
| 148 | 3300026118 | Ga0207675_100006648 | Ga0207675_1000066489 | 266 |
| 149 | 3300027717 | Ga0209998_10007078 | Ga0209998_100070781 | 266 |
| 150 | 3300028380 | Ga0268265_10063206 | Ga0268265_100632063 | 266 |
| 151 | 3300033528 | Ga0316588_1046351 | Ga0316588_10463511 | 266 |
| 152 | 3300046500 | Ga0495596_0030928 | Ga0495596_0030928_1240_2112 | 266 |
| 153 | 3300048903 | Ga0496100_0065541 | Ga0496100_0065541_277_1149 | 266 |
| 154 | 3300048907 | Ga0496104_0580793 | Ga0496104_0580793_129_1001 | 266 |
| 155 | 3300048909 | Ga0496106_0052580 | Ga0496106_0052580_449_1321 | 266 |
| 156 | 3300048910 | Ga0496107_0005889 | Ga0496107_0005889_7147_8019 | 266 |
| 157 | 3300048918 | Ga0496115_0033333 | Ga0496115_0033333_1027_1899 | 266 |
| 158 | 3300049591 | Ga0501075_0111228 | Ga0501075_0111228_351_1253 | 266 |
| 159 | 3300005347 | Ga0070668_100122064 | Ga0070668_1001220643 | 267 |
| 160 | 3300005355 | Ga0070671_100052025 | Ga0070671_1000520252 | 267 |
| 161 | 3300005356 | Ga0070674_100083127 | Ga0070674_1000831272 | 267 |
| 162 | 3300005364 | Ga0070673_100516261 | Ga0070673_1005162612 | 267 |
| 163 | 3300005365 | Ga0070688_100017102 | Ga0070688_1000171022 | 267 |
| 164 | 3300005366 | Ga0070659_100169508 | Ga0070659_1001695082 | 267 |
| 165 | 3300005367 | Ga0070667_100385398 | Ga0070667_1003853981 | 267 |
| 166 | 3300005437 | Ga0070710_10142184 | Ga0070710_101421842 | 267 |
| 167 | 3300005440 | Ga0070705_100066873 | Ga0070705_1000668732 | 267 |
| 168 | 3300005539 | Ga0068853_100027244 | Ga0068853_1000272443 | 267 |
| 169 | 3300005543 | Ga0070672_100258966 | Ga0070672_1002589662 | 267 |
| 170 | 3300005544 | Ga0070686_100201879 | Ga0070686_1002018792 | 267 |
| 171 | 3300005564 | Ga0070664_100508640 | Ga0070664_1005086402 | 267 |
| 172 | 3300005617 | Ga0068859_100499942 | Ga0068859_1004999422 | 267 |
| 173 | 3300005718 | Ga0068866_10022310 | Ga0068866_100223102 | 267 |
| 174 | 3300005842 | Ga0068858_100035019 | Ga0068858_1000350192 | 267 |
| 175 | 3300006163 | Ga0070715_10142679 | Ga0070715_101426792 | 267 |
| 176 | 3300006871 | Ga0075434_100124026 | Ga0075434_1001240262 | 267 |
| 177 | 3300006881 | Ga0068865_100007677 | Ga0068865_1000076777 | 267 |
| 178 | 3300006931 | Ga0097620_100499909 | Ga0097620_1004999092 | 267 |
| 179 | 3300007076 | Ga0075435_100496458 | Ga0075435_1004964582 | 267 |
| 180 | 3300009101 | Ga0105247_10009786 | Ga0105247_100097862 | 267 |
| 181 | 3300009147 | Ga0114129_10271700 | Ga0114129_102717002 | 267 |
| 182 | 3300009148 | Ga0105243_10057822 | Ga0105243_100578225 | 267 |
| 183 | 3300009174 | Ga0105241_10047328 | Ga0105241_100473282 | 267 |
| 184 | 3300009177 | Ga0105248_10022362 | Ga0105248_100223624 | 267 |
