F438438

General Info

Members Datasets Scaffolds Average Seq Length
414 283 828 141

Family's Representative Sequence

Representative Sequence 3300049587|Ga0501071_0119821|Ga0501071_0119821_394_909
Length 171
Sequence VVAGRGKGGTAPFPDDSPLHHGLIEKERETMRFMVMVKATKESEAGEMPSEQLLSEMMRYNEELVKAGVMLAGEGLQPSSKGVRVRFNGKERKVIDGPFTETKELVAGFWIMQVRSREEVIEWVRRCPNPMEGESEIEIRQIFETDDFGDAMTPELRAQEERLRRQTQKHQ

Samples

Sample ID Description Type Environment
1 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
2 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
5 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
6 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
7 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
8 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
9 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
68 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
69 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
70 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
71 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
103 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
104 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
105 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
107 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
111 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
114 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
115 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
116 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
118 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
119 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
170 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
173 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
174 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
175 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
176 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
177 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
178 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
179 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
180 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
181 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
182 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
183 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
184 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
185 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
186 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
187 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
188 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
189 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
190 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
191 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
192 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
193 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
194 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
195 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
196 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
197 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
198 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
199 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
200 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
201 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
202 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
203 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
204 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
205 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
206 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
207 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
208 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
209 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
210 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
211 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
212 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
213 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
214 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
215 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
216 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
217 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
218 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
219 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
220 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
221 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
222 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
223 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
224 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
225 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
226 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
