F438337

General Info

Members Datasets Scaffolds Average Seq Length
414 285 296 285

Family's Representative Sequence

Representative Sequence 3300025225|Ga0209566_100351|Ga0209566_10035120
Length 295
Sequence MQGAEAVVATFKEFRNNVKPNWCPGCGDFTVQASIQRAAANVGLEPEQLAVISGIGCSGRISGYINAYGLHGIHGRALPIAQGVKLANRELTVIASGGDGDGFAIGMGHTVHAIRRNLDITYIVMDNQIYGLTKGQTSPRSAEGFKTKSTPEGSIETTLSPLEIALSAGATFVAQSFSSDLKQLTSLIEQAIQHKGFSLINVFSPCVTFNKVNTYDWFKENIVNLEQFPEYDPSNRIAAMTKIMETNGMLTGLIYQDTTRKSYEDMAVGFKPEALAKQDLTLPEAEFEKLLAEFK

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2510917027 Brevibacillus sp. CF112 Isolate Rhizosphere
3 2512564013 Brevibacillus sp. BC25 Isolate Rhizosphere
4 2512564039 Paenibacillus mucilaginosus 3016 Isolate Rhizosphere
5 2524023129 Paenibacillus pinihumi DSM 23905 Isolate Rhizosphere
6 2551306519 Bacillus sp. WBUNB004 Isolate Rhizosphere
7 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
8 2593339131 Bacillus sp. UNCCL81 Isolate Unclassified
9 2593339198 Paenibacillus sp. UNCCL117 Isolate Unclassified
10 2597490337 Halobacterium salinarum DSM 3754 Isolate Nodule
11 2599185353 Staphylococcus sp. NFPP34 Isolate Rhizoplane
12 2600254943 Staphylococcus pasteuri NFIX07 Isolate Rhizoplane
13 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
14 2643221729 Bacillus sp. Root11 Isolate Unclassified
15 2643221730 Bacillus sp. Root131 Isolate Unclassified
16 2643221731 Bacillus sp. Root147 Isolate Unclassified
17 2643221732 Bacillus sp. Root239 Isolate Unclassified
18 2671180330 Peribacillus simplex SH-B26 Isolate Unclassified
19 2671180694 Paenibacillus sp. A3 Isolate Unclassified
20 2684622632 Bacillus cereus 905 Isolate Unclassified
21 2695420987 Bacillus thuringiensis KNU-07 Isolate Unclassified
22 2703719227 Bacillus mycoides GOE6 Isolate Rhizosphere
23 2718218445 Bacillus sp. B25(2016b) Isolate Rhizosphere
24 2738541295 Bacillus sp. OK085 Isolate Unclassified
25 2738541358 Bacillus sp. OV752 Isolate Unclassified
26 2738543006 Bacillus sp. OK077 Isolate Unclassified
27 2738543010 Bacillus sp. YR335 Isolate Unclassified
28 2738543017 Bacillus sp. OV186 Isolate Unclassified
29 2744054657 Brevibacillus sp. SKDU10 Isolate Unclassified
30 2757320391 Bacillus sp. NFR08 Isolate Rhizoplane
31 2775507177 Bacillus sp. AFS055030 Isolate Unclassified
32 2775507192 Bacillus sp. AFS041924 Isolate Unclassified
33 2788500588 Lysinibacillus sp. YS11 Isolate Unclassified
34 2808606364 Bacillus sp. SLBN-3 Isolate Unclassified
35 2816332186 Peribacillus frigoritolerans 3612 Isolate Unclassified
36 2816332336 Brevibacillus laterosporus ZQ2 Isolate Unclassified
37 2818991443 Bacillus thuringiensis 1230 Isolate Unclassified
38 2818991451 Lysinibacillus fusiformis 3193 Isolate Unclassified
39 2818991459 Paenibacillus sp. 597 Isolate Unclassified
40 2818991465 Priestia megaterium 3291 Isolate Rhizosphere
41 2831905167 Ammoniphilus oxalaticus RAOx-1 Isolate Rhizosphere
42 2842682962 Bacillus sp. R-72492 Isolate Unclassified
43 2842882022 Bacillus sp. R-71893 Isolate Unclassified
44 2849139964 Bacillus sp. R-71875 Isolate Unclassified
45 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
46 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
47 2857460504 Brevibacillus sp. R-74223 Isolate Unclassified
48 2857465823 Brevibacillus sp. R-74266 Isolate Unclassified
49 2857472729 Cohnella sp. R-74144 Isolate Unclassified
50 2857581216 Bacillus sp. R-71922 Isolate Unclassified
51 2857586860 Bacillus sp. R-71935 Isolate Unclassified
52 2857591370 Brevibacillus sp. R-71934 Isolate Unclassified
53 2857604169 Domibacillus sp. R-71921 Isolate Unclassified
54 2857609550 Domibacillus sp. R-71929 Isolate Unclassified
55 2864997549 Paenibacillus sp. R-72005 Isolate Unclassified
56 2865002811 Paenibacillus sp. R-74131 Isolate Unclassified
57 2881644220 Siminovitchia terrae LMG 29736 Isolate Rhizosphere
58 2888578766 Paenibacillus lycopersici 12200R-189 Isolate Rhizosphere
59 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
60 2889295896 Paenibacillus sp. PvR098 Isolate Rhizosphere
61 2898907183 Brevibacillus sp. SYP-B805 Isolate Rhizosphere
62 2904113452 Paenibacillus paridis py1325 Isolate Unclassified
63 2904524088 Priestia megaterium 1428 Isolate Rhizosphere
64 2904606771 Lysinibacillus macroides 1284 Isolate Rhizosphere
65 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
66 2907202186 Paenibacillus sp. HJL G12 Isolate Unclassified
67 2915597211 Brevibacillus brevis Ag35 Isolate Nodule
68 2915606848 Brevibacillus sp. HD1.4A Isolate Rhizosphere
69 2919143609 Priestia megaterium 1751 Isolate Rhizosphere
70 2919414237 Neobacillus niacini 3240 Isolate Rhizosphere
71 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
72 2919517244 Priestia aryabhattai 3820 Isolate Unclassified
73 2919720352 Priestia megaterium 4340 Isolate Unclassified
74 2925326138 Paenibacillus hemerocallicola KCTC 33185 Isolate Unclassified
75 2928093941 Priestia aryabhattai 1389 Isolate Rhizosphere
76 2929004312 Priestia megaterium 1104 Isolate Unclassified
77 2929183550 Brevibacillus sp. R-71971 Hybrid assembly Isolate Unclassified
78 2929206907 Paenibacillus sp. R-74146 Hybrid assembly Isolate Unclassified
79 2929233124 Bacillus sp. R-74298 Hybrid assembly Isolate Unclassified
80 2936340661 Gottfriedia acidiceleris 1-17 Isolate Rhizosphere
81 2936361878 Neobacillus endophyticus BRMEA1 Isolate Unclassified
82 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
83 2938917290 Bacillus sp. CR71 Isolate Unclassified
84 2939593269 Lysinibacillus parviboronicapiens 736 Isolate Rhizosphere
85 2947426588 Bacillus sp. RZ2MS9 Isolate Rhizosphere
86 2960319331 Priestia megaterium AFS057444 Isolate Unclassified
87 2960375949 Priestia megaterium AFS067084 Isolate Unclassified
88 2964375228 Anaerobacillus alkaliphilus B16-10 Isolate Rhizosphere
89 2965761152 Bacillus sp. COPE52 Isolate Unclassified
90 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
91 2977254563 Bacillus sp. SORGH_AS 510 Isolate Unclassified
92 2979083700 Bacillus toyonensis SORGH_AS 407 Isolate Unclassified
93 2980125574 Paenibacillus sp. tmac-D7 Isolate Unclassified
94 2980182181 Paenibacillus cymbidii R196 Isolate Unclassified
95 2981284811 Paenibacillus sp. PvR052 Isolate Rhizosphere
96 2981289755 Paenibacillus sp. PvR148 Isolate Rhizosphere
97 2981980479 Paenibacillus sp. PvR018 Isolate Rhizosphere
98 2981985349 Paenibacillus sp. PvR053 Isolate Rhizosphere
99 2990275345 Bacillus sp. SLBN-46 Isolate Unclassified
100 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere
101 3006826541 Bacillus haikouensis CrR16 Isolate Unclassified
102 3006978542 Bacillus sp. FJAT-49705 Isolate Rhizosphere
103 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
104 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
105 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
106 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
107 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
108 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
109 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
110 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
111 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
112 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
113 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
114 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
115 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
116 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
117 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
118 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
119 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
120 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
121 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
122 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
123 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
124 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
125 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
126 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
127 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
128 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
129 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
130 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
131 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
132 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
133 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
134 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
135 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
136 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
137 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
138 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
139 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
140 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
141 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
142 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
143 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
144 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
145 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
146 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
147 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
148 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
149 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
150 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
151 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
152 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
153 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
154 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
155 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
156 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
157 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
158 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
159 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
160 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
161 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
163 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
164 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
166 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
