F438375

General Info

Members Datasets Scaffolds Average Seq Length
414 176 828 210

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_0011540|Ga0395900_0011540_1818_2585
Length 246
Sequence VDDARPITVLIADDHPLILSGLAALIRAEPDLALVGEASDAVAAVEHYLRLRPDVMLVDLNMPGGGGVEAIRKIRALVPDARIAILTTYDGDEDVHRGLLAGASAYLLKQSGLDEVLQCVRQVAANRRYLAPGLAEKLAGRVDANRLSRRELEILAHLSAGMSNKMIARTENIGVGTVKYHVNNILSKLNVSCRTEAACVAARRGLIREIRGRNSEHKKANSCSDPGSAFGCGSAGSGPLRCNPPL

Samples

Sample ID Description Type Environment
1 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
28 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
29 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
31 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
32 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
33 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
36 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
37 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
38 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
42 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
43 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
44 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
45 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
46 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
47 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
73 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
74 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
75 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
76 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
77 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
78 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
79 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
80 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
81 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
82 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
83 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
84 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
85 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
86 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
87 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
88 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
89 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
90 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
91 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
92 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
93 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
94 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
95 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
96 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
97 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
98 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
99 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
100 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
101 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
102 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
103 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
104 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
105 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
106 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
107 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
108 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
109 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
110 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
111 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
112 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
113 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
114 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
115 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
116 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
117 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
118 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
119 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
120 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
121 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
122 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
123 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
124 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
125 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
126 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
127 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
128 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
129 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
130 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
131 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
132 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
133 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
134 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
135 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
136 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
137 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
138 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
139 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
140 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
141 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
142 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
143 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
144 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
145 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
146 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
147 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
148 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
149 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
150 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
151 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
152 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
153 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
154 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
155 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
156 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
157 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
158 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
159 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
160 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
161 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
162 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
163 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
171 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
172 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
173 2643221556 Massilia sp. Root1485 Isolate Unclassified
174 2643221684 Massilia sp. Root133 Isolate Unclassified
175 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
176 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.03
Metatranscriptomes 0
Isolates 0.97