| 185 | 3300011119 | Ga0105246_10193982 | Ga0105246_101939822 | 267 |
| 186 | 3300013297 | Ga0157378_10008350 | Ga0157378_100083502 | 267 |
| 187 | 3300013308 | Ga0157375_10011387 | Ga0157375_100113875 | 267 |
| 188 | 3300014326 | Ga0157380_10059777 | Ga0157380_100597772 | 267 |
| 189 | 3300014968 | Ga0157379_10004819 | Ga0157379_100048199 | 267 |
| 190 | 3300014969 | Ga0157376_10099032 | Ga0157376_100990322 | 267 |
| 191 | 3300025900 | Ga0207710_10038632 | Ga0207710_100386322 | 267 |
| 192 | 3300025903 | Ga0207680_10131896 | Ga0207680_101318962 | 267 |
| 193 | 3300025905 | Ga0207685_10056016 | Ga0207685_100560162 | 267 |
| 194 | 3300025916 | Ga0207663_10095785 | Ga0207663_100957852 | 267 |
| 195 | 3300025935 | Ga0207709_10093253 | Ga0207709_100932531 | 267 |
| 196 | 3300025936 | Ga0207670_10192105 | Ga0207670_101921052 | 267 |
| 197 | 3300025937 | Ga0207669_10098087 | Ga0207669_100980872 | 267 |
| 198 | 3300025939 | Ga0207665_10086132 | Ga0207665_100861322 | 267 |
| 199 | 3300025940 | Ga0207691_10193169 | Ga0207691_101931692 | 267 |
| 200 | 3300025960 | Ga0207651_10408829 | Ga0207651_104088291 | 267 |
| 201 | 3300025972 | Ga0207668_10199231 | Ga0207668_101992312 | 267 |
| 202 | 3300026035 | Ga0207703_10101025 | Ga0207703_101010252 | 267 |
| 203 | 3300026088 | Ga0207641_10214245 | Ga0207641_102142452 | 267 |
| 204 | 3300028379 | Ga0268266_10414376 | Ga0268266_104143762 | 267 |
| 205 | 3300028381 | Ga0268264_10374963 | Ga0268264_103749632 | 267 |
| 206 | 3300035170 | Ga0373943_0001595 | Ga0373943_0001595_4777_5652 | 267 |
| 207 | 3300035695 | Ga0373927_0002114 | Ga0373927_0002114_2773_3648 | 267 |
| 208 | 3300035725 | Ga0373947_0002223 | Ga0373947_0002223_6083_6958 | 267 |
| 209 | 3300037068 | Ga0373925_0027368 | Ga0373925_0027368_528_1403 | 267 |
| 210 | 3300046455 | Ga0495603_0000388 | Ga0495603_0000388_9064_9939 | 267 |
| 211 | 3300046461 | Ga0495641_0011172 | Ga0495641_0011172_733_1608 | 267 |
| 212 | 3300046472 | Ga0495580_0010115 | Ga0495580_0010115_3240_4115 | 267 |
| 213 | 3300046473 | Ga0495582_0001097 | Ga0495582_0001097_11003_11878 | 267 |
| 214 | 3300046475 | Ga0495639_0001533 | Ga0495639_0001533_6252_7127 | 267 |
| 215 | 3300046499 | Ga0495594_0000118 | Ga0495594_0000118_6683_7558 | 267 |
| 216 | 3300046526 | Ga0495666_0031793 | Ga0495666_0031793_374_1249 | 267 |
| 217 | 3300046531 | Ga0495665_0012636 | Ga0495665_0012636_3439_4314 | 267 |
| 218 | 3300046557 | Ga0495622_0001418 | Ga0495622_0001418_3628_4503 | 267 |
| 219 | 3300046642 | Ga0495634_0004076 | Ga0495634_0004076_3240_4115 | 267 |
| 220 | 3300046663 | Ga0495635_0045769 | Ga0495635_0045769_101_976 | 267 |
| 221 | 3300046681 | Ga0495647_0004404 | Ga0495647_0004404_1550_2425 | 267 |