167 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
169 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300029277 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.ctcc.R1 Metatranscriptome Rhizosphere
186 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
187 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
188 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
189 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
190 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
191 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
192 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
193 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
194 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
195 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
196 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
197 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
198 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
199 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
200 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
201 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
202 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
203 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
204 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
205 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
206 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
207 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
208 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
209 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
210 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
211 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
212 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
213 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
214 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
215 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
216 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
217 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
218 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
219 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
220 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
221 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
222 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
223 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
224 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
225 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
226 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
227 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
228 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
229 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
230 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
231 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
233 3300049131 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
234 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
235 3300049133 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
236 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
237 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
238 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
239 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
240 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
241 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
242 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
243 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
244 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
245 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
246 3300049543 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
247 3300049544 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
248 3300049546 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
249 3300049548 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
250 3300049549 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
251 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
252 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
253 3300049553 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
254 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
255 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
257 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
258 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
259 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
260 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
261 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
262 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
263 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
264 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
265 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
266 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
267 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
268 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
269 8002317523 Cohnella sp. GbtcB17 Isolate Unclassified
270 8022621104 Bacillus sp. PIC28 Isolate Rhizosphere
271 8022792930 Bacillus sp. Xin Isolate Rhizosphere
272 8022893055 Bacillus aryabhattai AFS007213 Isolate Unclassified
273 8022914991 Bacillus aryabhattai SQU-R12 Isolate Unclassified
274 8023438354 Bacillus sp. BH2 Isolate Unclassified
275 8023444577 Bacillus sp. BH32 Isolate Unclassified
276 8046991243 Cohnella rhizosphaerae DSM 28161 Isolate Rhizosphere
277 8054280661 Metabacillus kandeliae GX 13764 Isolate Rhizosphere
278 8054795415 Paenibacillus periandrae PM10 Isolate Nodule
279 8055531788 Lysinibacillus pakistanensis LY1 Isolate Rhizosphere
280 8055632911 Paenibacillus radicibacter N1-5-1-14 Isolate Unclassified
281 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified
282 8057582654 Bacillus arachidis YX15 Isolate Rhizosphere
283 8057632132 Cytobacillus kochii RZ2 Isolate Rhizosphere
284 8057733483 Paenibacillus apiarius MW-14 Isolate Rhizosphere
285 8057977335 Paenibacillus oenotherae DT7-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 59.18
Metatranscriptomes 12.32
Isolates 28.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.35
Nodule 0.97
Rhizoplane 5.07
Rhizosphere 61.35
Stem 0
Stem Tuber 0
Unclassified 21.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1296820 2162886007 Bacteria 2213
2 JGI25159J45721_1005363 3300002987 Bacteria 4038
3 JGI25159J45721_1005869 3300002987 Bacteria 3784
4 JGI25151J46595_10004881 3300003187 Bacteria 7002
5 JGI25151J46595_10025499 3300003187 Bacteria 2405
6 JGI25151J46595_10045559 3300003187 Bacteria 1547
7 JGI25151J46595_10050394 3300003187 Bacteria 1419
8 JGI25151J46595_10070234 3300003187 Bacteria 1064
9 rootH1_10000119 3300003316 Bacteria 90410
10 rootL2_10022595 3300003322 Bacteria 56416
11 rootH1_10004118 3300003323 Bacteria 3163
12 JGI25407J50210_10049536 3300003373 Unclassified 1066
13 Ga0007409J51694_1073870 3300003575 Bacteria 946
14 Ga0006562J51391_1000047 3300003578 Bacteria 14819
15 Ga0006562J51391_1003697 3300003578 Bacteria 2758
16 Ga0055532_1000004 3300003758 Bacteria 471824
17 Ga0055532_1000712 3300003758 Bacteria 12384
18 Ga0055528_1014770 3300003790 Bacteria 2867
19 Ga0055541_1001187 3300003841 Bacteria 5796
20 Ga0055541_1007823 3300003841 Bacteria 1735
21 Ga0065704_10003626 3300005289 Bacteria 4663
22 Ga0065707_10016287 3300005295 Bacteria 2387
23 Ga0070676_10358970 3300005328 Bacteria 1004
24 Ga0070673_100207458 3300005364 Bacteria 1690
25 Ga0070703_10077723 3300005406 Bacteria 1123
26 Ga0070705_100065990 3300005440 Bacteria 2169
27 Ga0070694_100000399 3300005444 Bacteria 23589
28 Ga0070708_100000579 3300005445 Bacteria 27450
29 Ga0070708_100069247 3300005445 Bacteria 3173
30 Ga0070708_100136394 3300005445 Unclassified 2273
31 Ga0070708_100256767 3300005445 Bacteria 1642
32 Ga0070706_100033789 3300005467 Bacteria 4721
33 Ga0070706_100214634 3300005467 Unclassified 1796
34 Ga0070707_100000056 3300005468 Bacteria 99729
35 Ga0070707_100120498 3300005468 Bacteria 2547
36 Ga0070707_100171950 3300005468 Bacteria 2111
37 Ga0070698_100007971 3300005471 Bacteria 11456
38 Ga0070698_100090865 3300005471 Bacteria 3036
39 Ga0070698_100330054 3300005471 Bacteria 1456
40 Ga0070699_100018280 3300005518 Bacteria 6022
41 Ga0070699_100073049 3300005518 Unclassified 2984
42 Ga0070699_100099789 3300005518 Bacteria 2544
43 Ga0070697_100000950 3300005536 Bacteria 21830
44 Ga0070697_100032542 3300005536 Bacteria 4197
45 Ga0070697_100045311 3300005536 Unclassified 3564
46 Ga0070697_100488753 3300005536 Bacteria 1075
47 Ga0070672_100047740 3300005543 Unclassified 3324
48 Ga0070695_100066894 3300005545 Bacteria 2343
49 Ga0070665_100025637 3300005548 Bacteria 5940
50 Ga0070704_100072839 3300005549 Bacteria 2500
51 Ga0070704_100619405 3300005549 Unclassified 953
52 Ga0068859_100169071 3300005617 Unclassified 2267
53 Ga0068864_100080813 3300005618 Bacteria 2849
54 Ga0081455_10005250 3300005937 Bacteria 14238
55 Ga0081455_10010202 3300005937 Bacteria 9560
56 Ga0081455_10197304 3300005937 Bacteria 1510
57 Ga0081538_10001682 3300005981 Bacteria 22527
58 Ga0081538_10007898 3300005981 Bacteria 9116
59 Ga0081538_10008726 3300005981 Bacteria 8555
60 Ga0081538_10025043 3300005981 Bacteria 4227
61 Ga0075364_10250653 3300006051 Bacteria 1203
62 Ga0097621_100597108 3300006237 Bacteria 1009
63 Ga0068871_100077779 3300006358 Unclassified 2742
64 Ga0075428_100067020 3300006844 Bacteria 3930
65 Ga0075428_100739374 3300006844 Bacteria 1047
66 Ga0075430_100015395 3300006846 Bacteria 6511
67 Ga0075431_100010639 3300006847 Bacteria 9247
68 Ga0075431_100030834 3300006847 Bacteria 5523
69 Ga0075431_100057894 3300006847 Bacteria 3997
70 Ga0075431_100237157 3300006847 Unclassified 1857
71 Ga0075431_100247204 3300006847 Unclassified 1813
72 Ga0075433_10094170 3300006852 Bacteria 2651
73 Ga0075433_10105245 3300006852 Unclassified 2500
74 Ga0075433_10115788 3300006852 Bacteria 2378
75 Ga0075433_10167307 3300006852 Bacteria 1956
76 Ga0075434_100005428 3300006871 Bacteria 11609
77 Ga0075434_100142209 3300006871 Bacteria 2419
78 Ga0075434_100163828 3300006871 Bacteria 2243
79 Ga0075434_100214311 3300006871 Bacteria 1946
80 Ga0075434_100363214 3300006871 Bacteria 1469
81 Ga0075429_100046068 3300006880 Bacteria 3794