227 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
228 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
229 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
230 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
231 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
232 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
233 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
234 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
235 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
248 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
249 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
250 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
251 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
252 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
253 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
254 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
255 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
256 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
257 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
258 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
259 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
260 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
261 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
262 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
263 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
266 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
267 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
268 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
269 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
270 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
271 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
272 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
273 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
274 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
275 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
276 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
277 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
278 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
279 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
280 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
281 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
282 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
283 2928963466 Dyella japonica 1073 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.03
Metatranscriptomes 0
Isolates 0.97

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.66
Nodule 0
Rhizoplane 4.11
Rhizosphere 83.09
Stem 0
Stem Tuber 0
Unclassified 0.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501071_0119821 3300049587 Bacteria 1950
2 JGI25162J39368_1001626 3300002737 Bacteria 11229
3 JGI25151J46595_10008056 3300003187 Bacteria 5106
4 Ga0055542_1000184 3300003762 Bacteria 77138
5 Ga0055526_1003286 3300003771 Bacteria 10367
6 Ga0055537_1000584 3300003773 Bacteria 20298
7 Ga0055524_1000339 3300003775 Bacteria 43237
8 Ga0055528_1001583 3300003790 Bacteria 13500
9 Ga0055540_1000307 3300003792 Bacteria 43492
10 Ga0070658_10919119 3300005327 Bacteria 761
11 Ga0070676_10077665 3300005328 Bacteria 2007
12 Ga0070676_10382694 3300005328 Bacteria 975
13 Ga0070683_100112336 3300005329 Bacteria 2571
14 Ga0070683_100341499 3300005329 Bacteria 1426
15 Ga0070677_10655618 3300005333 Bacteria 587
16 Ga0068869_100043376 3300005334 Bacteria 3230
17 Ga0068869_100857646 3300005334 Bacteria 784
18 Ga0070680_100013043 3300005336 Bacteria 6468
19 Ga0070680_100021852 3300005336 Bacteria 5089
20 Ga0070682_101034624 3300005337 Bacteria 684
21 Ga0068868_100472581 3300005338 Bacteria 1094
22 Ga0070660_100416407 3300005339 Bacteria 1112
23 Ga0070691_10509944 3300005341 Bacteria 697
24 Ga0070692_10012485 3300005345 Bacteria 3933
25 Ga0070668_100578629 3300005347 Bacteria 980
26 Ga0070669_100913854 3300005353 Bacteria 750
27 Ga0070671_100689352 3300005355 Bacteria 886
28 Ga0070674_100045576 3300005356 Bacteria 2996
29 Ga0070674_100986168 3300005356 Bacteria 739
30 Ga0070673_100563152 3300005364 Bacteria 1036
31 Ga0070673_100704197 3300005364 Bacteria 927
32 Ga0070673_101909408 3300005364 Bacteria 563
33 Ga0070688_100758615 3300005365 Bacteria 756
34 Ga0070667_100771596 3300005367 Bacteria 892
35 Ga0070703_10002124 3300005406 Bacteria 5767
36 Ga0070714_100001170 3300005435 Bacteria 18916
37 Ga0070714_100231657 3300005435 Bacteria 1702
38 Ga0070710_10110540 3300005437 Bacteria 1650
39 Ga0070710_10974874 3300005437 Bacteria 616
40 Ga0070701_10158929 3300005438 Bacteria 1307
41 Ga0070701_10433307 3300005438 Bacteria 840
42 Ga0070705_100008553 3300005440 Bacteria 5070
43 Ga0070700_100005628 3300005441 Bacteria 6644