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.97
Nodule 0
Rhizoplane 2.66
Rhizosphere 92.75
Stem 0
Stem Tuber 0
Unclassified 4.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395900_0011540 3300037418 Bacteria 9042
2 rootH2_10041950 3300003320 Bacteria 13442
3 rootH2_10176118 3300003320 Unclassified 2659
4 rootL2_10046749 3300003322 Bacteria 9251
5 rootL2_10110879 3300003322 Bacteria 4035
6 Ga0055525_1000008 3300003759 Bacteria 604287
7 Ga0070658_10050875 3300005327 Bacteria 3358
8 Ga0070658_10074054 3300005327 Bacteria 2793
9 Ga0070658_10078895 3300005327 Bacteria 2703
10 Ga0070680_100311228 3300005336 Bacteria 1336
11 Ga0070680_100702535 3300005336 Bacteria 870
12 Ga0070660_100045627 3300005339 Bacteria 3356
13 Ga0070660_100129861 3300005339 Bacteria 2016
14 Ga0070661_100232743 3300005344 Bacteria 1416
15 Ga0070661_100380545 3300005344 Bacteria 1112
16 Ga0070659_100016260 3300005366 Bacteria 5584
17 Ga0070659_100035282 3300005366 Bacteria 3894
18 Ga0070714_100007765 3300005435 Bacteria 8356
19 Ga0070714_100157057 3300005435 Bacteria 2054
20 Ga0070710_10113721 3300005437 Bacteria 1629
21 Ga0070711_100000096 3300005439 Bacteria 46808
22 Ga0070711_100026662 3300005439 Bacteria 3788
23 Ga0070662_100380829 3300005457 Bacteria 1161
24 Ga0070681_10261809 3300005458 Unclassified 1641
25 Ga0070698_100495649 3300005471 Bacteria 1159
26 Ga0070679_100136016 3300005530 Bacteria 2438
27 Ga0070679_100248912 3300005530 Unclassified 1734
28 Ga0070684_100678959 3300005535 Bacteria 960
29 Ga0070697_100577644 3300005536 Unclassified 987
30 Ga0068853_100219187 3300005539 Unclassified 1737
31 Ga0070665_100123980 3300005548 Bacteria 2586
32 Ga0068855_100007665 3300005563 Bacteria 13051
33 Ga0068855_100047472 3300005563 Bacteria 5073
34 Ga0068855_100136666 3300005563 Bacteria 2796
35 Ga0068855_100383561 3300005563 Bacteria 1543
36 Ga0070664_100059975 3300005564 Bacteria 3238
37 Ga0068856_100435689 3300005614 Bacteria 1331
38 Ga0070702_100179189 3300005615 Unclassified 1385
39 Ga0068852_100505715 3300005616 Bacteria 1204
40 Ga0068864_100105821 3300005618 Bacteria 2501
41 Ga0068864_100703162 3300005618 Bacteria 988
42 Ga0070716_100592341 3300006173 Bacteria 833
43 Ga0070712_100080160 3300006175 Bacteria 2362
44 Ga0097621_100189608 3300006237 Bacteria 1780
45 Ga0075430_100362801 3300006846 Bacteria 1196
46 Ga0075434_100743081 3300006871 Unclassified 998
47 Ga0068865_100946218 3300006881 Bacteria 751
48 Ga0099794_10002673 3300007265 Bacteria 6638
49 Ga0105240_10043852 3300009093 Bacteria 5688
50 Ga0105240_10073963 3300009093 Unclassified 4208
51 Ga0105245_10000070 3300009098 Bacteria 106666
52 Ga0105245_10326612 3300009098 Bacteria 1513
53 Ga0105245_10441279 3300009098 Bacteria 1308
54 Ga0105243_10027978 3300009148 Bacteria 4325
55 Ga0105241_10827939 3300009174 Bacteria 854
56 Ga0105242_10015280 3300009176 Bacteria 5962
57 Ga0105242_10015764 3300009176 Bacteria 5871
58 Ga0105248_10453106 3300009177 Unclassified 1446
59 Ga0105239_10473493 3300010375 Bacteria 1422
60 Ga0105239_11912279 3300010375 Bacteria 688
61 Ga0157370_10034684 3300013104 Bacteria 4910
62 Ga0157370_10139318 3300013104 Bacteria 2260
63 Ga0157374_10441745 3300013296 Bacteria 1301
64 Ga0157374_10451059 3300013296 Bacteria 1287
65 Ga0157374_10865827 3300013296 Bacteria 921
66 Ga0157378_10031253 3300013297 Unclassified 4703
67 Ga0157372_10247034 3300013307 Bacteria 2071
68 Ga0157372_10381366 3300013307 Bacteria 1643
69 Ga0163163_10019147 3300014325 Bacteria 6424
70 Ga0157376_10464049 3300014969 Bacteria 1238
71 Ga0209563_100003 3300025230 Bacteria 1932942
72 Ga0209677_104266 3300025253 Bacteria 4210
73 Ga0209148_1001268 3300025254 Bacteria 13871
74 Ga0207680_10269086 3300025903 Unclassified 1181
75 Ga0207705_10001848 3300025909 Bacteria 16642
76 Ga0207705_10143600 3300025909 Bacteria 1784
77 Ga0207705_10219386 3300025909 Bacteria 1444
78 Ga0207707_10767647 3300025912 Unclassified 805
79 Ga0207695_10067193 3300025913 Bacteria 3678
80 Ga0207695_10156504 3300025913 Bacteria 2213
81 Ga0207693_10118592 3300025915 Viruses 2078
82 Ga0207663_10000076 3300025916 Bacteria 46935
83 Ga0207663_10056846 3300025916 Bacteria 2463
84 Ga0207657_10006299 3300025919 Bacteria 12329
85 Ga0207657_10036479 3300025919 Bacteria 4400
86 Ga0207657_10072155 3300025919 Bacteria 2921
87 Ga0207649_10092974 3300025920 Bacteria 1978
88 Ga0207649_10148169 3300025920 Bacteria 1613
89 Ga0207694_10076454 3300025924 Bacteria 2622
90 Ga0207687_10000279 3300025927 Bacteria 35014
91 Ga0207664_10020572 3300025929 Bacteria 4894
92 Ga0207706_10079014 3300025933 Bacteria 2893
93 Ga0207706_10203354 3300025933 Bacteria 1737
94 Ga0207704_10092255 3300025938 Bacteria 1993
95 Ga0207711_10803209 3300025941 Bacteria 876
96 Ga0207667_10008551 3300025949 Bacteria 12146
97 Ga0207667_10040836 3300025949 Bacteria 4937
98 Ga0207667_10106681 3300025949 Unclassified 2889