82 Ga0075436_100000029 3300006914 Bacteria 97599
83 Ga0075436_100000673 3300006914 Bacteria 22494
84 Ga0075436_100029286 3300006914 Bacteria 3786
85 Ga0075436_100044308 3300006914 Bacteria 3067
86 Ga0097620_100169065 3300006931 Unclassified 2267
87 Ga0075435_100008876 3300007076 Bacteria 7241
88 Ga0075435_100404942 3300007076 Bacteria 1174
89 Ga0105251_10015481 3300009011 Bacteria 4166
90 Ga0105251_10032735 3300009011 Bacteria 2588
91 Ga0105244_10006286 3300009036 Bacteria 7729
92 Ga0105250_10001693 3300009092 Bacteria 11648
93 Ga0105250_10006163 3300009092 Bacteria 5270
94 Ga0105250_10022637 3300009092 Bacteria 2533
95 Ga0105250_10033897 3300009092 Bacteria 2050
96 Ga0105250_10174053 3300009092 Bacteria 902
97 Ga0111539_10019694 3300009094 Bacteria 8322
98 Ga0111539_10076170 3300009094 Bacteria 3950
99 Ga0111539_10802728 3300009094 Bacteria 1095
100 Ga0114129_10321490 3300009147 Unclassified 2057
101 Ga0114129_10457623 3300009147 Bacteria 1673
102 Ga0114129_10460110 3300009147 Bacteria 1667
103 Ga0105243_10002092 3300009148 Bacteria 16912
104 Ga0105242_10230406 3300009176 Bacteria 1660
105 Ga0105248_10001231 3300009177 Bacteria 28569
106 Ga0105246_10006934 3300011119 Bacteria 6934
107 Ga0105246_10017611 3300011119 Bacteria 4544
108 Ga0157371_10004977 3300013102 Bacteria 11409
109 Ga0157374_10090525 3300013296 Bacteria 2917
110 Ga0157378_10065674 3300013297 Bacteria 3248
111 Ga0157378_10075778 3300013297 Unclassified 3029
112 Ga0157377_10126543 3300014745 Bacteria 1555
113 Ga0224712_10056016 3300022467 Bacteria 1553
114 Ga0209784_100041 3300025224 Bacteria 228573
115 Ga0209784_101672 3300025224 Bacteria 2699
116 Ga0209566_100076 3300025225 Bacteria 161921
117 Ga0209566_100351 3300025225 Bacteria 39621
118 Ga0209566_100938 3300025225 Bacteria 13315
119 Ga0209147_100010 3300025229 Bacteria 741391
120 Ga0209147_100053 3300025229 Bacteria 267615
121 Ga0209147_100245 3300025229 Bacteria 52865
122 Ga0209147_101270 3300025229 Bacteria 9858
123 Ga0209258_102595 3300025242 Bacteria 4516
124 Ga0209130_1004614 3300025284 Bacteria 5142
125 Ga0209130_1004734 3300025284 Bacteria 5031
126 Ga0209130_1013854 3300025284 Bacteria 2048
127 Ga0209130_1036316 3300025284 Bacteria 979
128 Ga0209675_1014709 3300025291 Bacteria 2366
129 Ga0209676_1001610 3300025292 Bacteria 20001
130 Ga0209676_1014058 3300025292 Bacteria 3035
131 Ga0209676_1014312 3300025292 Bacteria 2990
132 Ga0209025_1000302 3300025294 Bacteria 110301
133 Ga0209025_1000931 3300025294 Bacteria 44624
134 Ga0209025_1001319 3300025294 Bacteria 33734
135 Ga0209025_1001392 3300025294 Bacteria 32218
136 Ga0209025_1001875 3300025294 Bacteria 24630
137 Ga0209025_1002476 3300025294 Bacteria 19413
138 Ga0209025_1004054 3300025294 Bacteria 13101
139 Ga0209025_1005227 3300025294 Bacteria 10702
140 Ga0209025_1008332 3300025294 Bacteria 7473
141 Ga0209025_1008546 3300025294 Bacteria 7348
142 Ga0209025_1008794 3300025294 Bacteria 7181
143 Ga0209025_1009244 3300025294 Bacteria 6906
144 Ga0209025_1013413 3300025294 Bacteria 5153
145 Ga0209025_1019984 3300025294 Bacteria 3690
146 Ga0209025_1021778 3300025294 Bacteria 3433
147 Ga0209025_1022025 3300025294 Bacteria 3401
148 Ga0207696_1003324 3300025711 Bacteria 7399
149 Ga0207696_1009673 3300025711 Bacteria 3582
150 Ga0207696_1013494 3300025711 Bacteria 2846
151 Ga0207655_1005283 3300025728 Bacteria 8856
152 Ga0207655_1034951 3300025728 Bacteria 2253
153 Ga0207655_1038103 3300025728 Bacteria 2107
154 Ga0207655_1042062 3300025728 Bacteria 1950
155 Ga0207713_1003207 3300025735 Bacteria 11291
156 Ga0207653_10027033 3300025885 Bacteria 1841
157 Ga0207685_10043387 3300025905 Bacteria 1694
158 Ga0207684_10036239 3300025910 Bacteria 4188
159 Ga0207646_10006849 3300025922 Bacteria 11715
160 Ga0207644_10028438 3300025931 Bacteria 3870
161 Ga0207686_10049095 3300025934 Bacteria 2618
162 Ga0207669_10568651 3300025937 Bacteria 917
163 Ga0207691_10087760 3300025940 Unclassified 2790
164 Ga0207711_10009986 3300025941 Bacteria 7889
165 Ga0207641_10359203 3300026088 Bacteria 1390
166 Ga0207648_10198228 3300026089 Unclassified 1780
167 Ga0207675_100601153 3300026118 Bacteria 1103
168 Ga0268266_10100732 3300028379 Bacteria 2545
169 Ga0311001_1050231 3300029277 Bacteria 1961
170 Ga0237817_10006 3300030083 Bacteria 90374
171 Ga0307408_100146312 3300031548 Bacteria 1860
172 Ga0307408_100299917 3300031548 Bacteria 1345
173 Ga0395899_0046831 3300037312 Bacteria 3220
174 Ga0395899_0403797 3300037312 Bacteria 903
175 Ga0395898_0040844 3300037466 Bacteria 4585
176 Ga0395898_0483413 3300037466 Bacteria 1178
177 Ga0237819_00814 3300038705 Bacteria 9889
178 Ga0237819_01368 3300038705 Bacteria 6403
179 Ga0439436_0000786 3300041404 Bacteria 8588
180 Ga0439449_0000071 3300042007 Bacteria 32033
181 Ga0439449_0016355 3300042007 Bacteria 2787
182 Ga0439457_020859 3300042014 Bacteria 1453
183 Ga0439462_0003273 3300042015 Bacteria 3874
184 Ga0439462_0005182 3300042015 Bacteria 3205
185 Ga0466969_0001616 3300044656 Bacteria 12071
186 Ga0466966_0266051 3300044684 Bacteria 1032
187 Ga0466961_0008694 3300044693 Bacteria 6473
188 Ga0466968_0002179 3300044735 Bacteria 7145
189 Ga0466959_0000907 3300045049 Bacteria 17510
190 Ga0451576_0142717 3300045051 Unclassified 2497
191 Ga0466967_0000070 3300045976 Bacteria 37759
192 Ga0495603_0137911 3300046455 Bacteria 1419
193 Ga0495584_0009657 3300046491 Bacteria 4966
194 Ga0495585_0015599 3300046492 Bacteria 4414
195 Ga0495654_0102010 3300046530 Bacteria 1320
196 Ga0495622_0093329 3300046557 Bacteria 1382
197 Ga0495633_0076773 3300046558 Bacteria 1556
198 Ga0495589_0129330 3300046794 Bacteria 1213
199 Ga0495636_0022954 3300047318 Bacteria 2524
200 Ga0495683_0076294 3300047323 Bacteria 1640
201 Ga0495626_0086128 3300048091 Bacteria 1389
202 Ga0496100_0101502 3300048903 Bacteria 1983
203 Ga0496101_0001169 3300048904 Bacteria 15706
204 Ga0496102_0002061 3300048905 Bacteria 17306
205 Ga0496103_0133789 3300048906 Bacteria 1584
206 Ga0496104_0001867 3300048907 Bacteria 18233
207 Ga0496105_0005394 3300048908 Bacteria 9700
208 Ga0496106_0000875 3300048909 Bacteria 21949
209 Ga0496107_0011386 3300048910 Bacteria 6193
210 Ga0496109_0180278 3300048912 Bacteria 1983
211 Ga0496110_0004634 3300048913 Bacteria 10684
212 Ga0496110_0010798 3300048913 Bacteria 7444
213 Ga0496110_0059200 3300048913 Bacteria 3375
214 Ga0496110_0169001 3300048913 Bacteria 1983
215 Ga0496110_0208463 3300048913 Bacteria 1776
216 Ga0496111_0003946 3300048914 Bacteria 9309
217 Ga0496112_0002742 3300048915 Bacteria 14273
218 Ga0496112_0069492 3300048915 Bacteria 3479
219 Ga0496113_0000788 3300048916 Bacteria 16423
220 Ga0496116_0014110 3300048919 Bacteria 6397
221 Ga0496116_0042129 3300048919 Bacteria 3125
222 Ga0496120_0032976 3300048923 Bacteria 3116
223 Ga0496122_0007978 3300048925 Bacteria 11574
224 Ga0496122_0010117 3300048925 Bacteria 9784
225 Ga0496122_0088332 3300048925 Bacteria 2125
226 Ga0496122_0119118 3300048925 Bacteria 1708
227 Ga0496124_0011390 3300048927 Bacteria 8890
228 Ga0496124_0062369 3300048927 Bacteria 3120
229 Ga0496125_0004367 3300048928 Bacteria 16379
230 Ga0496126_0011884 3300048929 Bacteria 8953
231 Ga0501306_000348 3300049127 Bacteria 3363
232 Ga0501309_003111 3300049129 Bacteria 1857
233 Ga0501341_00137 3300049131 Bacteria 2375
234 Ga0501343_000047 3300049132 Bacteria 5006
235 Ga0501343_000771 3300049132 Bacteria 1998
236 Ga0501344_00138 3300049133 Bacteria 2527
237 Ga0501344_02118 3300049133 Bacteria 1008
238 Ga0501344_02622 3300049133 Bacteria 933
239 Ga0501305_000530 3300049161 Bacteria 3169
240 Ga0501305_000987 3300049161 Bacteria 2629
241 Ga0501305_001923 3300049161 Bacteria 2146
242 Ga0501305_031211 3300049161 Bacteria 831
243 Ga0501312_008684 3300049528 Bacteria 1325
244 Ga0501313_007897 3300049529 Bacteria 1177
245 Ga0501314_001224 3300049530 Bacteria 1823
246 Ga0501314_008680 3300049530 Bacteria 923
247 Ga0501315_000037 3300049531 Bacteria 5521
248 Ga0501315_021186 3300049531 Bacteria 878
249 Ga0501315_023921 3300049531 Bacteria 842
250 Ga0501317_000473 3300049533 Bacteria 2826
251 Ga0501317_004957 3300049533 Bacteria 1407
252 Ga0501321_000382 3300049537 Bacteria 2760
253 Ga0501322_000918 3300049538 Bacteria 1532
254 Ga0501323_007144 3300049539 Bacteria 1267
255 Ga0501324_007973 3300049540 Bacteria 925
256 Ga0501327_01212 3300049543 Bacteria 1205
257 Ga0501328_00352 3300049544 Bacteria 1496
258 Ga0501330_003585 3300049546 Bacteria 933
259 Ga0501332_00329 3300049548 Bacteria 1983
260 Ga0501333_003762 3300049549 Bacteria 937
261 Ga0501333_003832 3300049549 Bacteria 930
262 Ga0501335_000363 3300049551 Bacteria 2777
263 Ga0501335_000418 3300049551 Bacteria 2671
264 Ga0501335_002772 3300049551 Bacteria 1443
265 Ga0501335_007864 3300049551 Bacteria 992
266 Ga0501335_011149 3300049551 Bacteria 875
267 Ga0501335_012614 3300049551 Bacteria 837
268 Ga0501336_000161 3300049552 Bacteria 2779
269 Ga0501336_000276 3300049552 Bacteria 2353
270 Ga0501336_000488 3300049552 Bacteria 1973
271 Ga0501336_007489 3300049552 Bacteria 829
272 Ga0501337_000379 3300049553 Bacteria 2119
273 Ga0501337_000633 3300049553 Bacteria 1812
274 Ga0501340_000187 3300049556 Bacteria 2260
275 Ga0501034_0081431 3300049571 Bacteria 3240
276 Ga0501040_0000020 3300049576 Archaea 73076
277 nmdc:mga05p37_131506_c1 3300050507 Bacteria 3071
278 nmdc:mga05p37_270436_c1 3300050507 Unclassified 2031
279 nmdc:mga0qj67_15561_c1 3300050509 Bacteria 5759
280 nmdc:mga06r32_42446_c1 3300050510 Bacteria 4324
281 nmdc:mga06r32_9867_c1 3300050510 Bacteria 8616
282 nmdc:mga08y16_374439_c1 3300050511 Bacteria 1460
283 nmdc:mga0n895_123218_c1 3300050512 Bacteria 2614
284 nmdc:mga0n895_469720_c1 3300050512 Bacteria 1269
285 nmdc:mga0n895_5651_c1 3300050512 Bacteria 10481
286 nmdc:mga0rr50_5763_c1 3300050513 Bacteria 7434
287 nmdc:mga08x19_172_c1 3300050514 Bacteria 53474
288 nmdc:mga08x19_1_c1 3300050514 Bacteria 2010344
289 nmdc:mga0a205_130356_c1 3300050515 Unclassified 2415
290 nmdc:mga0a205_16765_c1 3300050515 Bacteria 6860
291 nmdc:mga0a205_7506_c1 3300050515 Bacteria 9876
292 nmdc:mga0a205_84295_c1 3300050515 Bacteria 3070
293 Ga0495619_0004171 3300053085 Bacteria 9233
294 Ga0590075_001493 3300059424 Bacteria 5831
295 Ga0587080_001113 3300059503 Bacteria 2757
296 Ga0587067_000908 3300059640 Bacteria 2956