| 222 | 3300046683 | Ga0495658_0005399 | Ga0495658_0005399_4840_5715 | 267 |
| 223 | 3300046689 | Ga0495613_0011228 | Ga0495613_0011228_4308_5183 | 267 |
| 224 | 3300047315 | Ga0495581_0007319 | Ga0495581_0007319_1199_2074 | 267 |
| 225 | 3300047322 | Ga0495680_0009556 | Ga0495680_0009556_3975_4850 | 267 |
| 226 | 3300048089 | Ga0495614_0000925 | Ga0495614_0000925_7510_8385 | 267 |
| 227 | 3300048904 | Ga0496101_0007361 | Ga0496101_0007361_3682_4590 | 267 |
| 228 | 3300048904 | Ga0496101_0198217 | Ga0496101_0198217_424_1302 | 267 |
| 229 | 3300048905 | Ga0496102_0024870 | Ga0496102_0024870_2535_3443 | 267 |
| 230 | 3300048906 | Ga0496103_0019299 | Ga0496103_0019299_889_1797 | 267 |
| 231 | 3300048907 | Ga0496104_0004903 | Ga0496104_0004903_8021_8929 | 267 |
| 232 | 3300048907 | Ga0496104_0260976 | Ga0496104_0260976_26_904 | 267 |
| 233 | 3300048908 | Ga0496105_0011302 | Ga0496105_0011302_6098_7006 | 267 |
| 234 | 3300048908 | Ga0496105_0052737 | Ga0496105_0052737_1063_1941 | 267 |
| 235 | 3300048909 | Ga0496106_0003035 | Ga0496106_0003035_3771_4679 | 267 |
| 236 | 3300048910 | Ga0496107_0018935 | Ga0496107_0018935_746_1654 | 267 |
| 237 | 3300048912 | Ga0496109_0023691 | Ga0496109_0023691_2525_3403 | 267 |
| 238 | 3300048916 | Ga0496113_0064399 | Ga0496113_0064399_1322_2200 | 267 |
| 239 | 3300048917 | Ga0496114_0005047 | Ga0496114_0005047_3560_4468 | 267 |
| 240 | 3300049568 | Ga0501031_0017500 | Ga0501031_0017500_2171_3040 | 267 |
| 241 | 3300049570 | Ga0501033_0016928 | Ga0501033_0016928_3294_4163 | 267 |
| 242 | 3300049572 | Ga0501036_0074588 | Ga0501036_0074588_990_1859 | 267 |
| 243 | 3300049574 | Ga0501038_0024712 | Ga0501038_0024712_1714_2583 | 267 |
| 244 | 3300049575 | Ga0501039_0152852 | Ga0501039_0152852_783_1661 | 267 |
| 245 | 3300049577 | Ga0501041_0015747 | Ga0501041_0015747_1451_2320 | 267 |
| 246 | 3300049577 | Ga0501041_0089245 | Ga0501041_0089245_485_1393 | 267 |
| 247 | 3300049578 | Ga0501042_0025356 | Ga0501042_0025356_1349_2218 | 267 |
| 248 | 3300049578 | Ga0501042_0032669 | Ga0501042_0032669_1658_2566 | 267 |
| 249 | 3300049579 | Ga0501043_0036186 | Ga0501043_0036186_941_1810 | 267 |
| 250 | 3300049580 | Ga0501046_0087786 | Ga0501046_0087786_45_953 | 267 |
| 251 | 3300049580 | Ga0501046_0152276 | Ga0501046_0152276_595_1464 | 267 |
| 252 | 3300049582 | Ga0501048_0003852 | Ga0501048_0003852_745_1614 | 267 |
| 253 | 3300049584 | Ga0501068_0038096 | Ga0501068_0038096_1250_2119 | 267 |
| 254 | 3300049586 | Ga0501070_0207858 | Ga0501070_0207858_646_1515 | 267 |
| 255 | 3300049587 | Ga0501071_0009755 | Ga0501071_0009755_358_1227 | 267 |
| 256 | 3300049587 | Ga0501071_0018521 | Ga0501071_0018521_2202_3080 | 267 |