44 Ga0070700_100061573 3300005441 Bacteria 2368
45 Ga0070694_100779685 3300005444 Bacteria 782
46 Ga0070708_100056684 3300005445 Bacteria 3486
47 Ga0070663_101466018 3300005455 Bacteria 606
48 Ga0070678_100098768 3300005456 Bacteria 2258
49 Ga0070662_100306771 3300005457 Bacteria 1291
50 Ga0070662_101234612 3300005457 Bacteria 643
51 Ga0070681_10001446 3300005458 Bacteria 20920
52 Ga0070681_10170461 3300005458 Bacteria 2098
53 Ga0068867_100132670 3300005459 Bacteria 1938
54 Ga0068867_100781436 3300005459 Bacteria 850
55 Ga0070685_10109574 3300005466 Bacteria 1699
56 Ga0070685_10459430 3300005466 Bacteria 893
57 Ga0070706_100126323 3300005467 Bacteria 2385
58 Ga0070698_100086610 3300005471 Bacteria 3119
59 Ga0070698_100270753 3300005471 Bacteria 1630
60 Ga0070699_100061365 3300005518 Bacteria 3258
61 Ga0070679_100000085 3300005530 Bacteria 70740
62 Ga0070679_100011083 3300005530 Bacteria 8578
63 Ga0070679_100144316 3300005530 Bacteria 2359
64 Ga0070684_100018462 3300005535 Bacteria 5745
65 Ga0070684_100149442 3300005535 Bacteria 2116
66 Ga0070684_100934180 3300005535 Bacteria 813
67 Ga0070697_100166197 3300005536 Bacteria 1866
68 Ga0068853_100944597 3300005539 Bacteria 829
69 Ga0070686_100100638 3300005544 Bacteria 1952
70 Ga0070695_100015803 3300005545 Bacteria 4560
71 Ga0070695_101868008 3300005545 Bacteria 504
72 Ga0070696_100004528 3300005546 Bacteria 9276
73 Ga0070696_102019132 3300005546 Bacteria 501
74 Ga0070693_100088699 3300005547 Bacteria 1860
75 Ga0070693_100545548 3300005547 Bacteria 829
76 Ga0070665_100181533 3300005548 Bacteria 2105
77 Ga0070665_100269102 3300005548 Bacteria 1706
78 Ga0070704_100003253 3300005549 Bacteria 9287
79 Ga0068855_100118607 3300005563 Bacteria 3030
80 Ga0068855_100745007 3300005563 Bacteria 1045
81 Ga0068854_100295485 3300005578 Bacteria 1309
82 Ga0068856_100019460 3300005614 Bacteria 6589
83 Ga0070702_100643362 3300005615 Bacteria 801
84 Ga0068859_100017095 3300005617 Bacteria 7283
85 Ga0068864_101781446 3300005618 Unclassified 621
86 Ga0068866_10473280 3300005718 Bacteria 824
87 Ga0068861_100559929 3300005719 Bacteria 1043
88 Ga0068861_100840258 3300005719 Bacteria 865
89 Ga0068870_10706360 3300005840 Bacteria 696
90 Ga0068863_100067299 3300005841 Bacteria 3388
91 Ga0068863_100098773 3300005841 Bacteria 2773
92 Ga0068862_100339318 3300005844 Bacteria 1391
93 Ga0070717_10000013 3300006028 Bacteria 228046
94 Ga0075365_10327276 3300006038 Bacteria 1079
95 Ga0075363_100159248 3300006048 Bacteria 1277
96 Ga0075363_100274310 3300006048 Bacteria 974
97 Ga0075364_10106728 3300006051 Bacteria 1866
98 Ga0075432_10000280 3300006058 Bacteria 14149
99 Ga0075367_10042094 3300006178 Bacteria 2672
100 Ga0075367_10290748 3300006178 Bacteria 1028
101 Ga0097621_100616860 3300006237 Bacteria 993
102 Ga0068871_100389199 3300006358 Bacteria 1240
103 Ga0075430_100019898 3300006846 Bacteria 5710
104 Ga0075430_100062682 3300006846 Bacteria 3122
105 Ga0075430_100097182 3300006846 Bacteria 2461
106 Ga0075431_100000560 3300006847 Bacteria 31320
107 Ga0075431_100336020 3300006847 Bacteria 1521
108 Ga0075431_100360988 3300006847 Bacteria 1459
109 Ga0075431_100710725 3300006847 Bacteria 982
110 Ga0075431_100752930 3300006847 Bacteria 949
111 Ga0075434_100104378 3300006871 Bacteria 2844
112 Ga0075434_100530014 3300006871 Bacteria 1198
113 Ga0075434_101680302 3300006871 Bacteria 643
114 Ga0068865_100321956 3300006881 Bacteria 1244
115 Ga0068865_100782264 3300006881 Bacteria 822
116 Ga0097620_100017094 3300006931 Bacteria 7283
117 Ga0097620_100756337 3300006931 Bacteria 1061
118 Ga0075435_100122920 3300007076 Bacteria 2167
119 Ga0105240_10423597 3300009093 Bacteria 1495
120 Ga0111539_10013128 3300009094 Bacteria 10361
121 Ga0111539_10614563 3300009094 Bacteria 1266
122 Ga0111539_10672568 3300009094 Bacteria 1205
123 Ga0105245_10442974 3300009098 Bacteria 1306
124 Ga0105245_11007762 3300009098 Bacteria 877
125 Ga0114129_10027656 3300009147 Bacteria 8030
126 Ga0114129_10404601 3300009147 Bacteria 1798
127 Ga0114129_11205397 3300009147 Bacteria 943
128 Ga0105241_10405696 3300009174 Bacteria 1196
129 Ga0105242_10548878 3300009176 Bacteria 1108
130 Ga0105248_10653117 3300009177 Bacteria 1187
131 Ga0105237_10917276 3300009545 Bacteria 883
132 Ga0105238_10617862 3300009551 Bacteria 1092
133 Ga0105249_10015046 3300009553 Bacteria 6844
134 Ga0105239_10477257 3300010375 Bacteria 1416
135 Ga0105239_10753415 3300010375 Bacteria 1115
136 Ga0105246_10048766 3300011119 Bacteria 2897
137 Ga0105246_10336266 3300011119 Bacteria 1232
138 Ga0105246_10362829 3300011119 Bacteria 1191
139 Ga0105246_11331835 3300011119 Bacteria 667
140 Ga0157369_10951432 3300013105 Bacteria 880
141 Ga0157374_10325157 3300013296 Bacteria 1525
142 Ga0157374_10525177 3300013296 Bacteria 1190
143 Ga0157378_10463759 3300013297 Bacteria 1259