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2937972304 2937978946 233
2 3300045051 Ga0451576_0142717 Ga0451576_0142717_75_857 243
3 3300003373 JGI25407J50210_10049536 JGI25407J50210_100495361 244
4 3300048927 Ga0496124_0062369 Ga0496124_0062369_1644_2411 245
5 3300025937 Ga0207669_10568651 Ga0207669_105686511 249
6 3300049161 Ga0501305_031211 Ga0501305_031211_30_815 253
7 3300049531 Ga0501315_021186 Ga0501315_021186_20_805 253
8 3300049531 Ga0501315_023921 Ga0501315_023921_21_806 253
9 3300049551 Ga0501335_011149 Ga0501335_011149_73_858 253
10 3300049551 Ga0501335_012614 Ga0501335_012614_19_804 253
11 3300049552 Ga0501336_007489 Ga0501336_007489_14_799 253
12 3300037312 Ga0395899_0403797 Ga0395899_0403797_93_890 257
13 3300038705 Ga0237819_00814 Ga0237819_00814_3326_4123 257
14 3300049552 Ga0501336_000161 Ga0501336_000161_1854_2678 262
15 3300048913 Ga0496110_0059200 Ga0496110_0059200_979_1842 266
16 3300049133 Ga0501344_02622 Ga0501344_02622_20_883 269
17 3300005406 Ga0070703_10077723 Ga0070703_100777231 271
18 3300005440 Ga0070705_100065990 Ga0070705_1000659901 271
19 3300005445 Ga0070708_100256767 Ga0070708_1002567672 271
20 3300005468 Ga0070707_100120498 Ga0070707_1001204982 271
21 3300005468 Ga0070707_100171950 Ga0070707_1001719502 271
22 3300005471 Ga0070698_100090865 Ga0070698_1000908652 271
23 3300005471 Ga0070698_100330054 Ga0070698_1003300542 271
24 3300005518 Ga0070699_100018280 Ga0070699_1000182803 271
25 3300005518 Ga0070699_100099789 Ga0070699_1000997892 271
26 3300005536 Ga0070697_100000950 Ga0070697_10000095015 271
27 3300005545 Ga0070695_100066894 Ga0070695_1000668942 271
28 3300005549 Ga0070704_100072839 Ga0070704_1000728392 271
29 3300005549 Ga0070704_100619405 Ga0070704_1006194051 271
30 3300009147 Ga0114129_10321490 Ga0114129_103214902 271
31 3300025885 Ga0207653_10027033 Ga0207653_100270332 271
32 3300025922 Ga0207646_10006849 Ga0207646_100068495 271
33 3300048913 Ga0496110_0208463 Ga0496110_0208463_125_988 271
34 3300050507 nmdc:mga05p37_270436_c1 nmdc:mga05p37_270436_c1_1046_1921 271
35 3300006914 Ga0075436_100000029 Ga0075436_10000002939 272
36 3300006914 Ga0075436_100000673 Ga0075436_10000067320 272
37 3300050514 nmdc:mga08x19_172_c1 nmdc:mga08x19_172_c1_6169_7065 272
38 3300050514 nmdc:mga08x19_1_c1 nmdc:mga08x19_1_c1_785763_786659 272
39 3300005937 Ga0081455_10010202 Ga0081455_100102025 273
40 3300005937 Ga0081455_10197304 Ga0081455_101973041 273
41 3300005981 Ga0081538_10001682 Ga0081538_1000168219 273
42 3300005981 Ga0081538_10007898 Ga0081538_100078984 273
43 3300005981 Ga0081538_10008726 Ga0081538_100087264 273
44 3300005981 Ga0081538_10025043 Ga0081538_100250431 273
45 3300006846 Ga0075430_100015395 Ga0075430_1000153952 273
46 3300006847 Ga0075431_100247204 Ga0075431_1002472042 273
47 3300009094 Ga0111539_10076170 Ga0111539_100761702 273
48 3300029277 Ga0311001_1050231 Ga0311001_10502312 273
49 3300049533 Ga0501317_004957 Ga0501317_004957_80_940 273
50 3300049576 Ga0501040_0000020 Ga0501040_0000020_27834_28697 273
51 3300050509 nmdc:mga0qj67_15561_c1 nmdc:mga0qj67_15561_c1_1226_2086 273
52 3300050510 nmdc:mga06r32_42446_c1 nmdc:mga06r32_42446_c1_824_1684 273
53 3300050511 nmdc:mga08y16_374439_c1 nmdc:mga08y16_374439_c1_481_1341 273
54 iso_pr_archaea 2597490337 2599020860 273
55 3300005444 Ga0070694_100000399 Ga0070694_10000039914 274
56 3300005445 Ga0070708_100000579 Ga0070708_10000057920 274
57 3300005467 Ga0070706_100033789 Ga0070706_1000337895 274
58 3300005468 Ga0070707_100000056 Ga0070707_10000005633 274
59 3300005471 Ga0070698_100007971 Ga0070698_1000079715 274
60 3300005536 Ga0070697_100045311 Ga0070697_1000453114 274
61 3300005536 Ga0070697_100488753 Ga0070697_1004887531 274
62 3300005548 Ga0070665_100025637 Ga0070665_1000256375 274
63 3300005937 Ga0081455_10005250 Ga0081455_100052509 274
64 3300006051 Ga0075364_10250653 Ga0075364_102506532 274
65 3300006844 Ga0075428_100739374 Ga0075428_1007393741 274
66 3300006847 Ga0075431_100010639 Ga0075431_1000106392 274
67 3300006847 Ga0075431_100057894 Ga0075431_1000578943 274
68 3300006847 Ga0075431_100237157 Ga0075431_1002371573 274
69 3300006852 Ga0075433_10094170 Ga0075433_100941702 274
70 3300009177 Ga0105248_10001231 Ga0105248_100012315 274
71 3300025910 Ga0207684_10036239 Ga0207684_100362392 274
72 3300025941 Ga0207711_10009986 Ga0207711_100099865 274
73 3300028379 Ga0268266_10100732 Ga0268266_101007322 274
74 3300050510 nmdc:mga06r32_9867_c1 nmdc:mga06r32_9867_c1_3405_4286 274
75 3300050515 nmdc:mga0a205_16765_c1 nmdc:mga0a205_16765_c1_2313_3194 274
76 3300006847 Ga0075431_100030834 Ga0075431_1000308342 275
77 3300006852 Ga0075433_10167307 Ga0075433_101673072 275
78 3300006871 Ga0075434_100142209 Ga0075434_1001422092 275
79 3300006871 Ga0075434_100163828 Ga0075434_1001638282 275
80 3300006914 Ga0075436_100029286 Ga0075436_1000292864 275
81 3300009094 Ga0111539_10802728 Ga0111539_108027281 275
82 3300009147 Ga0114129_10457623 Ga0114129_104576231 275
83 3300048913 Ga0496110_0004634 Ga0496110_0004634_8977_9846 275
84 3300049571 Ga0501034_0081431 Ga0501034_0081431_1935_2813 275
85 3300050515 nmdc:mga0a205_7506_c1 nmdc:mga0a205_7506_c1_61_939 275
86 iso_pu_bacteria 2510917027 2511180791 276
87 iso_pu_bacteria 2512564013 2512636885 276
88 iso_pu_bacteria 2512564039 2512734533 276
89 iso_pu_bacteria 2524023129 2524190838 276
90 iso_pu_bacteria 2551306519 2553391141 276
91 iso_pu_bacteria 2585428059 2587738171 276
92 iso_pu_bacteria 2593339131 2595089240 276
93 iso_pu_bacteria 2593339198 2595316741 276
94 iso_pu_bacteria 2599185353 2600198197 276
95 iso_pu_bacteria 2600254943 2600400968 276
96 iso_pu_bacteria 2643221676 2644421356 276
97 iso_pu_bacteria 2643221729 2644705380 276
98 iso_pu_bacteria 2643221730 2644710073 276
99 iso_pu_bacteria 2643221731 2644716203 276
100 iso_pu_bacteria 2643221732 2644723927 276
101 iso_pu_bacteria 2671180330 2672335192 276