| 257 | 3300049588 | Ga0501072_0016718 | Ga0501072_0016718_4411_5319 | 267 |
| 258 | 3300049588 | Ga0501072_0017692 | Ga0501072_0017692_2262_3131 | 267 |
| 259 | 3300049590 | Ga0501074_0238099 | Ga0501074_0238099_142_1050 | 267 |
| 260 | 3300049592 | Ga0501076_0441486 | Ga0501076_0441486_174_1052 | 267 |
| 261 | 3300049593 | Ga0501077_0029965 | Ga0501077_0029965_1681_2589 | 267 |
| 262 | 3300049593 | Ga0501077_0042908 | Ga0501077_0042908_1024_1893 | 267 |
| 263 | 3300049741 | Ga0501079_0028920 | Ga0501079_0028920_1353_2222 | 267 |
| 264 | 3300049741 | Ga0501079_0070923 | Ga0501079_0070923_99_1007 | 267 |
| 265 | 3300049742 | Ga0501080_0079915 | Ga0501080_0079915_874_1743 | 267 |
| 266 | 3300049743 | Ga0501081_0006774 | Ga0501081_0006774_1272_2180 | 267 |
| 267 | 3300049743 | Ga0501081_0047675 | Ga0501081_0047675_1323_2192 | 267 |
| 268 | 3300049743 | Ga0501081_0071025 | Ga0501081_0071025_1524_2402 | 267 |
| 269 | 3300049822 | Ga0501035_0021365 | Ga0501035_0021365_3045_3914 | 267 |
| 270 | 3300049822 | Ga0501035_0390836 | Ga0501035_0390836_202_1080 | 267 |
| 271 | 3300049824 | Ga0501045_0004697 | Ga0501045_0004697_1907_2776 | 267 |
| 272 | 3300050510 | nmdc:mga06r32_225753_c1 | nmdc:mga06r32_225753_c1_668_1540 | 267 |
| 273 | 3300053085 | Ga0495619_0045154 | Ga0495619_0045154_298_1173 | 267 |
| 274 | 3300053153 | Ga0500616_0051166 | Ga0500616_0051166_273_1139 | 267 |
| 275 | 3300054114 | Ga0501084_0036083 | Ga0501084_0036083_1496_2404 | 267 |
| 276 | 3300061734 | Ga0530510_0005370 | Ga0530510_0005370_558_1436 | 267 |
| 277 | 3300061734 | Ga0530510_0049778 | Ga0530510_0049778_1462_2331 | 267 |
| 278 | 3300061734 | Ga0530510_0209142 | Ga0530510_0209142_468_1340 | 267 |
| 279 | 3300005459 | Ga0068867_100321530 | Ga0068867_1003215302 | 269 |
| 280 | 3300009093 | Ga0105240_10124883 | Ga0105240_101248832 | 269 |
| 281 | 3300027907 | Ga0207428_10330529 | Ga0207428_103305292 | 269 |
| 282 | 3300028380 | Ga0268265_10222495 | Ga0268265_102224952 | 269 |
| 283 | 3300031901 | Ga0307406_10067991 | Ga0307406_100679912 | 269 |
| 284 | 3300032126 | Ga0307415_100398132 | Ga0307415_1003981322 | 269 |
| 285 | 3300035118 | Ga0373954_0092828 | Ga0373954_0092828_177_1085 | 269 |
| 286 | 3300046529 | Ga0495652_0039078 | Ga0495652_0039078_2382_3290 | 269 |
| 287 | 3300046536 | Ga0495587_0110070 | Ga0495587_0110070_425_1333 | 269 |
| 288 | 3300046679 | Ga0495623_0082928 | Ga0495623_0082928_33_941 | 269 |
| 289 | 3300048912 | Ga0496109_0047722 | Ga0496109_0047722_180_1073 | 269 |
| 290 | 3300048927 | Ga0496124_0103005 | Ga0496124_0103005_761_1654 | 269 |
| 291 | 3300053078 | Ga0495612_0020047 | Ga0495612_0020047_507_1415 | 269 |