144 Ga0157372_10392840 3300013307 Bacteria 1616
145 Ga0157372_12335619 3300013307 Bacteria 614
146 Ga0157375_10140603 3300013308 Bacteria 2541
147 Ga0157375_11470033 3300013308 Bacteria 804
148 Ga0163163_10287914 3300014325 Bacteria 1695
149 Ga0163163_10459871 3300014325 Bacteria 1333
150 Ga0163163_11843497 3300014325 Bacteria 665
151 Ga0157380_10184506 3300014326 Bacteria 1836
152 Ga0157380_11219290 3300014326 Bacteria 797
153 Ga0157377_10045987 3300014745 Bacteria 2440
154 Ga0163161_10597597 3300017792 Bacteria 909
155 Ga0163161_11200003 3300017792 Bacteria 656
156 Ga0163161_11776361 3300017792 Bacteria 548
157 Ga0209672_101142 3300025228 Bacteria 10974
158 Ga0209437_100323 3300025233 Bacteria 61084
159 Ga0207425_1000864 3300025245 Bacteria 14824
160 Ga0209026_1001181 3300025250 Bacteria 12119
161 Ga0209148_1000252 3300025254 Bacteria 85199
162 Ga0209233_1017394 3300025261 Bacteria 1960
163 Ga0209565_1000101 3300025263 Bacteria 129092
164 Ga0209455_1014401 3300025272 Bacteria 1790
165 Ga0209673_1000820 3300025273 Bacteria 41055
166 Ga0209130_1000420 3300025284 Bacteria 45713
167 Ga0209675_1000121 3300025291 Bacteria 107684
168 Ga0209676_1000073 3300025292 Bacteria 305947
169 Ga0209025_1011678 3300025294 Bacteria 5746
170 Ga0209564_1000492 3300025295 Bacteria 65596
171 Ga0209564_1001449 3300025295 Bacteria 24206
172 Ga0209758_1041710 3300025297 Bacteria 1711
173 Ga0209050_1000008 3300025298 Bacteria 1144179
174 Ga0209256_1000168 3300025299 Bacteria 132040
175 Ga0207426_1011000 3300025302 Bacteria 3475
176 Ga0209051_1000005 3300025303 Bacteria 1142353
177 Ga0209257_1000031 3300025304 Bacteria 688770
178 Ga0207653_10003076 3300025885 Bacteria 5287
179 Ga0207682_10608009 3300025893 Bacteria 515
180 Ga0207692_10130490 3300025898 Bacteria 1419
181 Ga0207642_10451335 3300025899 Bacteria 779
182 Ga0207642_10584616 3300025899 Bacteria 693
183 Ga0207688_10007872 3300025901 Bacteria 5800
184 Ga0207688_10198939 3300025901 Bacteria 1201
185 Ga0207688_10288983 3300025901 Bacteria 1000
186 Ga0207699_10014675 3300025906 Bacteria 4047
187 Ga0207645_10096789 3300025907 Bacteria 1902
188 Ga0207645_10386242 3300025907 Bacteria 940
189 Ga0207643_10464331 3300025908 Bacteria 807
190 Ga0207705_10120452 3300025909 Bacteria 1947
191 Ga0207684_10307953 3300025910 Bacteria 1365
192 Ga0207654_10262214 3300025911 Bacteria 1162
193 Ga0207707_10029177 3300025912 Bacteria 4822
194 Ga0207707_10461937 3300025912 Bacteria 1085
195 Ga0207695_10840823 3300025913 Bacteria 798
196 Ga0207663_11509618 3300025916 Bacteria 541
197 Ga0207660_10013668 3300025917 Bacteria 5324
198 Ga0207660_10067939 3300025917 Bacteria 2583
199 Ga0207662_10074680 3300025918 Bacteria 2058
200 Ga0207657_11248486 3300025919 Bacteria 563
201 Ga0207649_10705151 3300025920 Bacteria 783
202 Ga0207649_11275136 3300025920 Bacteria 581
203 Ga0207652_10029984 3300025921 Bacteria 4553
204 Ga0207652_11414792 3300025921 Bacteria 599
205 Ga0207646_10251112 3300025922 Bacteria 1598
206 Ga0207646_10436520 3300025922 Bacteria 1182
207 Ga0207694_10410162 3300025924 Bacteria 1127
208 Ga0207694_10665167 3300025924 Bacteria 878
209 Ga0207650_10033351 3300025925 Bacteria 3729
210 Ga0207659_11661773 3300025926 Bacteria 544
211 Ga0207687_10044759 3300025927 Bacteria 3056
212 Ga0207664_10012411 3300025929 Bacteria 6089
213 Ga0207706_10232267 3300025933 Bacteria 1614
214 Ga0207706_11125551 3300025933 Bacteria 655
215 Ga0207686_10149302 3300025934 Bacteria 1625
216 Ga0207709_10042904 3300025935 Bacteria 2723
217 Ga0207709_10622750 3300025935 Bacteria 856
218 Ga0207709_10877805 3300025935 Bacteria 728
219 Ga0207670_10513875 3300025936 Bacteria 974
220 Ga0207669_10075109 3300025937 Bacteria 2140
221 Ga0207669_10119558 3300025937 Bacteria 1785
222 Ga0207704_10079162 3300025938 Bacteria 2117
223 Ga0207704_10364130 3300025938 Bacteria 1130
224 Ga0207704_10472040 3300025938 Bacteria 1005
225 Ga0207711_10877202 3300025941 Bacteria 834
226 Ga0207689_10117608 3300025942 Bacteria 2186
227 Ga0207689_10516107 3300025942 Bacteria 1002
228 Ga0207667_10591696 3300025949 Bacteria 1119
229 Ga0207712_10005502 3300025961 Bacteria 7988
230 Ga0207712_10498114 3300025961 Bacteria 1041
231 Ga0207668_10100747 3300025972 Bacteria 2146
232 Ga0207668_10655172 3300025972 Bacteria 919
233 Ga0207640_10298433 3300025981 Bacteria 1273
234 Ga0207640_10326375 3300025981 Bacteria 1224
235 Ga0207640_11432630 3300025981 Unclassified 619
236 Ga0207658_10074097 3300025986 Bacteria 2586
237 Ga0207677_10100933 3300026023 Bacteria 2123
238 Ga0207677_10451859 3300026023 Bacteria 1101
239 Ga0207703_10640101 3300026035 Bacteria 1008
240 Ga0207703_12354463 3300026035 Bacteria 508
241 Ga0207639_10799820 3300026041 Bacteria 879
242 Ga0207678_10047613 3300026067 Bacteria 3707
243 Ga0207678_10052180 3300026067 Bacteria 3529
244 Ga0207678_11235696 3300026067 Bacteria 661