102 iso_pu_bacteria 2671180694 2673820984 276
103 iso_pu_bacteria 2684622632 2685151738 276
104 iso_pu_bacteria 2695420987 2698321476 276
105 iso_pu_bacteria 2703719227 2705995683 276
106 iso_pu_bacteria 2718218445 2721506904 276
107 iso_pu_bacteria 2738541295 2738812959 276
108 iso_pu_bacteria 2738541358 2739155110 276
109 iso_pu_bacteria 2738543006 2739207568 276
110 iso_pu_bacteria 2738543017 2739268497 276
111 iso_pu_bacteria 2744054657 2745168273 276
112 iso_pu_bacteria 2757320391 2757564995 276
113 iso_pu_bacteria 2775507177 2777764032 276
114 iso_pu_bacteria 2775507192 2777839825 276
115 iso_pu_bacteria 2788500588 2791212419 276
116 iso_pu_bacteria 2808606364 2808868619 276
117 iso_pu_bacteria 2816332186 2816864036 276
118 iso_pu_bacteria 2816332336 2817619402 276
119 iso_pu_bacteria 2818991443 2819580913 276
120 iso_pu_bacteria 2818991451 2819626028 276
121 iso_pu_bacteria 2818991459 2819670100 276
122 iso_pu_bacteria 2818991465 2819709675 276
123 iso_pu_bacteria 2831905167 2831907132 276
124 iso_pu_bacteria 2842682962 2842685041 276
125 iso_pu_bacteria 2842882022 2842884068 276
126 iso_pu_bacteria 2849139964 2849140949 276
127 iso_pu_bacteria 2857357740 2857362329 276
128 iso_pu_bacteria 2857453340 2857456852 276
129 iso_pu_bacteria 2857460504 2857461408 276
130 iso_pu_bacteria 2857465823 2857466729 276
131 iso_pu_bacteria 2857472729 2857472821 276
132 iso_pu_bacteria 2857581216 2857584182 276
133 iso_pu_bacteria 2857586860 2857588525 276
134 iso_pu_bacteria 2857591370 2857592729 276
135 iso_pu_bacteria 2864997549 2864997685 276
136 iso_pu_bacteria 2865002811 2865006015 276
137 iso_pu_bacteria 2881644220 2881646285 276
138 iso_pu_bacteria 2888578766 2888581439 276
139 iso_pu_bacteria 2889049205 2889049936 276
140 iso_pu_bacteria 2889295896 2889296498 276
141 iso_pu_bacteria 2898907183 2898908074 276
142 iso_pu_bacteria 2904113452 2904115117 276
143 iso_pu_bacteria 2904524088 2904524902 276
144 iso_pu_bacteria 2904606771 2904611377 276
145 iso_pu_bacteria 2904755435 2904757015 276
146 iso_pu_bacteria 2907202186 2907203727 276
147 iso_pu_bacteria 2915597211 2915602070 276
148 iso_pu_bacteria 2915606848 2915611052 276
149 iso_pu_bacteria 2919143609 2919146509 276
150 iso_pu_bacteria 2919414237 2919414532 276
151 iso_pu_bacteria 2919425241 2919431037 276
152 iso_pu_bacteria 2919517244 2919518425 276
153 iso_pu_bacteria 2919720352 2919722790 276
154 iso_pu_bacteria 2925326138 2925327174 276
155 iso_pu_bacteria 2928093941 2928096650 276
156 iso_pu_bacteria 2929004312 2929005944 276
157 iso_pu_bacteria 2929183550 2929187166 276
158 iso_pu_bacteria 2929206907 2929210274 276
159 iso_pu_bacteria 2929233124 2929237428 276
160 iso_pu_bacteria 2936340661 2936343556 276
161 iso_pu_bacteria 2936361878 2936365315 276
162 iso_pu_bacteria 2938917290 2938921625 276
163 iso_pu_bacteria 2939593269 2939593504 276
164 iso_pu_bacteria 2947426588 2947430513 276
165 iso_pu_bacteria 2960319331 2960320416 276
166 iso_pu_bacteria 2960375949 2960379677 276
167 iso_pu_bacteria 2964375228 2964378671 276
168 iso_pu_bacteria 2965761152 2965765304 276
169 iso_pu_bacteria 2971410472 2971411654 276
170 iso_pu_bacteria 2977254563 2977258266 276
171 iso_pu_bacteria 2979083700 2979087388 276
172 iso_pu_bacteria 2980125574 2980128267 276
173 iso_pu_bacteria 2980182181 2980184690 276
174 iso_pu_bacteria 2981284811 2981284963 276
175 iso_pu_bacteria 2981289755 2981289907 276
176 iso_pu_bacteria 2981980479 2981981455 276
177 iso_pu_bacteria 2981985349 2981986351 276
178 iso_pu_bacteria 2990275345 2990279297 276
179 iso_pu_bacteria 3001892409 3001893444 276
180 iso_pu_bacteria 3006826541 3006827757 276
181 iso_pu_bacteria 3006978542 3006979307 276
182 iso_pu_bacteria 8002317523 8002319928 276
183 iso_pu_bacteria 8022621104 8022623635 276
184 iso_pu_bacteria 8022792930 8022794131 276
185 iso_pu_bacteria 8022893055 8022897742 276
186 iso_pu_bacteria 8022914991 8022916921 276
187 iso_pu_bacteria 8023438354 8023440518 276
188 iso_pu_bacteria 8023444577 8023444586 276
189 iso_pu_bacteria 8046991243 8046997997 276
190 iso_pu_bacteria 8054280661 8054281816 276
191 iso_pu_bacteria 8054795415 8054796016 276
192 iso_pu_bacteria 8055531788 8055533100 276
193 iso_pu_bacteria 8055632911 8055635433 276
194 iso_pu_bacteria 8056533031 8056539626 276
195 iso_pu_bacteria 8057582654 8057586177 276
196 iso_pu_bacteria 8057632132 8057634273 276
197 iso_pu_bacteria 8057733483 8057737948 276
198 iso_pu_bacteria 8057977335 8057978656 276
199 3300002987 JGI25159J45721_1005363 JGI25159J45721_10053632 277
200 3300002987 JGI25159J45721_1005869 JGI25159J45721_10058694 277
201 3300003187 JGI25151J46595_10004881 JGI25151J46595_100048817 277
202 3300003187 JGI25151J46595_10025499 JGI25151J46595_100254992 277
203 3300003187 JGI25151J46595_10045559 JGI25151J46595_100455591 277
204 3300003187 JGI25151J46595_10050394 JGI25151J46595_100503942 277
205 3300003187 JGI25151J46595_10070234 JGI25151J46595_100702341 277
206 3300003316 rootH1_10000119 rootH1_1000011916 277
207 3300003322 rootL2_10022595 rootL2_100225951 277
208 3300003323 rootH1_10004118 rootH1_100041182 277
209 3300003575 Ga0007409J51694_1073870 Ga0007409J51694_10738701 277
210 3300003578 Ga0006562J51391_1000047 Ga0006562J51391_10000472 277
211 3300003578 Ga0006562J51391_1003697 Ga0006562J51391_10036972 277
212 3300003758 Ga0055532_1000004 Ga0055532_1000004421 277
213 3300003758 Ga0055532_1000712 Ga0055532_10007124 277
214 3300003790 Ga0055528_1014770 Ga0055528_10147702 277
215 3300003841 Ga0055541_1001187 Ga0055541_10011874 277
216 3300003841 Ga0055541_1007823 Ga0055541_10078232 277
217 3300009011 Ga0105251_10015481 Ga0105251_100154812 277
218 3300009011 Ga0105251_10032735 Ga0105251_100327352 277
219 3300009036 Ga0105244_10006286 Ga0105244_100062866 277
220 3300009092 Ga0105250_10001693 Ga0105250_100016933 277
221 3300009092 Ga0105250_10006163 Ga0105250_100061633 277