| 292 | 3300053084 | Ga0495595_0045531 | Ga0495595_0045531_385_1293 | 269 |
| 293 | 3300053108 | Ga0500562_007605 | Ga0500562_007605_410_1312 | 269 |
| 294 | 3300035117 | Ga0373953_0062377 | Ga0373953_0062377_388_1221 | 271 |
| 295 | 3300035724 | Ga0373933_0254557 | Ga0373933_0254557_112_945 | 271 |
| 296 | 3300036401 | Ga0373937_0013033 | Ga0373937_0013033_6445_7278 | 271 |
| 297 | 3300036401 | Ga0373937_0030125 | Ga0373937_0030125_3297_4130 | 271 |
| 298 | 3300046536 | Ga0495587_0246405 | Ga0495587_0246405_46_879 | 271 |
| 299 | 3300053085 | Ga0495619_0143611 | Ga0495619_0143611_413_1246 | 271 |
| 300 | 3300005327 | Ga0070658_10280186 | Ga0070658_102801861 | 275 |
| 301 | 3300005329 | Ga0070683_100238102 | Ga0070683_1002381021 | 275 |
| 302 | 3300005330 | Ga0070690_100018348 | Ga0070690_1000183484 | 275 |
| 303 | 3300005334 | Ga0068869_100149207 | Ga0068869_1001492071 | 275 |
| 304 | 3300005335 | Ga0070666_10273388 | Ga0070666_102733881 | 275 |
| 305 | 3300005335 | Ga0070666_10287475 | Ga0070666_102874751 | 275 |
| 306 | 3300005367 | Ga0070667_100149992 | Ga0070667_1001499922 | 275 |
| 307 | 3300005367 | Ga0070667_100288528 | Ga0070667_1002885282 | 275 |
| 308 | 3300005548 | Ga0070665_100010107 | Ga0070665_1000101076 | 275 |
| 309 | 3300005548 | Ga0070665_100345297 | Ga0070665_1003452972 | 275 |
| 310 | 3300005563 | Ga0068855_100198469 | Ga0068855_1001984692 | 275 |
| 311 | 3300005564 | Ga0070664_100368693 | Ga0070664_1003686932 | 275 |
| 312 | 3300005577 | Ga0068857_100286512 | Ga0068857_1002865122 | 275 |
| 313 | 3300005614 | Ga0068856_100237542 | Ga0068856_1002375422 | 275 |
| 314 | 3300005616 | Ga0068852_100224273 | Ga0068852_1002242733 | 275 |
| 315 | 3300005618 | Ga0068864_100012779 | Ga0068864_1000127795 | 275 |
| 316 | 3300005719 | Ga0068861_100249487 | Ga0068861_1002494872 | 275 |
| 317 | 3300005834 | Ga0068851_10050839 | Ga0068851_100508392 | 275 |
| 318 | 3300006358 | Ga0068871_100434102 | Ga0068871_1004341022 | 275 |
| 319 | 3300009093 | Ga0105240_10098447 | Ga0105240_100984473 | 275 |
| 320 | 3300009098 | Ga0105245_10367489 | Ga0105245_103674892 | 275 |
| 321 | 3300009174 | Ga0105241_10152357 | Ga0105241_101523572 | 275 |
| 322 | 3300009174 | Ga0105241_10421414 | Ga0105241_104214142 | 275 |
| 323 | 3300009177 | Ga0105248_10103092 | Ga0105248_101030923 | 275 |
| 324 | 3300009177 | Ga0105248_10247822 | Ga0105248_102478222 | 275 |
| 325 | 3300009545 | Ga0105237_10216880 | Ga0105237_102168802 | 275 |
| 326 | 3300009545 | Ga0105237_10231700 | Ga0105237_102317003 | 275 |
| 327 | 3300009551 | Ga0105238_10083910 | Ga0105238_100839103 | 275 |
| 328 | 3300009553 | Ga0105249_10026075 | Ga0105249_100260755 | 275 |
| 329 | 3300011119 | Ga0105246_10115914 | Ga0105246_101159142 | 275 |