245 Ga0207708_10019771 3300026075 Bacteria 5078
246 Ga0207708_10117701 3300026075 Bacteria 2068
247 Ga0207702_10894495 3300026078 Bacteria 880
248 Ga0207702_10983127 3300026078 Bacteria 837
249 Ga0207641_10390238 3300026088 Bacteria 1335
250 Ga0207641_10711815 3300026088 Bacteria 989
251 Ga0207648_10044511 3300026089 Bacteria 3894
252 Ga0207648_10608619 3300026089 Bacteria 1007
253 Ga0207675_100255320 3300026118 Bacteria 1698
254 Ga0207675_101319023 3300026118 Bacteria 742
255 Ga0207683_10027287 3300026121 Bacteria 4934
256 Ga0207428_10121031 3300027907 Bacteria 2007
257 Ga0207428_10420649 3300027907 Bacteria 977
258 Ga0268266_11204723 3300028379 Bacteria 732
259 Ga0268264_10007701 3300028381 Bacteria 8972
260 Ga0307408_100001509 3300031548 Bacteria 17289
261 Ga0307405_11183318 3300031731 Bacteria 660
262 Ga0307405_11758528 3300031731 Bacteria 550
263 Ga0307413_10088291 3300031824 Bacteria 2011
264 Ga0307518_10000268 3300031838 Bacteria 39200
265 Ga0307410_10330074 3300031852 Bacteria 1213
266 Ga0307406_10012948 3300031901 Bacteria 4767
267 Ga0307406_10473625 3300031901 Bacteria 1010
268 Ga0307407_10838944 3300031903 Bacteria 701
269 Ga0307409_100770643 3300031995 Bacteria 967
270 Ga0307416_102230340 3300032002 Bacteria 649
271 Ga0307411_10180976 3300032005 Bacteria 1600
272 Ga0307411_11347720 3300032005 Bacteria 651
273 Ga0373937_0063325 3300036401 Bacteria 3401
274 Ga0395905_0063106 3300037471 Bacteria 3466
275 Ga0436364_1126622 3300037853 Bacteria 1830
276 Ga0436365_0179688 3300039437 Bacteria 2022
277 Ga0436365_0956387 3300039437 Bacteria 8717
278 Ga0436365_1818184 3300039437 Bacteria 9806
279 Ga0436361_0998960 3300039447 Bacteria 1694
280 Ga0436362_0930043 3300039453 Bacteria 1148
281 Ga0451807_0013773 3300041486 Bacteria 721
282 Ga0451807_1284140 3300041486 Bacteria 574
283 Ga0451837_0808992 3300041494 Bacteria 1431
284 Ga0451839_1393908 3300041496 Bacteria 878
285 Ga0451853_3551483 3300041512 Bacteria 1029
286 Ga0439460_0051202 3300042461 Bacteria 1239
287 Ga0466965_0170616 3300044683 Bacteria 1144
288 Ga0466963_0969645 3300044694 Bacteria 599
289 Ga0466964_0493926 3300044706 Bacteria 656
290 Ga0453684_0777448 3300044712 Bacteria 1034
291 Ga0466970_0307599 3300044765 Bacteria 895
292 Ga0466960_0594783 3300044901 Bacteria 656
293 Ga0466967_0412709 3300045976 Bacteria 1315
294 Ga0495603_0101101 3300046455 Bacteria 1683
295 Ga0495580_0068895 3300046472 Bacteria 2473
296 Ga0495580_0243253 3300046472 Bacteria 1233
297 Ga0495582_0022040 3300046473 Bacteria 3485
298 Ga0495582_0024741 3300046473 Bacteria 3287
299 Ga0495639_0042356 3300046475 Bacteria 2053
300 Ga0495664_0037561 3300046477 Bacteria 2859
301 Ga0495594_0020543 3300046499 Bacteria 3518
302 Ga0495618_0041776 3300046514 Bacteria 2889
303 Ga0495628_0085331 3300046516 Bacteria 2450
304 Ga0495630_0039009 3300046517 Bacteria 3552
305 Ga0495666_0008247 3300046526 Bacteria 5220
306 Ga0495640_0060031 3300046533 Bacteria 2587
307 Ga0495621_0429020 3300046539 Bacteria 564
308 Ga0495622_0111935 3300046557 Bacteria 1250
309 Ga0495634_0016572 3300046642 Bacteria 5267
310 Ga0495647_0015542 3300046681 Bacteria 2669
311 Ga0495647_0208464 3300046681 Bacteria 859
312 Ga0495658_0003552 3300046683 Bacteria 7711
313 Ga0495658_0026053 3300046683 Bacteria 3130
314 Ga0495613_0113983 3300046689 Bacteria 1946
315 Ga0495624_0774380 3300046690 Bacteria 568
316 Ga0495600_0226378 3300046809 Bacteria 1195
317 Ga0495581_0622362 3300047315 Bacteria 625
318 Ga0495674_0045889 3300047319 Bacteria 3880
319 Ga0495672_0001295 3300047320 Bacteria 24958
320 Ga0495676_0198869 3300047321 Bacteria 1393
321 Ga0495680_0025313 3300047322 Bacteria 4914
322 Ga0495684_0081004 3300047471 Bacteria 2464
323 Ga0496101_0034620 3300048904 Bacteria 3568
324 Ga0496101_1056802 3300048904 Bacteria 638
325 Ga0496102_0008851 3300048905 Bacteria 8638
326 Ga0496102_0022883 3300048905 Bacteria 5542
327 Ga0496104_0054124 3300048907 Bacteria 3793
328 Ga0496105_0470881 3300048908 Bacteria 990
329 Ga0496106_0000080 3300048909 Bacteria 76997
330 Ga0496106_0005624 3300048909 Bacteria 9276
331 Ga0496107_0001928 3300048910 Bacteria 13160
332 Ga0496107_0011011 3300048910 Bacteria 6292
333 Ga0496108_0032033 3300048911 Bacteria 4364
334 Ga0496110_0163386 3300048913 Bacteria 2019
335 Ga0496112_0157084 3300048915 Bacteria 2241
336 Ga0496114_0008209 3300048917 Bacteria 8273
337 Ga0496114_0738783 3300048917 Bacteria 861
338 Ga0501031_0029620 3300049568 Bacteria 3571
339 Ga0501033_0128416 3300049570 Bacteria 1837
340 Ga0501034_0600102 3300049571 Bacteria 1006
341 Ga0501036_0049173 3300049572 Bacteria 3570
342 Ga0501038_0572096 3300049574 Bacteria 857
343 Ga0501039_0018975 3300049575 Bacteria 5277
344 Ga0501041_0101171 3300049577 Bacteria 1784
345 Ga0501041_0109987 3300049577 Bacteria 1710
346 Ga0501042_0194965 3300049578 Bacteria 1461