99 Ga0207667_10304739 3300025949 Bacteria 1628
100 Ga0207667_10502449 3300025949 Bacteria 1230
101 Ga0207640_10952348 3300025981 Bacteria 753
102 Ga0207702_10217934 3300026078 Bacteria 1777
103 Ga0207648_10232149 3300026089 Bacteria 1641
104 Ga0207676_10042655 3300026095 Bacteria 3490
105 Ga0207676_10224523 3300026095 Bacteria 1675
106 Ga0207674_10609178 3300026116 Bacteria 1055
107 Ga0207698_10257607 3300026142 Bacteria 1601
108 Ga0209588_1019985 3300027671 Bacteria 2095
109 Ga0265338_10017894 3300028800 Bacteria 7613
110 Ga0373931_0234814 3300035691 Bacteria 1109
111 Ga0373937_0838339 3300036401 Unclassified 868
112 Ga0395899_0001640 3300037312 Bacteria 18679
113 Ga0395899_0002798 3300037312 Bacteria 14055
114 Ga0395899_0010152 3300037312 Bacteria 7220
115 Ga0395899_0068459 3300037312 Bacteria 2602
116 Ga0395899_0088498 3300037312 Bacteria 2246
117 Ga0395899_0106707 3300037312 Bacteria 2016
118 Ga0395899_0154522 3300037312 Bacteria 1624
119 Ga0395899_0439526 3300037312 Bacteria 856
120 Ga0395900_0000065 3300037418 Bacteria 196327
121 Ga0395900_0004717 3300037418 Bacteria 14376
122 Ga0395900_0014230 3300037418 Bacteria 8121
123 Ga0395900_0064366 3300037418 Bacteria 3768
124 Ga0395900_0064443 3300037418 Bacteria 3765
125 Ga0395900_0064656 3300037418 Bacteria 3758
126 Ga0395900_0179146 3300037418 Bacteria 2154
127 Ga0395900_0247137 3300037418 Bacteria 1787
128 Ga0395900_0541741 3300037418 Bacteria 1109
129 Ga0395898_0002040 3300037466 Bacteria 25291
130 Ga0395898_0090125 3300037466 Bacteria 2951
131 Ga0395898_1152549 3300037466 Bacteria 707
132 Ga0395905_0007498 3300037471 Bacteria 10855
133 Ga0395905_0083766 3300037471 Bacteria 2987
134 Ga0395905_0117509 3300037471 Bacteria 2499
135 Ga0395905_0250681 3300037471 Unclassified 1654
136 Ga0395905_0285041 3300037471 Bacteria 1538
137 Ga0395905_0294898 3300037471 Bacteria 1508
138 Ga0395905_0423051 3300037471 Bacteria 1228
139 Ga0395905_0566687 3300037471 Bacteria 1037
140 Ga0395901_0000114 3300038443 Bacteria 109241
141 Ga0395901_0007719 3300038443 Bacteria 10851
142 Ga0395901_0133912 3300038443 Bacteria 2604
143 Ga0395901_0240925 3300038443 Bacteria 1886
144 Ga0395901_0318572 3300038443 Bacteria 1609
145 Ga0395901_0342391 3300038443 Bacteria 1544
146 Ga0395901_0605421 3300038443 Bacteria 1104
147 Ga0395901_0678447 3300038443 Bacteria 1030
148 Ga0436361_0775667 3300039447 Bacteria 1552
149 Ga0466969_0006196 3300044656 Bacteria 6366
150 Ga0466969_0030421 3300044656 Bacteria 2752
151 Ga0466969_0036410 3300044656 Bacteria 2486
152 Ga0466969_0079895 3300044656 Bacteria 1562
153 Ga0466965_0005871 3300044683 Bacteria 5542
154 Ga0466965_0042889 3300044683 Bacteria 2232
155 Ga0466965_0084559 3300044683 Bacteria 1607
156 Ga0466966_0020521 3300044684 Bacteria 4343
157 Ga0466966_0035109 3300044684 Bacteria 3241
158 Ga0466966_0054894 3300044684 Bacteria 2523
159 Ga0466966_0154331 3300044684 Bacteria 1399
160 Ga0466961_0087502 3300044693 Bacteria 1968
161 Ga0466961_0088441 3300044693 Bacteria 1957
162 Ga0466963_0043584 3300044694 Bacteria 2951
163 Ga0466963_0233670 3300044694 Bacteria 1289
164 Ga0466964_0002657 3300044706 Bacteria 6402
165 Ga0466964_0017191 3300044706 Bacteria 2768
166 Ga0466968_0027154 3300044735 Bacteria 2354
167 Ga0466970_0242316 3300044765 Bacteria 1009
168 Ga0466957_0078079 3300044842 Bacteria 2058
169 Ga0466957_0230658 3300044842 Bacteria 1225
170 Ga0466959_0260978 3300045049 Bacteria 1192
171 Ga0451576_0363869 3300045051 Bacteria 1515
172 Ga0466958_0185063 3300045836 Bacteria 1322
173 Ga0466958_0194385 3300045836 Bacteria 1290
174 Ga0466967_0012865 3300045976 Bacteria 6431
175 Ga0495617_001367 3300046452 Bacteria 10797
176 Ga0495617_002927 3300046452 Bacteria 6549
177 Ga0495590_0000057 3300046457 Bacteria 93720
178 Ga0495590_0000741 3300046457 Bacteria 14835
179 Ga0495590_0002911 3300046457 Bacteria 7047
180 Ga0495590_0183207 3300046457 Bacteria 766
181 Ga0495591_000282 3300046458 Bacteria 47410
182 Ga0495638_0009859 3300046460 Bacteria 6665
183 Ga0495638_0094168 3300046460 Bacteria 1800
184 Ga0495650_0000185 3300046471 Bacteria 136913
185 Ga0495650_0000552 3300046471 Bacteria 53435
186 Ga0495650_0013382 3300046471 Bacteria 4341
187 Ga0495650_0119104 3300046471 Bacteria 973
188 Ga0495580_0472466 3300046472 Bacteria 839
189 Ga0495605_0000262 3300046474 Bacteria 61506
190 Ga0495605_0000395 3300046474 Bacteria 40225
191 Ga0495605_0004271 3300046474 Bacteria 8421
192 Ga0495605_0007143 3300046474 Bacteria 6355
193 Ga0495605_0009228 3300046474 Bacteria 5543
194 Ga0495605_0013659 3300046474 Bacteria 4466
195 Ga0495605_0017807 3300046474 Bacteria 3818
196 Ga0495605_0023868 3300046474 Bacteria 3210
197 Ga0495584_0000051 3300046491 Bacteria 87120
198 Ga0495584_0000170 3300046491 Bacteria 45748
199 Ga0495584_0000818 3300046491 Bacteria 20459
200 Ga0495584_0011122 3300046491 Bacteria 4613