222 3300009092 Ga0105250_10022637 Ga0105250_100226372 277
223 3300009092 Ga0105250_10033897 Ga0105250_100338972 277
224 3300009092 Ga0105250_10174053 Ga0105250_101740531 277
225 3300009147 Ga0114129_10460110 Ga0114129_104601102 277
226 3300009148 Ga0105243_10002092 Ga0105243_100020922 277
227 3300009176 Ga0105242_10230406 Ga0105242_102304061 277
228 3300011119 Ga0105246_10006934 Ga0105246_100069346 277
229 3300011119 Ga0105246_10017611 Ga0105246_100176113 277
230 3300013102 Ga0157371_10004977 Ga0157371_100049776 277
231 3300013296 Ga0157374_10090525 Ga0157374_100905252 277
232 3300013297 Ga0157378_10065674 Ga0157378_100656742 277
233 3300014745 Ga0157377_10126543 Ga0157377_101265432 277
234 3300025224 Ga0209784_100041 Ga0209784_100041189 277
235 3300025224 Ga0209784_101672 Ga0209784_1016722 277
236 3300025225 Ga0209566_100076 Ga0209566_10007659 277
237 3300025225 Ga0209566_100351 Ga0209566_10035120 277
238 3300025225 Ga0209566_100938 Ga0209566_1009386 277
239 3300025229 Ga0209147_100010 Ga0209147_10001079 277
240 3300025229 Ga0209147_100053 Ga0209147_100053157 277
241 3300025229 Ga0209147_100245 Ga0209147_10024544 277
242 3300025229 Ga0209147_101270 Ga0209147_1012702 277
243 3300025242 Ga0209258_102595 Ga0209258_1025953 277
244 3300025284 Ga0209130_1004614 Ga0209130_10046142 277
245 3300025284 Ga0209130_1004734 Ga0209130_10047342 277
246 3300025284 Ga0209130_1013854 Ga0209130_10138542 277
247 3300025284 Ga0209130_1036316 Ga0209130_10363162 277
248 3300025291 Ga0209675_1014709 Ga0209675_10147092 277
249 3300025292 Ga0209676_1001610 Ga0209676_10016103 277
250 3300025292 Ga0209676_1014058 Ga0209676_10140581 277
251 3300025292 Ga0209676_1014312 Ga0209676_10143123 277
252 3300025294 Ga0209025_1000302 Ga0209025_1000302101 277
253 3300025294 Ga0209025_1000931 Ga0209025_100093111 277
254 3300025294 Ga0209025_1001319 Ga0209025_10013192 277
255 3300025294 Ga0209025_1001392 Ga0209025_100139229 277
256 3300025294 Ga0209025_1001875 Ga0209025_10018756 277
257 3300025294 Ga0209025_1002476 Ga0209025_10024764 277
258 3300025294 Ga0209025_1004054 Ga0209025_100405411 277
259 3300025294 Ga0209025_1005227 Ga0209025_10052274 277
260 3300025294 Ga0209025_1008332 Ga0209025_10083323 277
261 3300025294 Ga0209025_1008546 Ga0209025_10085462 277
262 3300025294 Ga0209025_1008794 Ga0209025_10087947 277
263 3300025294 Ga0209025_1009244 Ga0209025_10092442 277
264 3300025294 Ga0209025_1013413 Ga0209025_10134135 277
265 3300025294 Ga0209025_1019984 Ga0209025_10199845 277
266 3300025294 Ga0209025_1021778 Ga0209025_10217782 277
267 3300025294 Ga0209025_1022025 Ga0209025_10220252 277
268 3300025711 Ga0207696_1003324 Ga0207696_10033243 277
269 3300025711 Ga0207696_1009673 Ga0207696_10096732 277
270 3300025711 Ga0207696_1013494 Ga0207696_10134942 277
271 3300025728 Ga0207655_1005283 Ga0207655_10052832 277
272 3300025728 Ga0207655_1034951 Ga0207655_10349511 277
273 3300025728 Ga0207655_1038103 Ga0207655_10381031 277
274 3300025728 Ga0207655_1042062 Ga0207655_10420623 277
275 3300025735 Ga0207713_1003207 Ga0207713_10032072 277
276 3300025905 Ga0207685_10043387 Ga0207685_100433871 277
277 3300025934 Ga0207686_10049095 Ga0207686_100490953 277
278 3300030083 Ga0237817_10006 Ga0237817_1000628 277
279 3300031548 Ga0307408_100146312 Ga0307408_1001463122 277
280 3300031548 Ga0307408_100299917 Ga0307408_1002999171 277
281 3300037312 Ga0395899_0046831 Ga0395899_0046831_1664_2530 277
282 3300037466 Ga0395898_0040844 Ga0395898_0040844_1235_2101 277
283 3300037466 Ga0395898_0483413 Ga0395898_0483413_213_1079 277
284 3300038705 Ga0237819_01368 Ga0237819_01368_2553_3419 277
285 3300041404 Ga0439436_0000786 Ga0439436_0000786_5615_6481 277
286 3300042007 Ga0439449_0000071 Ga0439449_0000071_28549_29415 277
287 3300042007 Ga0439449_0016355 Ga0439449_0016355_918_1784 277
288 3300042014 Ga0439457_020859 Ga0439457_020859_346_1212 277
289 3300042015 Ga0439462_0003273 Ga0439462_0003273_2313_3179 277
290 3300042015 Ga0439462_0005182 Ga0439462_0005182_2077_2943 277
291 3300044656 Ga0466969_0001616 Ga0466969_0001616_6157_7044 277
292 3300044684 Ga0466966_0266051 Ga0466966_0266051_119_985 277
293 3300044693 Ga0466961_0008694 Ga0466961_0008694_4752_5618 277
294 3300044735 Ga0466968_0002179 Ga0466968_0002179_504_1391 277
295 3300045049 Ga0466959_0000907 Ga0466959_0000907_6825_7691 277
296 3300045976 Ga0466967_0000070 Ga0466967_0000070_7506_8372 277
297 3300046455 Ga0495603_0137911 Ga0495603_0137911_200_1066 277
298 3300046491 Ga0495584_0009657 Ga0495584_0009657_1347_2213 277
299 3300046492 Ga0495585_0015599 Ga0495585_0015599_373_1239 277
300 3300046530 Ga0495654_0102010 Ga0495654_0102010_299_1165 277
301 3300046557 Ga0495622_0093329 Ga0495622_0093329_380_1246 277
302 3300046558 Ga0495633_0076773 Ga0495633_0076773_140_1006 277
303 3300046794 Ga0495589_0129330 Ga0495589_0129330_167_1033 277
304 3300047323 Ga0495683_0076294 Ga0495683_0076294_531_1397 277
305 3300048091 Ga0495626_0086128 Ga0495626_0086128_407_1273 277
306 3300048903 Ga0496100_0101502 Ga0496100_0101502_227_1093 277
307 3300048904 Ga0496101_0001169 Ga0496101_0001169_2270_3136 277
308 3300048905 Ga0496102_0002061 Ga0496102_0002061_3870_4736 277
309 3300048906 Ga0496103_0133789 Ga0496103_0133789_680_1546 277
310 3300048907 Ga0496104_0001867 Ga0496104_0001867_8252_9118 277
311 3300048908 Ga0496105_0005394 Ga0496105_0005394_404_1270 277
312 3300048909 Ga0496106_0000875 Ga0496106_0000875_13581_14447 277
313 3300048910 Ga0496107_0011386 Ga0496107_0011386_4437_5303 277
314 3300048912 Ga0496109_0180278 Ga0496109_0180278_227_1093 277
315 3300048913 Ga0496110_0010798 Ga0496110_0010798_310_1176 277
316 3300048913 Ga0496110_0169001 Ga0496110_0169001_891_1757 277
317 3300048914 Ga0496111_0003946 Ga0496111_0003946_7912_8778 277
318 3300048915 Ga0496112_0002742 Ga0496112_0002742_11913_12779 277
319 3300048915 Ga0496112_0069492 Ga0496112_0069492_921_1787 277