347 Ga0501043_0191471 3300049579 Bacteria 1590
348 Ga0501043_0505407 3300049579 Bacteria 902
349 Ga0501043_0860879 3300049579 Bacteria 652
350 Ga0501046_0000055 3300049580 Bacteria 129853
351 Ga0501046_0511857 3300049580 Bacteria 859
352 Ga0501047_0005669 3300049581 Bacteria 11754
353 Ga0501047_0185219 3300049581 Bacteria 1947
354 Ga0501048_0008411 3300049582 Bacteria 7803
355 Ga0501067_0090794 3300049583 Bacteria 1696
356 Ga0501068_0691648 3300049584 Bacteria 667
357 Ga0501070_0303007 3300049586 Bacteria 1301
358 Ga0501072_0023766 3300049588 Bacteria 4761
359 Ga0501072_0359473 3300049588 Bacteria 1156
360 Ga0501072_1073671 3300049588 Unclassified 627
361 Ga0501073_0637691 3300049589 Bacteria 735
362 Ga0501074_0074015 3300049590 Bacteria 2446
363 Ga0501074_0278170 3300049590 Bacteria 1190
364 Ga0501074_1195875 3300049590 Bacteria 533
365 Ga0501075_0193214 3300049591 Bacteria 1552
366 Ga0501076_0023341 3300049592 Bacteria 4767
367 Ga0501076_0240002 3300049592 Bacteria 1483
368 Ga0501217_073024 3300049661 Bacteria 937
369 Ga0501227_007998 3300049665 Bacteria 2269
370 Ga0501233_016320 3300049668 Bacteria 1539
371 Ga0501225_0010934 3300049705 Bacteria 2562
372 Ga0501079_0005189 3300049741 Bacteria 9683
373 Ga0501079_0531761 3300049741 Bacteria 924
374 Ga0501080_0198990 3300049742 Bacteria 1840
375 Ga0501080_0233738 3300049742 Bacteria 1680
376 Ga0501081_0102773 3300049743 Bacteria 2022
377 Ga0501083_0000281 3300049744 Bacteria 32337
378 Ga0501035_0104973 3300049822 Bacteria 2477
379 Ga0501035_0116879 3300049822 Bacteria 2334
380 Ga0501044_0040318 3300049823 Bacteria 4867
381 Ga0501044_0185184 3300049823 Bacteria 2047
382 Ga0501044_1280569 3300049823 Bacteria 600
383 Ga0501045_0116725 3300049824 Bacteria 1981
384 nmdc:mga03n38_714925_c1 3300050490 Bacteria 578
385 nmdc:mga00v17_311427_c1 3300050491 Bacteria 1023
386 nmdc:mga00v17_55553_c2 3300050491 Bacteria 2112
387 nmdc:mga0yw44_289959_c1 3300050492 Bacteria 1095
388 nmdc:mga06z11_204572_c1 3300050494 Bacteria 1148
389 nmdc:mga05p37_383631_c1 3300050507 Bacteria 1646
390 nmdc:mga05p37_615499_c1 3300050507 Bacteria 1223
391 nmdc:mga0qj67_345262_c1 3300050509 Bacteria 1204
392 nmdc:mga0qj67_53827_c1 3300050509 Bacteria 3186
393 nmdc:mga0qj67_78305_c1 3300050509 Bacteria 2646
394 nmdc:mga06r32_696142_c1 3300050510 Bacteria 982
395 nmdc:mga06r32_91278_c1 3300050510 Bacteria 2976
396 nmdc:mga08y16_150094_c1 3300050511 Bacteria 2423
397 nmdc:mga08y16_26410_c1 3300050511 Bacteria 6123
398 nmdc:mga08y16_538974_c1 3300050511 Bacteria 1182
399 nmdc:mga08y16_663903_c1 3300050511 Bacteria 1045
400 nmdc:mga0n895_1799480_c1 3300050512 Bacteria 573
401 nmdc:mga0n895_20252_c1 3300050512 Bacteria 6199
402 nmdc:mga0n895_77661_c1 3300050512 Bacteria 3303
403 nmdc:mga0rr50_28138_c1 3300050513 Bacteria 3947
404 nmdc:mga08x19_313148_c1 3300050514 Bacteria 1091
405 nmdc:mga08x19_566523_c1 3300050514 Bacteria 804
406 nmdc:mga08x19_895321_c1 3300050514 Bacteria 630
407 Ga0495619_0120833 3300053085 Bacteria 1796
408 Ga0500556_0000032 3300053104 Bacteria 150774
409 Ga0501082_0192354 3300060353 Bacteria 1774
410 Ga0501082_0354042 3300060353 Bacteria 1280
411 2586065021 2585427649 Bacteria 9053857
412 2809593423 2808606522 Bacteria 9488490
413 2915769429 2915768154 Bacteria 8424322
414 2928966205 2928963466 Bacteria 5165703
415 Ga0501071_0119821
416 JGI25162J39368_1001626
417 JGI25151J46595_10008056
418 Ga0055542_1000184
419 Ga0055526_1003286
420 Ga0055537_1000584
421 Ga0055524_1000339
422 Ga0055528_1001583
423 Ga0055540_1000307
424 Ga0070658_10919119
425 Ga0070676_10077665
426 Ga0070676_10382694
427 Ga0070683_100112336
428 Ga0070683_100341499
429 Ga0070677_10655618
430 Ga0068869_100043376
431 Ga0068869_100857646
432 Ga0070680_100013043
433 Ga0070680_100021852
434 Ga0070682_101034624
435 Ga0068868_100472581
436 Ga0070660_100416407
437 Ga0070691_10509944
438 Ga0070692_10012485
439 Ga0070668_100578629
440 Ga0070669_100913854
441 Ga0070671_100689352
442 Ga0070674_100045576
443 Ga0070674_100986168
444 Ga0070673_100563152
445 Ga0070673_100704197
446 Ga0070673_101909408
447 Ga0070688_100758615
448 Ga0070667_100771596
449 Ga0070703_10002124
450 Ga0070714_100001170
451 Ga0070714_100231657
452 Ga0070710_10110540
453 Ga0070710_10974874
454 Ga0070701_10158929
455 Ga0070701_10433307
456 Ga0070705_100008553
457 Ga0070700_100005628
458 Ga0070700_100061573
459 Ga0070694_100779685
460 Ga0070708_100056684
461 Ga0070663_101466018
462 Ga0070678_100098768
463 Ga0070662_100306771
464 Ga0070662_101234612
465 Ga0070681_10001446
466 Ga0070681_10170461
467 Ga0068867_100132670
468 Ga0068867_100781436
469 Ga0070685_10109574
470 Ga0070685_10459430
471 Ga0070706_100126323
472 Ga0070698_100086610
473 Ga0070698_100270753
474 Ga0070699_100061365
475 Ga0070679_100000085
476 Ga0070679_100011083
477 Ga0070679_100144316