201 Ga0495584_0027725 3300046491 Bacteria 2870
202 Ga0495584_0078509 3300046491 Bacteria 1661
203 Ga0495585_0002355 3300046492 Bacteria 13564
204 Ga0495585_0009714 3300046492 Bacteria 5758
205 Ga0495585_0058449 3300046492 Bacteria 2127
206 Ga0495585_0294178 3300046492 Bacteria 800
207 Ga0495596_0036234 3300046500 Bacteria 1954
208 Ga0495607_0000277 3300046501 Bacteria 55227
209 Ga0495607_0000488 3300046501 Bacteria 39688
210 Ga0495607_0001060 3300046501 Bacteria 25096
211 Ga0495607_0002084 3300046501 Bacteria 16714
212 Ga0495607_0004738 3300046501 Bacteria 9942
213 Ga0495607_0005122 3300046501 Bacteria 9476
214 Ga0495607_0031007 3300046501 Bacteria 3275
215 Ga0495583_0000108 3300046506 Bacteria 139791
216 Ga0495583_0000423 3300046506 Bacteria 63964
217 Ga0495583_0000587 3300046506 Bacteria 49879
218 Ga0495583_0000970 3300046506 Bacteria 33033
219 Ga0495583_0030611 3300046506 Bacteria 2618
220 Ga0495606_0000129 3300046507 Bacteria 127929
221 Ga0495606_0025425 3300046507 Bacteria 4240
222 Ga0495606_0044002 3300046507 Bacteria 2972
223 Ga0495606_0203843 3300046507 Bacteria 1125
224 Ga0495610_0000122 3300046512 Bacteria 88171
225 Ga0495616_0001253 3300046513 Bacteria 17855
226 Ga0495616_0002047 3300046513 Bacteria 13549
227 Ga0495616_0012816 3300046513 Bacteria 4744
228 Ga0495616_0024997 3300046513 Bacteria 3196
229 Ga0495616_0040674 3300046513 Bacteria 2373
230 Ga0495616_0046965 3300046513 Bacteria 2177
231 Ga0495618_0247110 3300046514 Unclassified 1120
232 Ga0495628_0425501 3300046516 Bacteria 967
233 Ga0495630_0481038 3300046517 Unclassified 952
234 Ga0495631_0001003 3300046518 Bacteria 17526
235 Ga0495631_0003361 3300046518 Bacteria 8774
236 Ga0495631_0077448 3300046518 Bacteria 1435
237 Ga0495632_0000052 3300046519 Bacteria 132992
238 Ga0495632_0002449 3300046519 Bacteria 14118
239 Ga0495632_0002898 3300046519 Bacteria 12609
240 Ga0495632_0029518 3300046519 Bacteria 2854
241 Ga0495637_0000018 3300046520 Bacteria 186671
242 Ga0495637_0026142 3300046520 Bacteria 2625
243 Ga0495637_0112613 3300046520 Bacteria 1053
244 Ga0495643_0000044 3300046522 Bacteria 226211
245 Ga0495643_0002869 3300046522 Bacteria 13096
246 Ga0495643_0004461 3300046522 Bacteria 9777
247 Ga0495643_0009305 3300046522 Bacteria 6117
248 Ga0495643_0025395 3300046522 Bacteria 3352
249 Ga0495643_0085074 3300046522 Bacteria 1640
250 Ga0495643_0183301 3300046522 Bacteria 1016
251 Ga0495644_0000126 3300046523 Bacteria 36677
252 Ga0495644_0023707 3300046523 Bacteria 2335
253 Ga0495648_0000329 3300046524 Bacteria 52302
254 Ga0495648_0000445 3300046524 Bacteria 44691
255 Ga0495648_0001852 3300046524 Bacteria 20282
256 Ga0495648_0018389 3300046524 Bacteria 4948
257 Ga0495648_0021296 3300046524 Bacteria 4493
258 Ga0495648_0059632 3300046524 Bacteria 2275
259 Ga0495648_0205771 3300046524 Bacteria 981
260 Ga0495648_0224491 3300046524 Bacteria 924
261 Ga0495642_0000660 3300046528 Bacteria 17260
262 Ga0495642_0033423 3300046528 Bacteria 2067
263 Ga0495654_0140823 3300046530 Bacteria 1075
264 Ga0495609_0000001 3300046538 Bacteria 1060094
265 Ga0495609_0000320 3300046538 Bacteria 42940
266 Ga0495609_0000825 3300046538 Bacteria 23058
267 Ga0495609_0000897 3300046538 Bacteria 21719
268 Ga0495609_0007721 3300046538 Bacteria 5334
269 Ga0495609_0022645 3300046538 Bacteria 2894
270 Ga0495597_0000216 3300046542 Bacteria 52708
271 Ga0495645_0106103 3300046543 Bacteria 1992
272 Ga0495645_0281036 3300046543 Bacteria 1094
273 Ga0495622_0005088 3300046557 Bacteria 6092
274 Ga0495633_0001328 3300046558 Bacteria 19400
275 Ga0495633_0017167 3300046558 Bacteria 3709
276 Ga0495656_0000720 3300046615 Bacteria 10685
277 Ga0495656_0012787 3300046615 Bacteria 3107
278 Ga0495656_0028884 3300046615 Bacteria 2228
279 Ga0495611_0000399 3300046648 Bacteria 27353
280 Ga0495611_0002330 3300046648 Bacteria 8785
281 Ga0495611_0004002 3300046648 Bacteria 6414
282 Ga0495611_0005035 3300046648 Bacteria 5662
283 Ga0495625_0033474 3300046660 Bacteria 3800
284 Ga0495625_0121386 3300046660 Bacteria 1778
285 Ga0495659_0000256 3300046664 Bacteria 21808
286 Ga0495659_0138886 3300046664 Bacteria 968
287 Ga0495659_0228302 3300046664 Bacteria 770
288 Ga0495661_0000063 3300046665 Bacteria 129706
289 Ga0495661_0000369 3300046665 Bacteria 48821
290 Ga0495661_0000518 3300046665 Bacteria 40036
291 Ga0495661_0000944 3300046665 Bacteria 26379
292 Ga0495661_0039557 3300046665 Bacteria 2930
293 Ga0495661_0083899 3300046665 Bacteria 1830
294 Ga0495661_0086096 3300046665 Bacteria 1799
295 Ga0495588_0000052 3300046674 Bacteria 304493
296 Ga0495588_0093271 3300046674 Bacteria 1578
297 Ga0495669_0008754 3300046684 Bacteria 4261
298 Ga0495670_0000521 3300046691 Bacteria 18192
299 Ga0495671_0000555 3300046692 Bacteria 27972
300 Ga0495671_0059525 3300046692 Bacteria 1887
301 Ga0495649_0000441 3300046694 Bacteria 35837
302 Ga0495649_0046409 3300046694 Bacteria 2365