320 3300048916 Ga0496113_0000788 Ga0496113_0000788_5010_5876 277
321 3300048919 Ga0496116_0014110 Ga0496116_0014110_339_1205 277
322 3300048919 Ga0496116_0042129 Ga0496116_0042129_1965_2831 277
323 3300048923 Ga0496120_0032976 Ga0496120_0032976_148_1014 277
324 3300048925 Ga0496122_0007978 Ga0496122_0007978_3602_4468 277
325 3300048925 Ga0496122_0010117 Ga0496122_0010117_3370_4236 277
326 3300048925 Ga0496122_0088332 Ga0496122_0088332_667_1533 277
327 3300048925 Ga0496122_0119118 Ga0496122_0119118_295_1161 277
328 3300048927 Ga0496124_0011390 Ga0496124_0011390_1389_2255 277
329 3300048928 Ga0496125_0004367 Ga0496125_0004367_1613_2479 277
330 3300048929 Ga0496126_0011884 Ga0496126_0011884_3057_3923 277
331 3300049127 Ga0501306_000348 Ga0501306_000348_907_1773 277
332 3300049129 Ga0501309_003111 Ga0501309_003111_817_1683 277
333 3300049131 Ga0501341_00137 Ga0501341_00137_1214_2080 277
334 3300049132 Ga0501343_000047 Ga0501343_000047_1855_2721 277
335 3300049132 Ga0501343_000771 Ga0501343_000771_21_887 277
336 3300049133 Ga0501344_00138 Ga0501344_00138_19_885 277
337 3300049133 Ga0501344_02118 Ga0501344_02118_126_992 277
338 3300049161 Ga0501305_000530 Ga0501305_000530_117_983 277
339 3300049161 Ga0501305_000987 Ga0501305_000987_1679_2545 277
340 3300049161 Ga0501305_001923 Ga0501305_001923_12_881 277
341 3300049528 Ga0501312_008684 Ga0501312_008684_433_1299 277
342 3300049529 Ga0501313_007897 Ga0501313_007897_292_1158 277
343 3300049530 Ga0501314_001224 Ga0501314_001224_943_1809 277
344 3300049530 Ga0501314_008680 Ga0501314_008680_13_879 277
345 3300049531 Ga0501315_000037 Ga0501315_000037_1865_2731 277
346 3300049533 Ga0501317_000473 Ga0501317_000473_1862_2728 277
347 3300049537 Ga0501321_000382 Ga0501321_000382_1860_2726 277
348 3300049538 Ga0501322_000918 Ga0501322_000918_19_885 277
349 3300049539 Ga0501323_007144 Ga0501323_007144_24_890 277
350 3300049540 Ga0501324_007973 Ga0501324_007973_20_886 277
351 3300049543 Ga0501327_01212 Ga0501327_01212_115_981 277
352 3300049544 Ga0501328_00352 Ga0501328_00352_615_1481 277
353 3300049546 Ga0501330_003585 Ga0501330_003585_14_880 277
354 3300049548 Ga0501332_00329 Ga0501332_00329_1101_1967 277
355 3300049549 Ga0501333_003762 Ga0501333_003762_54_920 277
356 3300049549 Ga0501333_003832 Ga0501333_003832_21_887 277
357 3300049551 Ga0501335_000363 Ga0501335_000363_141_1007 277
358 3300049551 Ga0501335_000418 Ga0501335_000418_35_901 277
359 3300049551 Ga0501335_002772 Ga0501335_002772_566_1432 277
360 3300049551 Ga0501335_007864 Ga0501335_007864_55_921 277
361 3300049552 Ga0501336_000276 Ga0501336_000276_1433_2299 277
362 3300049552 Ga0501336_000488 Ga0501336_000488_172_1038 277
363 3300049553 Ga0501337_000379 Ga0501337_000379_882_1748 277
364 3300049553 Ga0501337_000633 Ga0501337_000633_67_933 277
365 3300049556 Ga0501340_000187 Ga0501340_000187_1379_2245 277
366 3300053085 Ga0495619_0004171 Ga0495619_0004171_3613_4491 277
367 3300059424 Ga0590075_001493 Ga0590075_001493_1166_2050 277
368 3300059503 Ga0587080_001113 Ga0587080_001113_1775_2659 277
369 3300059640 Ga0587067_000908 Ga0587067_000908_404_1270 277
370 iso_pu_bacteria 2738543010 2739231177 277
371 iso_pu_bacteria 2857604169 2857605202 277
372 iso_pu_bacteria 2857609550 2857611956 277
373 3300005445 Ga0070708_100069247 Ga0070708_1000692472 278
374 3300005467 Ga0070706_100214634 Ga0070706_1002146342 278
375 3300022467 Ga0224712_10056016 Ga0224712_100560161 278
376 2162886007 SwRhRL2b_contig_1296820 SwRhRL2b_0759.00004120 279
377 3300005289 Ga0065704_10003626 Ga0065704_100036262 279
378 3300005295 Ga0065707_10016287 Ga0065707_100162871 279
379 3300005328 Ga0070676_10358970 Ga0070676_103589701 279
380 3300005364 Ga0070673_100207458 Ga0070673_1002074582 279
381 3300005445 Ga0070708_100136394 Ga0070708_1001363942 279
382 3300005518 Ga0070699_100073049 Ga0070699_1000730494 279
383 3300005536 Ga0070697_100032542 Ga0070697_1000325422 279
384 3300005543 Ga0070672_100047740 Ga0070672_1000477402 279
385 3300005617 Ga0068859_100169071 Ga0068859_1001690712 279
386 3300005618 Ga0068864_100080813 Ga0068864_1000808132 279
387 3300006237 Ga0097621_100597108 Ga0097621_1005971081 279
388 3300006358 Ga0068871_100077779 Ga0068871_1000777793 279
389 3300006844 Ga0075428_100067020 Ga0075428_1000670202 279
390 3300006852 Ga0075433_10105245 Ga0075433_101052452 279
391 3300006852 Ga0075433_10115788 Ga0075433_101157882 279
392 3300006871 Ga0075434_100005428 Ga0075434_10000542810 279
393 3300006871 Ga0075434_100214311 Ga0075434_1002143112 279
394 3300006871 Ga0075434_100363214 Ga0075434_1003632142 279
395 3300006880 Ga0075429_100046068 Ga0075429_1000460682 279
396 3300006914 Ga0075436_100044308 Ga0075436_1000443082 279
397 3300006931 Ga0097620_100169065 Ga0097620_1001690652 279
398 3300007076 Ga0075435_100008876 Ga0075435_1000088768 279
399 3300007076 Ga0075435_100404942 Ga0075435_1004049422 279
400 3300009094 Ga0111539_10019694 Ga0111539_100196944 279
401 3300013297 Ga0157378_10075778 Ga0157378_100757783 279
402 3300025931 Ga0207644_10028438 Ga0207644_100284382 279
403 3300025940 Ga0207691_10087760 Ga0207691_100877602 279
404 3300026088 Ga0207641_10359203 Ga0207641_103592032 279
405 3300026089 Ga0207648_10198228 Ga0207648_101982282 279
406 3300026118 Ga0207675_100601153 Ga0207675_1006011531 279
407 3300047318 Ga0495636_0022954 Ga0495636_0022954_1279_2139 279
408 3300050507 nmdc:mga05p37_131506_c1 nmdc:mga05p37_131506_c1_619_1479 279
409 3300050512 nmdc:mga0n895_123218_c1 nmdc:mga0n895_123218_c1_656_1516 279
410 3300050512 nmdc:mga0n895_469720_c1 nmdc:mga0n895_469720_c1_124_1017 279
411 3300050512 nmdc:mga0n895_5651_c1 nmdc:mga0n895_5651_c1_6804_7697 279
412 3300050513 nmdc:mga0rr50_5763_c1 nmdc:mga0rr50_5763_c1_743_1636 279
413 3300050515 nmdc:mga0a205_130356_c1 nmdc:mga0a205_130356_c1_122_1015 279
414 3300050515 nmdc:mga0a205_84295_c1 nmdc:mga0a205_84295_c1_1509_2369 279