478 Ga0070684_100018462
479 Ga0070684_100149442
480 Ga0070684_100934180
481 Ga0070697_100166197
482 Ga0068853_100944597
483 Ga0070686_100100638
484 Ga0070695_100015803
485 Ga0070695_101868008
486 Ga0070696_100004528
487 Ga0070696_102019132
488 Ga0070693_100088699
489 Ga0070693_100545548
490 Ga0070665_100181533
491 Ga0070665_100269102
492 Ga0070704_100003253
493 Ga0068855_100118607
494 Ga0068855_100745007
495 Ga0068854_100295485
496 Ga0068856_100019460
497 Ga0070702_100643362
498 Ga0068859_100017095
499 Ga0068864_101781446
500 Ga0068866_10473280
501 Ga0068861_100559929
502 Ga0068861_100840258
503 Ga0068870_10706360
504 Ga0068863_100067299
505 Ga0068863_100098773
506 Ga0068862_100339318
507 Ga0070717_10000013
508 Ga0075365_10327276
509 Ga0075363_100159248
510 Ga0075363_100274310
511 Ga0075364_10106728
512 Ga0075432_10000280
513 Ga0075367_10042094
514 Ga0075367_10290748
515 Ga0097621_100616860
516 Ga0068871_100389199
517 Ga0075430_100019898
518 Ga0075430_100062682
519 Ga0075430_100097182
520 Ga0075431_100000560
521 Ga0075431_100336020
522 Ga0075431_100360988
523 Ga0075431_100710725
524 Ga0075431_100752930
525 Ga0075434_100104378
526 Ga0075434_100530014
527 Ga0075434_101680302
528 Ga0068865_100321956
529 Ga0068865_100782264
530 Ga0097620_100017094
531 Ga0097620_100756337
532 Ga0075435_100122920
533 Ga0105240_10423597
534 Ga0111539_10013128
535 Ga0111539_10614563
536 Ga0111539_10672568
537 Ga0105245_10442974
538 Ga0105245_11007762
539 Ga0114129_10027656
540 Ga0114129_10404601
541 Ga0114129_11205397
542 Ga0105241_10405696
543 Ga0105242_10548878
544 Ga0105248_10653117
545 Ga0105237_10917276
546 Ga0105238_10617862
547 Ga0105249_10015046
548 Ga0105239_10477257
549 Ga0105239_10753415
550 Ga0105246_10048766
551 Ga0105246_10336266
552 Ga0105246_10362829
553 Ga0105246_11331835
554 Ga0157369_10951432
555 Ga0157374_10325157
556 Ga0157374_10525177
557 Ga0157378_10463759
558 Ga0157372_10392840
559 Ga0157372_12335619
560 Ga0157375_10140603
561 Ga0157375_11470033
562 Ga0163163_10287914
563 Ga0163163_10459871
564 Ga0163163_11843497
565 Ga0157380_10184506
566 Ga0157380_11219290
567 Ga0157377_10045987
568 Ga0163161_10597597
569 Ga0163161_11200003
570 Ga0163161_11776361
571 Ga0209672_101142
572 Ga0209437_100323
573 Ga0207425_1000864
574 Ga0209026_1001181
575 Ga0209148_1000252
576 Ga0209233_1017394
577 Ga0209565_1000101
578 Ga0209455_1014401
579 Ga0209673_1000820
580 Ga0209130_1000420
581 Ga0209675_1000121
582 Ga0209676_1000073
583 Ga0209025_1011678
584 Ga0209564_1000492
585 Ga0209564_1001449
586 Ga0209758_1041710
587 Ga0209050_1000008
588 Ga0209256_1000168
589 Ga0207426_1011000
590 Ga0209051_1000005
591 Ga0209257_1000031
592 Ga0207653_10003076
593 Ga0207682_10608009
594 Ga0207692_10130490
595 Ga0207642_10451335
596 Ga0207642_10584616
597 Ga0207688_10007872
598 Ga0207688_10198939
599 Ga0207688_10288983
600 Ga0207699_10014675
601 Ga0207645_10096789
602 Ga0207645_10386242
603 Ga0207643_10464331
604 Ga0207705_10120452
605 Ga0207684_10307953
606 Ga0207654_10262214
607 Ga0207707_10029177
608 Ga0207707_10461937
609 Ga0207695_10840823
610 Ga0207663_11509618
611 Ga0207660_10013668
612 Ga0207660_10067939
613 Ga0207662_10074680
614 Ga0207657_11248486
615 Ga0207649_10705151
616 Ga0207649_11275136
617 Ga0207652_10029984
618 Ga0207652_11414792
619 Ga0207646_10251112
620 Ga0207646_10436520
621 Ga0207694_10410162
622 Ga0207694_10665167
623 Ga0207650_10033351
624 Ga0207659_11661773
625 Ga0207687_10044759
626 Ga0207664_10012411
627 Ga0207706_10232267
628 Ga0207706_11125551
629 Ga0207686_10149302
630 Ga0207709_10042904
631 Ga0207709_10622750
632 Ga0207709_10877805
633 Ga0207670_10513875
634 Ga0207669_10075109
635 Ga0207669_10119558
636 Ga0207704_10079162
637 Ga0207704_10364130
638 Ga0207704_10472040
639 Ga0207711_10877202
640 Ga0207689_10117608
641 Ga0207689_10516107
642 Ga0207667_10591696
643 Ga0207712_10005502
644 Ga0207712_10498114
645 Ga0207668_10100747
646 Ga0207668_10655172
647 Ga0207640_10298433
648 Ga0207640_10326375
649 Ga0207640_11432630
650 Ga0207658_10074097
651 Ga0207677_10100933
652 Ga0207677_10451859
653 Ga0207703_10640101
654 Ga0207703_12354463
655 Ga0207639_10799820
656 Ga0207678_10047613
657 Ga0207678_10052180
658 Ga0207678_11235696
659 Ga0207708_10019771
660 Ga0207708_10117701
661 Ga0207702_10894495
662 Ga0207702_10983127
663 Ga0207641_10390238
664 Ga0207641_10711815
665 Ga0207648_10044511
666 Ga0207648_10608619
667 Ga0207675_100255320
668 Ga0207675_101319023
669 Ga0207683_10027287
670 Ga0207428_10121031
671 Ga0207428_10420649
672 Ga0268266_11204723
673 Ga0268264_10007701
674 Ga0307408_100001509
675 Ga0307405_11183318
676 Ga0307405_11758528
677 Ga0307413_10088291
678 Ga0307518_10000268
679 Ga0307410_10330074
680 Ga0307406_10012948
681 Ga0307406_10473625
682 Ga0307407_10838944
683 Ga0307409_100770643
684 Ga0307416_102230340