303 Ga0495589_0000015 3300046794 Bacteria 224112
304 Ga0495589_0000116 3300046794 Bacteria 75640
305 Ga0495589_0002579 3300046794 Bacteria 10075
306 Ga0495589_0107424 3300046794 Bacteria 1348
307 Ga0495660_0000145 3300046810 Bacteria 76912
308 Ga0495660_0000334 3300046810 Bacteria 41635
309 Ga0495660_0004007 3300046810 Bacteria 8991
310 Ga0495660_0007234 3300046810 Bacteria 6534
311 Ga0495660_0035402 3300046810 Bacteria 2789
312 Ga0495660_0050643 3300046810 Bacteria 2261
313 Ga0495660_0065883 3300046810 Bacteria 1932
314 Ga0495636_0000114 3300047318 Bacteria 33464
315 Ga0495636_0000895 3300047318 Bacteria 11046
316 Ga0495636_0120156 3300047318 Bacteria 1162
317 Ga0495672_0000064 3300047320 Bacteria 195158
318 Ga0495672_0003463 3300047320 Bacteria 13491
319 Ga0495672_0033561 3300047320 Bacteria 3178
320 Ga0495672_0048862 3300047320 Bacteria 2507
321 Ga0495672_0109369 3300047320 Bacteria 1485
322 Ga0495672_0129689 3300047320 Bacteria 1328
323 Ga0495683_0000225 3300047323 Bacteria 53019
324 Ga0495683_0000649 3300047323 Bacteria 25796
325 Ga0495683_0001565 3300047323 Bacteria 14818
326 Ga0495683_0039878 3300047323 Bacteria 2373
327 Ga0495683_0045577 3300047323 Bacteria 2203
328 Ga0495683_0047734 3300047323 Bacteria 2148
329 Ga0495687_000003 3300047443 Bacteria 859509
330 Ga0495687_000073 3300047443 Bacteria 155429
331 Ga0495687_000459 3300047443 Bacteria 49803
332 Ga0495687_000560 3300047443 Bacteria 43857
333 Ga0495687_000891 3300047443 Bacteria 31449
334 Ga0495687_000925 3300047443 Bacteria 30492
335 Ga0495687_001022 3300047443 Bacteria 27907
336 Ga0495677_0000001 3300047445 Bacteria 715000
337 Ga0495677_0000215 3300047445 Bacteria 26322
338 Ga0495677_0001000 3300047445 Bacteria 11382
339 Ga0495677_0002299 3300047445 Bacteria 7532
340 Ga0495677_0005827 3300047445 Unclassified 4663
341 Ga0495677_0007476 3300047445 Bacteria 4080
342 Ga0495677_0018184 3300047445 Bacteria 2547
343 Ga0495677_0096396 3300047445 Bacteria 1117
344 Ga0495679_016648 3300047446 Bacteria 2654
345 Ga0495679_027961 3300047446 Bacteria 1854
346 Ga0495679_115423 3300047446 Bacteria 737
347 Ga0495685_000158 3300047447 Bacteria 23008
348 Ga0495685_001448 3300047447 Bacteria 7269
349 Ga0495685_016855 3300047447 Bacteria 2496
350 Ga0495673_0008731 3300047469 Bacteria 5664
351 Ga0495673_0010731 3300047469 Bacteria 4964
352 Ga0495681_0012865 3300047470 Bacteria 4893
353 Ga0495686_0000620 3300047472 Bacteria 48981
354 Ga0495686_0000760 3300047472 Bacteria 42551
355 Ga0495686_0041569 3300047472 Bacteria 2926
356 Ga0495614_0241186 3300048089 Bacteria 825
357 Ga0495626_0000017 3300048091 Bacteria 231648
358 Ga0495626_0000128 3300048091 Bacteria 96772
359 Ga0495626_0000171 3300048091 Bacteria 80200
360 Ga0495626_0000353 3300048091 Bacteria 47964
361 Ga0495626_0012639 3300048091 Bacteria 4416
362 Ga0495626_0020814 3300048091 Bacteria 3263
363 Ga0496100_0124351 3300048903 Bacteria 1809
364 Ga0496101_0038577 3300048904 Bacteria 3393
365 Ga0496104_0062458 3300048907 Bacteria 3532
366 Ga0496107_0089741 3300048910 Bacteria 2245
367 Ga0496111_0222646 3300048914 Bacteria 1402
368 Ga0496113_0109595 3300048916 Bacteria 2147
369 Ga0496114_0185287 3300048917 Bacteria 1819
370 Ga0496114_0271997 3300048917 Bacteria 1493
371 Ga0496115_0015602 3300048918 Bacteria 5768
372 Ga0496115_0122240 3300048918 Bacteria 2143
373 Ga0496115_0610415 3300048918 Bacteria 866
374 Ga0496121_0132912 3300048924 Bacteria 1859
375 Ga0496122_0006346 3300048925 Bacteria 13604
376 Ga0496122_0007723 3300048925 Bacteria 11839
377 Ga0496123_0001975 3300048926 Bacteria 26577
378 Ga0496123_0118002 3300048926 Bacteria 1499
379 Ga0496124_0032157 3300048927 Bacteria 4638
380 Ga0496124_0095020 3300048927 Bacteria 2423
381 Ga0496124_0349164 3300048927 Bacteria 1047
382 Ga0496125_0036628 3300048928 Bacteria 4279
383 Ga0495678_000034 3300049459 Bacteria 207827
384 Ga0495678_000041 3300049459 Bacteria 185715
385 Ga0495678_000930 3300049459 Bacteria 25579
386 Ga0495678_002141 3300049459 Bacteria 13946
387 Ga0495678_051951 3300049459 Bacteria 1581
388 Ga0495678_061889 3300049459 Bacteria 1402
389 Ga0495678_070297 3300049459 Bacteria 1285
390 Ga0495678_071466 3300049459 Bacteria 1271
391 Ga0495682_0000013 3300049460 Bacteria 259670
392 Ga0495682_0000016 3300049460 Bacteria 233668
393 Ga0495682_0001108 3300049460 Bacteria 15688
394 Ga0495682_0029197 3300049460 Bacteria 2042
395 Ga0495682_0031325 3300049460 Bacteria 1965
396 Ga0495682_0033382 3300049460 Bacteria 1899
397 Ga0495682_0199837 3300049460 Unclassified 709
398 Ga0501031_0127105 3300049568 Bacteria 1665
399 Ga0501033_0036502 3300049570 Bacteria 3683
400 Ga0501034_0124363 3300049571 Bacteria 2565
401 Ga0501037_0066193 3300049573 Bacteria 2633
402 Ga0501043_0045243 3300049579 Bacteria 3462
403 Ga0501047_0335559 3300049581 Bacteria 1350
404 Ga0501047_0444464 3300049581 Bacteria 1126