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12367

PFO_beta_C

Pyruvate ferredoxin oxidoreductase beta subunit C terminal

206

271

0.94

PF02775

TPP_enzyme_C

Thiamine pyrophosphate enzyme, C-terminal TPP binding domain

54

202

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
5b46-assembly1.cif.gz_B-2 2-oxoacid:ferredoxin oxidoreductase 2 from sulfolobus tokodai - ligand free form 0.8646 8 279
6n2o-assembly1.cif.gz_D 2-oxoglutarate:ferredoxin oxidoreductase from magnetococcus marinus with 2-oxoglutarate, coenzyme a and succinyl-coa bound 0.8522 2 274
5b46-assembly1.cif.gz_B-2 2-oxoacid:ferredoxin oxidoreductase 2 from sulfolobus tokodai - ligand free form 0.8414 8 279
6n2o-assembly1.cif.gz_D 2-oxoglutarate:ferredoxin oxidoreductase from magnetococcus marinus with 2-oxoglutarate, coenzyme a and succinyl-coa bound 0.8325 2 274
5b48-assembly1.cif.gz_B 2-oxoacid:ferredoxin oxidoreductase 1 from sulfolobus tokodai 0.8199 8 279
ID Description Score Start End Superfamily
af_Q2FZ04_70_219_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.8854 67 202 3.40.50.970
af_Q57957_74_243_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.8649 70 210 3.40.50.970
af_O53181_117_260_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.8637 76 203 3.40.50.970
af_Q2FZ04_70_219_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.8034 67 202 3.40.50.970
af_O53181_117_260_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.7704 76 203 3.40.50.970
ID Description Score Start End GO Terms
AF-A0A846NTQ4-F1-model_v4 2-oxoacid ferredoxin oxidoreductase 0.9473 125 243 GO:0006082
GO:0044272
AF-A0A846NEX7-F1-model_v4 2-oxoacid:ferredoxin oxidoreductase subunit beta 0.9408 1 107 GO:0006082
GO:0016625
GO:0030976
GO:0044272
AF-A0A7C6TUY6-F1-model_v4 2-oxoacid:ferredoxin oxidoreductase subunit beta 0.9365 2 228 GO:0016625
GO:0030976
GO:0051536
AF-A0A7C7MM77-F1-model_v4 2-oxoacid:ferredoxin oxidoreductase subunit beta 0.9362 2 243 GO:0006082
GO:0016625
GO:0030976
GO:0044272
GO:0051536
AF-A0A0F9IQV4-F1-model_v4 Thiamine pyrophosphate enzyme TPP-binding domain-containing protein 0.9346 2 113 GO:0016625
GO:0030976

Feature Viewer

pLDDT pTM Quality
86.71 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map