| 330 | 3300013100 | Ga0157373_10216964 | Ga0157373_102169642 | 275 |
| 331 | 3300013105 | Ga0157369_10050758 | Ga0157369_100507585 | 275 |
| 332 | 3300013296 | Ga0157374_10128034 | Ga0157374_101280342 | 275 |
| 333 | 3300013297 | Ga0157378_10055669 | Ga0157378_100556693 | 275 |
| 334 | 3300013306 | Ga0163162_10106038 | Ga0163162_101060382 | 275 |
| 335 | 3300013307 | Ga0157372_10159961 | Ga0157372_101599612 | 275 |
| 336 | 3300014325 | Ga0163163_10000002 | Ga0163163_10000002540 | 275 |
| 337 | 3300014325 | Ga0163163_10223786 | Ga0163163_102237862 | 275 |
| 338 | 3300014325 | Ga0163163_10272775 | Ga0163163_102727752 | 275 |
| 339 | 3300014968 | Ga0157379_10204566 | Ga0157379_102045662 | 275 |
| 340 | 3300025903 | Ga0207680_10093859 | Ga0207680_100938592 | 275 |
| 341 | 3300025911 | Ga0207654_10028949 | Ga0207654_100289492 | 275 |
| 342 | 3300025911 | Ga0207654_10198440 | Ga0207654_101984402 | 275 |
| 343 | 3300025913 | Ga0207695_10090821 | Ga0207695_100908212 | 275 |
| 344 | 3300025913 | Ga0207695_10161212 | Ga0207695_101612122 | 275 |
| 345 | 3300025914 | Ga0207671_10442426 | Ga0207671_104424262 | 275 |
| 346 | 3300025941 | Ga0207711_10008568 | Ga0207711_100085683 | 275 |
| 347 | 3300025944 | Ga0207661_10159882 | Ga0207661_101598822 | 275 |
| 348 | 3300025945 | Ga0207679_10294762 | Ga0207679_102947622 | 275 |
| 349 | 3300025961 | Ga0207712_10022283 | Ga0207712_100222835 | 275 |
| 350 | 3300025986 | Ga0207658_10030336 | Ga0207658_100303364 | 275 |
| 351 | 3300025986 | Ga0207658_10102293 | Ga0207658_101022932 | 275 |
| 352 | 3300025986 | Ga0207658_10173370 | Ga0207658_101733702 | 275 |
| 353 | 3300026023 | Ga0207677_10164599 | Ga0207677_101645992 | 275 |
| 354 | 3300026023 | Ga0207677_10338640 | Ga0207677_103386402 | 275 |
| 355 | 3300026035 | Ga0207703_10009813 | Ga0207703_100098132 | 275 |
| 356 | 3300026035 | Ga0207703_10028431 | Ga0207703_100284313 | 275 |
| 357 | 3300026067 | Ga0207678_10302121 | Ga0207678_103021212 | 275 |
| 358 | 3300026116 | Ga0207674_10373769 | Ga0207674_103737692 | 275 |
| 359 | 3300026118 | Ga0207675_100283965 | Ga0207675_1002839652 | 275 |
| 360 | 3300028379 | Ga0268266_10007372 | Ga0268266_100073725 | 275 |
| 361 | 3300049581 | Ga0501047_0163375 | Ga0501047_0163375_832_1659 | 275 |
| 362 | 3300053087 | Ga0500643_000003 | Ga0500643_000003_320412_321239 | 275 |
| 363 | 3300053119 | Ga0500595_011061 | Ga0500595_011061_1476_2303 | 275 |
| 364 | 3300046539 | Ga0495621_0037542 | Ga0495621_0037542_580_1410 | 276 |
| 365 | 3300005328 | Ga0070676_10006897 | Ga0070676_100068972 | 277 |
| 366 | 3300005334 | Ga0068869_100009237 | Ga0068869_1000092372 | 277 |
| 367 | 3300005334 | Ga0068869_100274785 | Ga0068869_1002747852 | 277 |