405 Ga0501035_0001329 3300049822 Bacteria 25521
406 Ga0501035_0078527 3300049822 Bacteria 2915
407 Ga0501044_0012724 3300049823 Bacteria 9113
408 Ga0501044_0073392 3300049823 Bacteria 3478
409 nmdc:mga0qj67_80555_c1 3300050509 Bacteria 2609
410 nmdc:mga08x19_238439_c1 3300050514 Bacteria 1253
411 2643797314 2643221556 Bacteria 7251154
412 2644474144 2643221684 Bacteria 7145183
413 2809145585 2808606418 Bacteria 6724496
414 8047675021 8047673197 Bacteria 7395230
415 Ga0395900_0011540
416 rootH2_10041950
417 rootH2_10176118
418 rootL2_10046749
419 rootL2_10110879
420 Ga0055525_1000008
421 Ga0070658_10050875
422 Ga0070658_10074054
423 Ga0070658_10078895
424 Ga0070680_100311228
425 Ga0070680_100702535
426 Ga0070660_100045627
427 Ga0070660_100129861
428 Ga0070661_100232743
429 Ga0070661_100380545
430 Ga0070659_100016260
431 Ga0070659_100035282
432 Ga0070714_100007765
433 Ga0070714_100157057
434 Ga0070710_10113721
435 Ga0070711_100000096
436 Ga0070711_100026662
437 Ga0070662_100380829
438 Ga0070681_10261809
439 Ga0070698_100495649
440 Ga0070679_100136016
441 Ga0070679_100248912
442 Ga0070684_100678959
443 Ga0070697_100577644
444 Ga0068853_100219187
445 Ga0070665_100123980
446 Ga0068855_100007665
447 Ga0068855_100047472
448 Ga0068855_100136666
449 Ga0068855_100383561
450 Ga0070664_100059975
451 Ga0068856_100435689
452 Ga0070702_100179189
453 Ga0068852_100505715
454 Ga0068864_100105821
455 Ga0068864_100703162
456 Ga0070716_100592341
457 Ga0070712_100080160
458 Ga0097621_100189608
459 Ga0075430_100362801
460 Ga0075434_100743081
461 Ga0068865_100946218
462 Ga0099794_10002673
463 Ga0105240_10043852
464 Ga0105240_10073963
465 Ga0105245_10000070
466 Ga0105245_10326612
467 Ga0105245_10441279
468 Ga0105243_10027978
469 Ga0105241_10827939
470 Ga0105242_10015280
471 Ga0105242_10015764
472 Ga0105248_10453106
473 Ga0105239_10473493
474 Ga0105239_11912279
475 Ga0157370_10034684
476 Ga0157370_10139318
477 Ga0157374_10441745
478 Ga0157374_10451059
479 Ga0157374_10865827
480 Ga0157378_10031253
481 Ga0157372_10247034
482 Ga0157372_10381366
483 Ga0163163_10019147
484 Ga0157376_10464049
485 Ga0209563_100003
486 Ga0209677_104266
487 Ga0209148_1001268
488 Ga0207680_10269086
489 Ga0207705_10001848
490 Ga0207705_10143600
491 Ga0207705_10219386
492 Ga0207707_10767647
493 Ga0207695_10067193
494 Ga0207695_10156504
495 Ga0207693_10118592
496 Ga0207663_10000076
497 Ga0207663_10056846
498 Ga0207657_10006299
499 Ga0207657_10036479
500 Ga0207657_10072155
501 Ga0207649_10092974
502 Ga0207649_10148169
503 Ga0207694_10076454
504 Ga0207687_10000279
505 Ga0207664_10020572
506 Ga0207706_10079014
507 Ga0207706_10203354
508 Ga0207704_10092255
509 Ga0207711_10803209
510 Ga0207667_10008551
511 Ga0207667_10040836
512 Ga0207667_10106681
513 Ga0207667_10304739
514 Ga0207667_10502449
515 Ga0207640_10952348
516 Ga0207702_10217934
517 Ga0207648_10232149
518 Ga0207676_10042655
519 Ga0207676_10224523
520 Ga0207674_10609178
521 Ga0207698_10257607
522 Ga0209588_1019985
523 Ga0265338_10017894
524 Ga0373931_0234814
525 Ga0373937_0838339
526 Ga0395899_0001640
527 Ga0395899_0002798
528 Ga0395899_0010152
529 Ga0395899_0068459
530 Ga0395899_0088498
531 Ga0395899_0106707
532 Ga0395899_0154522
533 Ga0395899_0439526
534 Ga0395900_0000065
535 Ga0395900_0004717
536 Ga0395900_0014230
537 Ga0395900_0064366
538 Ga0395900_0064443
539 Ga0395900_0064656
540 Ga0395900_0179146
541 Ga0395900_0247137
542 Ga0395900_0541741
543 Ga0395898_0002040
544 Ga0395898_0090125
545 Ga0395898_1152549
546 Ga0395905_0007498
547 Ga0395905_0083766
548 Ga0395905_0117509
549 Ga0395905_0250681
550 Ga0395905_0285041
551 Ga0395905_0294898
552 Ga0395905_0423051
553 Ga0395905_0566687
554 Ga0395901_0000114
555 Ga0395901_0007719
556 Ga0395901_0133912
557 Ga0395901_0240925
558 Ga0395901_0318572
559 Ga0395901_0342391
560 Ga0395901_0605421
561 Ga0395901_0678447
562 Ga0436361_0775667
563 Ga0466969_0006196
564 Ga0466969_0030421
565 Ga0466969_0036410
566 Ga0466969_0079895
567 Ga0466965_0005871
568 Ga0466965_0042889
569 Ga0466965_0084559
570 Ga0466966_0020521
571 Ga0466966_0035109
572 Ga0466966_0054894
573 Ga0466966_0154331
574 Ga0466961_0087502
575 Ga0466961_0088441
576 Ga0466963_0043584
577 Ga0466963_0233670
578 Ga0466964_0002657
579 Ga0466964_0017191
580 Ga0466968_0027154
581 Ga0466970_0242316
582 Ga0466957_0078079
583 Ga0466957_0230658
584 Ga0466959_0260978
585 Ga0451576_0363869
586 Ga0466958_0185063
587 Ga0466958_0194385
588 Ga0466967_0012865
589 Ga0495617_001367
590 Ga0495617_002927
591 Ga0495590_0000057
592 Ga0495590_0000741
593 Ga0495590_0002911
594 Ga0495590_0183207
595 Ga0495591_000282
596 Ga0495638_0009859
597 Ga0495638_0094168
598 Ga0495650_0000185
599 Ga0495650_0000552
600 Ga0495650_0013382
601 Ga0495650_0119104
602 Ga0495580_0472466
603 Ga0495605_0000262
604 Ga0495605_0000395
605 Ga0495605_0004271
606 Ga0495605_0007143
607 Ga0495605_0009228