685 Ga0307411_10180976
686 Ga0307411_11347720
687 Ga0373937_0063325
688 Ga0395905_0063106
689 Ga0436364_1126622
690 Ga0436365_0179688
691 Ga0436365_0956387
692 Ga0436365_1818184
693 Ga0436361_0998960
694 Ga0436362_0930043
695 Ga0451807_0013773
696 Ga0451807_1284140
697 Ga0451837_0808992
698 Ga0451839_1393908
699 Ga0451853_3551483
700 Ga0439460_0051202
701 Ga0466965_0170616
702 Ga0466963_0969645
703 Ga0466964_0493926
704 Ga0453684_0777448
705 Ga0466970_0307599
706 Ga0466960_0594783
707 Ga0466967_0412709
708 Ga0495603_0101101
709 Ga0495580_0068895
710 Ga0495580_0243253
711 Ga0495582_0022040
712 Ga0495582_0024741
713 Ga0495639_0042356
714 Ga0495664_0037561
715 Ga0495594_0020543
716 Ga0495618_0041776
717 Ga0495628_0085331
718 Ga0495630_0039009
719 Ga0495666_0008247
720 Ga0495640_0060031
721 Ga0495621_0429020
722 Ga0495622_0111935
723 Ga0495634_0016572
724 Ga0495647_0015542
725 Ga0495647_0208464
726 Ga0495658_0003552
727 Ga0495658_0026053
728 Ga0495613_0113983
729 Ga0495624_0774380
730 Ga0495600_0226378
731 Ga0495581_0622362
732 Ga0495674_0045889
733 Ga0495672_0001295
734 Ga0495676_0198869
735 Ga0495680_0025313
736 Ga0495684_0081004
737 Ga0496101_0034620
738 Ga0496101_1056802
739 Ga0496102_0008851
740 Ga0496102_0022883
741 Ga0496104_0054124
742 Ga0496105_0470881
743 Ga0496106_0000080
744 Ga0496106_0005624
745 Ga0496107_0001928
746 Ga0496107_0011011
747 Ga0496108_0032033
748 Ga0496110_0163386
749 Ga0496112_0157084
750 Ga0496114_0008209
751 Ga0496114_0738783
752 Ga0501031_0029620
753 Ga0501033_0128416
754 Ga0501034_0600102
755 Ga0501036_0049173
756 Ga0501038_0572096
757 Ga0501039_0018975
758 Ga0501041_0101171
759 Ga0501041_0109987
760 Ga0501042_0194965
761 Ga0501043_0191471
762 Ga0501043_0505407
763 Ga0501043_0860879
764 Ga0501046_0000055
765 Ga0501046_0511857
766 Ga0501047_0005669
767 Ga0501047_0185219
768 Ga0501048_0008411
769 Ga0501067_0090794
770 Ga0501068_0691648
771 Ga0501070_0303007
772 Ga0501072_0023766
773 Ga0501072_0359473
774 Ga0501072_1073671
775 Ga0501073_0637691
776 Ga0501074_0074015
777 Ga0501074_0278170
778 Ga0501074_1195875
779 Ga0501075_0193214
780 Ga0501076_0023341
781 Ga0501076_0240002
782 Ga0501217_073024
783 Ga0501227_007998
784 Ga0501233_016320
785 Ga0501225_0010934
786 Ga0501079_0005189
787 Ga0501079_0531761
788 Ga0501080_0198990
789 Ga0501080_0233738
790 Ga0501081_0102773
791 Ga0501083_0000281
792 Ga0501035_0104973
793 Ga0501035_0116879
794 Ga0501044_0040318
795 Ga0501044_0185184
796 Ga0501044_1280569
797 Ga0501045_0116725
798 nmdc:mga03n38_714925_c1
799 nmdc:mga00v17_311427_c1
800 nmdc:mga00v17_55553_c2
801 nmdc:mga0yw44_289959_c1
802 nmdc:mga06z11_204572_c1
803 nmdc:mga05p37_383631_c1
804 nmdc:mga05p37_615499_c1
805 nmdc:mga0qj67_345262_c1
806 nmdc:mga0qj67_53827_c1
807 nmdc:mga0qj67_78305_c1
808 nmdc:mga06r32_696142_c1
809 nmdc:mga06r32_91278_c1
810 nmdc:mga08y16_150094_c1
811 nmdc:mga08y16_26410_c1
812 nmdc:mga08y16_538974_c1
813 nmdc:mga08y16_663903_c1
814 nmdc:mga0n895_1799480_c1
815 nmdc:mga0n895_20252_c1
816 nmdc:mga0n895_77661_c1
817 nmdc:mga0rr50_28138_c1
818 nmdc:mga08x19_313148_c1
819 nmdc:mga08x19_566523_c1
820 nmdc:mga08x19_895321_c1
821 Ga0495619_0120833
822 Ga0500556_0000032
823 Ga0501082_0192354
824 Ga0501082_0354042
825 2586065021
826 2809593423
827 2915769429
828 2928966205

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03795

YCII

YCII-related domain

31

146

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
1s7i-assembly1.cif.gz_A-2 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa 0.7807 1 115
1s7i-assembly1.cif.gz_A-2 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa 0.7252 1 115
1mwq-assembly1.cif.gz_A structure of hi0828, a hypothetical protein from haemophilus influenzae with a putative active-site phosphohistidine 0.6933 1 116
1mwq-assembly1.cif.gz_A structure of hi0828, a hypothetical protein from haemophilus influenzae with a putative active-site phosphohistidine 0.6693 1 116
3pht-assembly1.cif.gz_B-2 crystal structure of h74a mutant of helicobacter pylori nikr 0.6589 2 113
ID Description Score Start End Superfamily
1s7iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7807 1 115 3.30.70.1060
1s7iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7252 1 115 3.30.70.1060
af_O07243_1_96_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7099 1 115 3.30.70.1060
af_P0AB55_1_98_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.6727 1 116 3.30.70.1060
af_P0AB55_1_98_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.6609 1 116 3.30.70.1060
ID Description Score Start End GO Terms
AF-A0A3M8ST25-F1-model_v4 YciI family protein 0.9947 1 139
AF-A0A1L6LXU1-F1-model_v4 deleted 0.9932 1 139
AF-A0A7G9NYV5-F1-model_v4 YciI family protein 0.9919 1 139
AF-B1H6M3-F1-model_v4 deleted 0.9906 1 139
AF-A0A7X5U7D6-F1-model_v4 YciI family protein 0.9896 1 139

Map