| 368 | 3300005338 | Ga0068868_100126159 | Ga0068868_1001261593 | 277 |
| 369 | 3300005354 | Ga0070675_100041531 | Ga0070675_1000415312 | 277 |
| 370 | 3300005364 | Ga0070673_100050167 | Ga0070673_1000501672 | 277 |
| 371 | 3300005364 | Ga0070673_100139298 | Ga0070673_1001392982 | 277 |
| 372 | 3300005456 | Ga0070678_100067775 | Ga0070678_1000677752 | 277 |
| 373 | 3300005459 | Ga0068867_100018214 | Ga0068867_1000182145 | 277 |
| 374 | 3300005459 | Ga0068867_100021718 | Ga0068867_1000217186 | 277 |
| 375 | 3300005548 | Ga0070665_100018459 | Ga0070665_1000184592 | 277 |
| 376 | 3300005840 | Ga0068870_10020200 | Ga0068870_100202002 | 277 |
| 377 | 3300006237 | Ga0097621_100224264 | Ga0097621_1002242642 | 277 |
| 378 | 3300006358 | Ga0068871_100071410 | Ga0068871_1000714102 | 277 |
| 379 | 3300006358 | Ga0068871_100106690 | Ga0068871_1001066902 | 277 |
| 380 | 3300006881 | Ga0068865_100046407 | Ga0068865_1000464072 | 277 |
| 381 | 3300009093 | Ga0105240_10557027 | Ga0105240_105570271 | 277 |
| 382 | 3300009098 | Ga0105245_10079194 | Ga0105245_100791943 | 277 |
| 383 | 3300009098 | Ga0105245_10136141 | Ga0105245_101361412 | 277 |
| 384 | 3300009098 | Ga0105245_10139774 | Ga0105245_101397741 | 277 |
| 385 | 3300009148 | Ga0105243_10020489 | Ga0105243_100204896 | 277 |
| 386 | 3300009176 | Ga0105242_10046008 | Ga0105242_100460083 | 277 |
| 387 | 3300009176 | Ga0105242_10290337 | Ga0105242_102903372 | 277 |
| 388 | 3300011119 | Ga0105246_10090749 | Ga0105246_100907492 | 277 |
| 389 | 3300013296 | Ga0157374_10044710 | Ga0157374_100447103 | 277 |
| 390 | 3300013297 | Ga0157378_10764113 | Ga0157378_107641131 | 277 |
| 391 | 3300013306 | Ga0163162_10139878 | Ga0163162_101398782 | 277 |
| 392 | 3300013308 | Ga0157375_10043821 | Ga0157375_100438212 | 277 |
| 393 | 3300014968 | Ga0157379_10012165 | Ga0157379_100121656 | 277 |
| 394 | 3300014968 | Ga0157379_10348628 | Ga0157379_103486282 | 277 |
| 395 | 3300014969 | Ga0157376_10023632 | Ga0157376_100236322 | 277 |
| 396 | 3300017792 | Ga0163161_10036697 | Ga0163161_100366974 | 277 |
| 397 | 3300025907 | Ga0207645_10214335 | Ga0207645_102143351 | 277 |
| 398 | 3300025927 | Ga0207687_10014900 | Ga0207687_100149005 | 277 |
| 399 | 3300025927 | Ga0207687_10337679 | Ga0207687_103376792 | 277 |
| 400 | 3300025934 | Ga0207686_10251036 | Ga0207686_102510362 | 277 |
| 401 | 3300025938 | Ga0207704_10084201 | Ga0207704_100842013 | 277 |
| 402 | 3300025942 | Ga0207689_10014919 | Ga0207689_100149193 | 277 |
| 403 | 3300025960 | Ga0207651_10118540 | Ga0207651_101185402 | 277 |
| 404 | 3300026023 | Ga0207677_10076614 | Ga0207677_100766142 | 277 |
| 405 | 3300026041 | Ga0207639_10133979 | Ga0207639_101339792 | 277 |