608 Ga0495605_0013659
609 Ga0495605_0017807
610 Ga0495605_0023868
611 Ga0495584_0000051
612 Ga0495584_0000170
613 Ga0495584_0000818
614 Ga0495584_0011122
615 Ga0495584_0027725
616 Ga0495584_0078509
617 Ga0495585_0002355
618 Ga0495585_0009714
619 Ga0495585_0058449
620 Ga0495585_0294178
621 Ga0495596_0036234
622 Ga0495607_0000277
623 Ga0495607_0000488
624 Ga0495607_0001060
625 Ga0495607_0002084
626 Ga0495607_0004738
627 Ga0495607_0005122
628 Ga0495607_0031007
629 Ga0495583_0000108
630 Ga0495583_0000423
631 Ga0495583_0000587
632 Ga0495583_0000970
633 Ga0495583_0030611
634 Ga0495606_0000129
635 Ga0495606_0025425
636 Ga0495606_0044002
637 Ga0495606_0203843
638 Ga0495610_0000122
639 Ga0495616_0001253
640 Ga0495616_0002047
641 Ga0495616_0012816
642 Ga0495616_0024997
643 Ga0495616_0040674
644 Ga0495616_0046965
645 Ga0495618_0247110
646 Ga0495628_0425501
647 Ga0495630_0481038
648 Ga0495631_0001003
649 Ga0495631_0003361
650 Ga0495631_0077448
651 Ga0495632_0000052
652 Ga0495632_0002449
653 Ga0495632_0002898
654 Ga0495632_0029518
655 Ga0495637_0000018
656 Ga0495637_0026142
657 Ga0495637_0112613
658 Ga0495643_0000044
659 Ga0495643_0002869
660 Ga0495643_0004461
661 Ga0495643_0009305
662 Ga0495643_0025395
663 Ga0495643_0085074
664 Ga0495643_0183301
665 Ga0495644_0000126
666 Ga0495644_0023707
667 Ga0495648_0000329
668 Ga0495648_0000445
669 Ga0495648_0001852
670 Ga0495648_0018389
671 Ga0495648_0021296
672 Ga0495648_0059632
673 Ga0495648_0205771
674 Ga0495648_0224491
675 Ga0495642_0000660
676 Ga0495642_0033423
677 Ga0495654_0140823
678 Ga0495609_0000001
679 Ga0495609_0000320
680 Ga0495609_0000825
681 Ga0495609_0000897
682 Ga0495609_0007721
683 Ga0495609_0022645
684 Ga0495597_0000216
685 Ga0495645_0106103
686 Ga0495645_0281036
687 Ga0495622_0005088
688 Ga0495633_0001328
689 Ga0495633_0017167
690 Ga0495656_0000720
691 Ga0495656_0012787
692 Ga0495656_0028884
693 Ga0495611_0000399
694 Ga0495611_0002330
695 Ga0495611_0004002
696 Ga0495611_0005035
697 Ga0495625_0033474
698 Ga0495625_0121386
699 Ga0495659_0000256
700 Ga0495659_0138886
701 Ga0495659_0228302
702 Ga0495661_0000063
703 Ga0495661_0000369
704 Ga0495661_0000518
705 Ga0495661_0000944
706 Ga0495661_0039557
707 Ga0495661_0083899
708 Ga0495661_0086096
709 Ga0495588_0000052
710 Ga0495588_0093271
711 Ga0495669_0008754
712 Ga0495670_0000521
713 Ga0495671_0000555
714 Ga0495671_0059525
715 Ga0495649_0000441
716 Ga0495649_0046409
717 Ga0495589_0000015
718 Ga0495589_0000116
719 Ga0495589_0002579
720 Ga0495589_0107424
721 Ga0495660_0000145
722 Ga0495660_0000334
723 Ga0495660_0004007
724 Ga0495660_0007234
725 Ga0495660_0035402
726 Ga0495660_0050643
727 Ga0495660_0065883
728 Ga0495636_0000114
729 Ga0495636_0000895
730 Ga0495636_0120156
731 Ga0495672_0000064
732 Ga0495672_0003463
733 Ga0495672_0033561
734 Ga0495672_0048862
735 Ga0495672_0109369
736 Ga0495672_0129689
737 Ga0495683_0000225
738 Ga0495683_0000649
739 Ga0495683_0001565
740 Ga0495683_0039878
741 Ga0495683_0045577
742 Ga0495683_0047734
743 Ga0495687_000003
744 Ga0495687_000073
745 Ga0495687_000459
746 Ga0495687_000560
747 Ga0495687_000891
748 Ga0495687_000925
749 Ga0495687_001022
750 Ga0495677_0000001
751 Ga0495677_0000215
752 Ga0495677_0001000
753 Ga0495677_0002299
754 Ga0495677_0005827
755 Ga0495677_0007476
756 Ga0495677_0018184
757 Ga0495677_0096396
758 Ga0495679_016648
759 Ga0495679_027961
760 Ga0495679_115423
761 Ga0495685_000158
762 Ga0495685_001448
763 Ga0495685_016855
764 Ga0495673_0008731
765 Ga0495673_0010731
766 Ga0495681_0012865
767 Ga0495686_0000620
768 Ga0495686_0000760
769 Ga0495686_0041569
770 Ga0495614_0241186
771 Ga0495626_0000017
772 Ga0495626_0000128
773 Ga0495626_0000171
774 Ga0495626_0000353
775 Ga0495626_0012639
776 Ga0495626_0020814
777 Ga0496100_0124351
778 Ga0496101_0038577
779 Ga0496104_0062458
780 Ga0496107_0089741
781 Ga0496111_0222646
782 Ga0496113_0109595
783 Ga0496114_0185287
784 Ga0496114_0271997
785 Ga0496115_0015602
786 Ga0496115_0122240
787 Ga0496115_0610415
788 Ga0496121_0132912
789 Ga0496122_0006346
790 Ga0496122_0007723
791 Ga0496123_0001975
792 Ga0496123_0118002
793 Ga0496124_0032157
794 Ga0496124_0095020
795 Ga0496124_0349164
796 Ga0496125_0036628
797 Ga0495678_000034
798 Ga0495678_000041
799 Ga0495678_000930
800 Ga0495678_002141
801 Ga0495678_051951
802 Ga0495678_061889
803 Ga0495678_070297
804 Ga0495678_071466
805 Ga0495682_0000013
806 Ga0495682_0000016
807 Ga0495682_0001108
808 Ga0495682_0029197
809 Ga0495682_0031325
810 Ga0495682_0033382
811 Ga0495682_0199837
812 Ga0501031_0127105
813 Ga0501033_0036502
814 Ga0501034_0124363
815 Ga0501037_0066193
816 Ga0501043_0045243
817 Ga0501047_0335559
818 Ga0501047_0444464
819 Ga0501035_0001329
820 Ga0501035_0078527
821 Ga0501044_0012724
822 Ga0501044_0073392
823 nmdc:mga0qj67_80555_c1
824 nmdc:mga08x19_238439_c1
825 2643797314
826 2644474144
827 2809145585
828 8047675021

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

9

121

0.98

PF00196

GerE

Bacterial regulatory proteins, luxR family

145

201

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1fse-assembly2.cif.gz_C crystal structure of the bacillus subtilis regulatory protein gere 0.9739 146 208
7x1k-assembly1.cif.gz_B crystal structure of the flagellar expression regulator degu from listeria monocytogenes 0.9719 146 204
6ekh-assembly1.cif.gz_Y crystal structure of activated chey from methanoccocus maripaludis 0.9707 5 122
3ulq-assembly1.cif.gz_B crystal structure of the anti-activator rapf complexed with the response regulator coma dna binding domain 0.9641 145 199
1qmp-assembly2.cif.gz_B phosphorylated aspartate in the crystal structure of the sporulation response regulator, spo0a 0.9615 5 124
ID Description Score Start End Superfamily
4hyeB02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9963 146 206 1.10.10.10
3cloC02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9787 146 200 1.10.10.10
3cloA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9757 146 200 1.10.10.10
af_P06993_830_894_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9754 144 198 1.10.10.10
4hyeA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9745 144 206 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A6I1GK69-F1-model_v4 Response regulator 0.9842 4 131 GO:0000160
GO:0003677
AF-A0A0F9FFZ2-F1-model_v4 Response regulatory domain-containing protein 0.9834 5 135 GO:0000160
GO:0003677
AF-A0A3N5SS09-F1-model_v4 DNA-binding response regulator 0.9824 5 130 GO:0000160
GO:0003677
AF-A0A4V1TC14-F1-model_v4 deleted 0.98 5 131
AF-A0A3S0B2N0-F1-model_v4 Response regulator transcription factor 0.9791 2 131 GO:0000160
GO:0003677

Map