| 406 | 3300026089 | Ga0207648_10016758 | Ga0207648_100167586 | 277 |
| 407 | 3300026089 | Ga0207648_10023606 | Ga0207648_100236062 | 277 |
| 408 | 3300026121 | Ga0207683_10033624 | Ga0207683_100336242 | 277 |
| 409 | 3300026121 | Ga0207683_10076085 | Ga0207683_100760852 | 277 |
| 410 | 3300028379 | Ga0268266_10110992 | Ga0268266_101109922 | 277 |
| 411 | 3300048918 | Ga0496115_0102387 | Ga0496115_0102387_1348_2202 | 277 |
| 412 | 3300053140 | Ga0500573_0000025 | Ga0500573_0000025_43855_44694 | 277 |
| 413 | 3300003214 | JGI25165J46597_1000003 | JGI25165J46597_1000003660 | 278 |
| 414 | 3300025231 | Ga0207427_108006 | Ga0207427_1080062 | 278 |
| 415 | 3300025261 | Ga0209233_1000015 | Ga0209233_1000015124 | 278 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7z3h-assembly2.cif.gz_B | crystal structure of iba57 from chaetomium thermophilum | 0.8479 | 3 | 275 |
| 7z3h-assembly5.cif.gz_E | crystal structure of iba57 from chaetomium thermophilum | 0.8426 | 3 | 275 |
| 7z3h-assembly4.cif.gz_D | crystal structure of iba57 from chaetomium thermophilum | 0.8425 | 3 | 275 |
| 7z3h-assembly6.cif.gz_F | crystal structure of iba57 from chaetomium thermophilum | 0.841 | 3 | 275 |
| 7z3h-assembly3.cif.gz_C | crystal structure of iba57 from chaetomium thermophilum | 0.8373 | 3 | 275 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1vlyA02 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Aminomethyltransferase beta-barrel domains | 0.9362 | 10 | 95 | 3.30.70.1400 |
| af_E9AH81_4_151_3.30.70.1400 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Aminomethyltransferase beta-barrel domains | 0.9232 | 2 | 94 | 3.30.70.1400 |
| 1vlyA02 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Aminomethyltransferase beta-barrel domains | 0.905 | 10 | 95 | 3.30.70.1400 |
| af_G5EE11_2_112_3.30.70.1400 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Aminomethyltransferase beta-barrel domains | 0.8938 | 3 | 101 | 3.30.70.1400 |
| 1wosA02 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Aminomethyltransferase beta-barrel domains | 0.891 | 9 | 93 | 3.30.70.1400 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1Q3JMC9-F1-model_v4 | deleted | 0.9714 | 1 | 275 |
|
| AF-A0A849E5N5-F1-model_v4 | Folate-binding protein | 0.9682 | 2 | 101 |
GO:0016226
|
| AF-A0A1Q3JMC9-F1-model_v4 | deleted | 0.9543 | 1 | 275 |
|
| AF-A0A846N4R4-F1-model_v4 | Aminomethyltransferase folate-binding domain-containing protein | 0.952 | 2 | 276 |
GO:0016226
|
| AF-A0A846N4R4-F1-model_v4 | Aminomethyltransferase folate-binding domain-containing protein | 0.9483 | 2 | 276 |
GO:0016226
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar